{ "uniprot_canonical_ac": "P01569-1", "uniprot_ac": "P01569", "uniprot_id": "IFNA5_HUMAN", "mass": { "chemical_mass": 21942.0, "monoisotopic_mass": 21942.0 }, "refseq": { "ac": "NP_002160", "name": "interferon alpha-5 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002160" }, "gene_names": [ { "name": "IFNA5", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P01569", "id": "P01569" }, { "name": "IFN-alpha-5; IFN-alphaG; INA5; INFA5; leIF G", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002160", "id": "NP_002160" }, { "name": "IFNA5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002160", "id": "NP_002160" } ], "protein_names": [ { "name": "Interferon alpha-5", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P01569" }, { "name": "IFN-alpha-5", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01569" }, { "name": "Interferon alpha-61", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01569" }, { "name": "Interferon alpha-G", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01569" }, { "name": "LeIF G", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01569" }, { "name": "interferon alpha-5 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002160", "id": "NP_002160" }, { "name": "interferon alpha-G; interferon alpha-61", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002160", "id": "NP_002160" } ], "function": [ { "annotation": "Observational study of gene-disease association. (HuGE Navigator)", "evidence": [ { "database": "RefSeq", "id": "NP_002160", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002160" }, { "database": "PubMed", "id": "18953482", "url": "https://glygen.org/publication/PubMed/18953482" }, { "database": "PubMed", "id": "17703412", "url": "https://glygen.org/publication/PubMed/17703412" } ] }, { "annotation": "Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.", "evidence": [ { "database": "UniProtKB", "id": "P01569", "url": "https://www.uniprot.org/uniprot/P01569#function" } ] }, { "annotation": "This is the first report of positive association of IFNA gene in SLE, especially the role of specific subtypes IFNA1 and IFNA5. GeneRIF: Observational study of gene-gene interaction. (HuGE Navigator)", "evidence": [ { "database": "RefSeq", "id": "NP_002160", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002160" }, { "database": "PubMed", "id": "19000144", "url": "https://glygen.org/publication/PubMed/19000144" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "39.02", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000147873", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000147873" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "41.27", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000147873", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000147873" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "27.66", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000147873", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000147873" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000147873", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000147873" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "54.38", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000147873", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000147873" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "24.15", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000147873", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000147873" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000147873", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000147873" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "39.16", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000147873", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000147873" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "26.48", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000147873", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000147873" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000147873", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000147873" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "27.72", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000147873", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000147873" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "26.16", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000147873", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000147873" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "27.5", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000147873", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000147873" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P01569", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01569" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P01569", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01569" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P01569", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01569" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P01569", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01569" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01569", "url": "https://www.uniprot.org/uniprot/P01569" } ], "common_name": "Human" } ], "gene": [ { "name": "IFNA5", "url": "https://www.uniprot.org/uniprot/P01569", "locus": { "chromosome": "9", "start_pos": 21304326, "end_pos": 21305313, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000147873", "url": "https://www.ensembl.org/id/ENSG00000147873" } ] } } ], "crossref": [ { "id": "ENSG00000147873", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000147873", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00095", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00095", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL3856161", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3856161", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "IFNA5", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=IFNA5", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "3442", "url": "https://www.ncbi.nlm.nih.gov/gene/3442", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "5426", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=5426", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P01569", "url": "https://www.ebi.ac.uk/intact/interactors/id:P01569*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000471", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000471", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009079", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009079", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:3442", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3442", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "147565", "url": "http://www.omim.org/entry/147565", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P01569", "url": "https://www.nextprot.org/entry/NX_P01569", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "RRTLMIM", "url": "https://omabrowser.org/oma/group/RRTLMIM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5358931at2759", "url": "http://www.orthodb.org/?query=5358931at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11691", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11691", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11691:SF60", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11691:SF60", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00143", "url": "http://pfam.xfam.org/family/PF00143", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P01569", "url": "https://pharos.nih.gov/targets/P01569", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P01569", "url": "http://purl.obolibrary.org/obo/PR_P01569", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-912694", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912694", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-933541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933541", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9833109", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833109", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_002160", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002160", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P01569", "url": "https://www.uniprot.org/uniprot/P01569", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01569-1", "url": "https://www.uniprot.org/uniprot/P01569-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MALPFVLLMALVVLNCKSICSLGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWDETLLDKFYTELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSANLQERLRRKE", "length": 189, "header": "sp|P01569-1|IFNA5_HUMAN Isoform 1 of Interferon alpha-5 OS=Homo sapiens OX=9606 GN=IFNA5 PE=1 SV=1 CANONICAL=P01569-1" }, "isoforms": [ { "isoform_ac": "P01569-1", "url": "", "sequence": { "sequence": "MALPFVLLMALVVLNCKSICSLGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWDETLLDKFYTELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSANLQERLRRKE", "length": 189, "header": "sp|P01569-1|IFNA5_HUMAN Isoform 1 of Interferon alpha-5 OS=Homo sapiens OX=9606 GN=IFNA5 PE=1 SV=1 CANONICAL=P01569-1" }, "locus": { "chromosome": "9", "start_pos": 21305256, "end_pos": 21304690, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000610521.2", "url": "https://www.ensembl.org/id/ENST00000610521.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000484479.1", "url": "https://www.ensembl.org/id/ENSP00000484479.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Shp-2 tyrosine phosphatase functions as a negative regulator of the interferon-stimulated Jak/STAT pathway.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "You M, Yu DH, Feng GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-912694", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912694" } ], "reference": [ { "type": "PubMed", "id": "10022928", "url": "https://glygen.org/publication/PubMed/10022928" } ] }, { "title": "Determination of residues involved in ligand binding and signal transmission in the human IFN-alpha receptor 2.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Chuntharapai A, Gibbs V, Lu J, Ow A, Marsters S, Ashkenazi A, De Vos A, Jin Kim K", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "10395669", "url": "https://glygen.org/publication/PubMed/10395669" } ] }, { "title": "IKK-i, a novel lipopolysaccharide-inducible kinase that is related to IkappaB kinases.", "journal": "International immunology", "date": "1999", "authors": "Shimada T, Kawai T, Takeda K, Matsumoto M, Inoue J, Tatsumi Y, Kanamaru A, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-933541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933541" } ], "reference": [ { "type": "PubMed", "id": "10421793", "url": "https://glygen.org/publication/PubMed/10421793" } ] }, { "title": "Catalytically active TYK2 is essential for interferon-beta-mediated phosphorylation of STAT3 and interferon-alpha receptor-1 (IFNAR-1) but not for activation of phosphoinositol 3-kinase.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Rani MR, Leaman DW, Han Y, Leung S, Croze E, Fish EN, Wolfman A, Ransohoff RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "10542297", "url": "https://glygen.org/publication/PubMed/10542297" } ] }, { "title": "NF-kappaB activation by a signaling complex containing TRAF2, TANK and TBK1, a novel IKK-related kinase.", "journal": "The EMBO journal", "date": "1999", "authors": "Pomerantz JL, Baltimore D", "evidence": [ { "database": "Reactome", "id": "R-HSA-933541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933541" } ], "reference": [ { "type": "PubMed", "id": "10581243", "url": "https://glygen.org/publication/PubMed/10581243" } ] }, { "title": "Regulation of STAT1 nuclear export by Jak1.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Mowen K, David M", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "10982844", "url": "https://glygen.org/publication/PubMed/10982844" } ] }, { "title": "Multitasking in signal transduction by a promiscuous human Ins(3,4,5,6)P(4) 1-kinase/Ins(1,3,4)P(3) 5/6-kinase.", "journal": "The Biochemical journal", "date": "2000", "authors": "Yang X, Shears SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "11042108", "url": "https://glygen.org/publication/PubMed/11042108" } ] }, { "title": "Rabenosyn-5, a novel Rab5 effector, is complexed with hVPS45 and recruited to endosomes through a FYVE finger domain.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Nielsen E, Christoforidis S, Uttenweiler-Joseph S, Miaczynska M, Dewitte F, Wilm M, Hoflack B, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "11062261", "url": "https://glygen.org/publication/PubMed/11062261" } ] }, { "title": "Phosphorylation-induced dimerization of interferon regulatory factor 7 unmasks DNA binding and a bipartite transactivation domain.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Marie I, Smith E, Prakash A, Levy DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-933541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933541" } ], "reference": [ { "type": "PubMed", "id": "11073981", "url": "https://glygen.org/publication/PubMed/11073981" } ] }, { "title": "Gene structure and function of the 2'-5'-oligoadenylate synthetase family.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2000", "authors": "Justesen J, Hartmann R, Kjeldgaard NO", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "11092454", "url": "https://glygen.org/publication/PubMed/11092454" } ] }, { "title": "Methylation of histone H3 lysine 9 creates a binding site for HP1 proteins.", "journal": "Nature", "date": "2001", "authors": "Lachner M, O'Carroll D, Rea S, Mechtler K, Jenuwein T", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "11242053", "url": "https://glygen.org/publication/PubMed/11242053" } ] }, { "title": "Inositol hexakisphosphate kinase 2 mediates growth suppressive and apoptotic effects of interferon-beta in ovarian carcinoma cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Morrison BH, Bauer JA, Kalvakolanu DV, Lindner DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "11337497", "url": "https://glygen.org/publication/PubMed/11337497" } ] }, { "title": "Effect of early interferon treatment on conversion to definite multiple sclerosis: a randomised study.", "journal": "Lancet (London, England)", "date": "2001", "authors": "Comi G, Filippi M, Barkhof F, Durelli L, Edan G, Fernandez O, Hartung H, Seeldrayers P, Sorensen PS, Rovaris M, Martinelli V, Hommes OR", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "11377645", "url": "https://glygen.org/publication/PubMed/11377645" } ] }, { "title": "Functional classification of interferon-stimulated genes identified using microarrays.", "journal": "Journal of leukocyte biology", "date": "2001", "authors": "de Veer MJ, Holko M, Frevel M, Walker E, Der S, Paranjape JM, Silverman RH, Williams BR", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "11404376", "url": "https://glygen.org/publication/PubMed/11404376" } ] }, { "title": "The 2-5A/RNase L/RNase L inhibitor (RLI) [correction of (RNI)] pathway regulates mitochondrial mRNAs stability in interferon alpha-treated H9 cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Le Roy F, Bisbal C, Silhol M, Martinand C, Lebleu B, Salehzada T", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "11585831", "url": "https://glygen.org/publication/PubMed/11585831" } ] }, { "title": "TYK2 and JAK2 are substrates of protein-tyrosine phosphatase 1B.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Myers MP, Andersen JN, Cheng A, Tremblay ML, Horvath CM, Parisien JP, Salmeen A, Barford D, Tonks NK", "evidence": [ { "database": "Reactome", "id": "R-HSA-912694", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912694" } ], "reference": [ { "type": "PubMed", "id": "11694501", "url": "https://glygen.org/publication/PubMed/11694501" } ] }, { "title": "RAD51C interacts with RAD51B and is central to a larger protein complex in vivo exclusive of RAD51.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Miller KA, Yoshikawa DM, McConnell IR, Clark R, Schild D, Albala JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "11744692", "url": "https://glygen.org/publication/PubMed/11744692" } ] }, { "title": "Mediator function of the human Rad51B-Rad51C complex in Rad51/RPA-catalyzed DNA strand exchange.", "journal": "Genes & development", "date": "2001", "authors": "Sigurdsson S, Van Komen S, Bussen W, Schild D, Albala JS, Sung P", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "11751636", "url": "https://glygen.org/publication/PubMed/11751636" } ] }, { "title": "The human beta-globin locus control region.", "journal": "European journal of biochemistry", "date": "2002", "authors": "Levings PP, Bungert J", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "11895428", "url": "https://glygen.org/publication/PubMed/11895428" } ] }, { "title": "Membrane topology and mitochondrial targeting of mitofusins, ubiquitous mammalian homologs of the transmembrane GTPase Fzo.", "journal": "Journal of cell science", "date": "2002", "authors": "Rojo M, Legros F, Chateau D, Lombes A", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "11950885", "url": "https://glygen.org/publication/PubMed/11950885" } ] }, { "title": "PYPAF7, a novel PYRIN-containing Apaf1-like protein that regulates activation of NF-kappa B and caspase-1-dependent cytokine processing.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Wang L, Manji GA, Grenier JM, Al-Garawi A, Merriam S, Lora JM, Geddes BJ, Briskin M, DiStefano PS, Bertin J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "12019269", "url": "https://glygen.org/publication/PubMed/12019269" } ] }, { "title": "Identification of X-linked inhibitor of apoptosis-associated factor-1 as an interferon-stimulated gene that augments TRAIL Apo2L-induced apoptosis.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Leaman DW, Chawla-Sarkar M, Vyas K, Reheman M, Tamai K, Toji S, Borden EC", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "12029096", "url": "https://glygen.org/publication/PubMed/12029096" } ] }, { "title": "A core-BRAF35 complex containing histone deacetylase mediates repression of neuronal-specific genes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Hakimi MA, Bochar DA, Chenoweth J, Lane WS, Mandel G, Shiekhattar R", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "12032298", "url": "https://glygen.org/publication/PubMed/12032298" } ] }, { "title": "Association of the adaptor TANK with the I kappa B kinase (IKK) regulator NEMO connects IKK complexes with IKK epsilon and TBK1 kinases.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Chariot A, Leonardi A, Muller J, Bonif M, Brown K, Siebenlist U", "evidence": [ { "database": "Reactome", "id": "R-HSA-933541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933541" } ], "reference": [ { "type": "PubMed", "id": "12133833", "url": "https://glygen.org/publication/PubMed/12133833" } ] }, { "title": "Unconventional Rac-GEF activity is mediated through the Dock180-ELMO complex.", "journal": "Nature cell biology", "date": "2002", "authors": "Brugnera E, Haney L, Grimsley C, Lu M, Walk SF, Tosello-Trampont AC, Macara IG, Madhani H, Fink GR, Ravichandran KS", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "12134158", "url": "https://glygen.org/publication/PubMed/12134158" } ] }, { "title": "Complex formation by the human Rad51B and Rad51C DNA repair proteins and their activities in vitro.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Lio YC, Mazin AV, Kowalczykowski SC, Chen DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "12427746", "url": "https://glygen.org/publication/PubMed/12427746" } ] }, { "title": "Interferon regulatory factor-7 synergizes with other transcription factors through multiple interactions with p300/CBP coactivators.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Yang H, Lin CH, Ma G, Baffi MO, Wathelet MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-933541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933541" } ], "reference": [ { "type": "PubMed", "id": "12604599", "url": "https://glygen.org/publication/PubMed/12604599" } ] }, { "title": "IKKepsilon and TBK1 are essential components of the IRF3 signaling pathway.", "journal": "Nature immunology", "date": "2003", "authors": "Fitzgerald KA, McWhirter SM, Faia KL, Rowe DC, Latz E, Golenbock DT, Coyle AJ, Liao SM, Maniatis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "12692549", "url": "https://glygen.org/publication/PubMed/12692549" } ] }, { "title": "Cutting edge: Monarch-1: a pyrin/nucleotide-binding domain/leucine-rich repeat protein that controls classical and nonclassical MHC class I genes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2003", "authors": "Williams KL, Taxman DJ, Linhoff MW, Reed W, Ting JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "12759408", "url": "https://glygen.org/publication/PubMed/12759408" } ] }, { "title": "Apoptosis and interferons: role of interferon-stimulated genes as mediators of apoptosis.", "journal": "Apoptosis : an international journal on programmed cell death", "date": "2003", "authors": "Chawla-Sarkar M, Lindner DJ, Liu YF, Williams BR, Sen GC, Silverman RH, Borden EC", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "12766484", "url": "https://glygen.org/publication/PubMed/12766484" } ] }, { "title": "The human type I interferon receptor: NMR structure reveals the molecular basis of ligand binding.", "journal": "Structure (London, England : 1993)", "date": "2003", "authors": "Chill JH, Quadt SR, Levy R, Schreiber G, Anglister J", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "12842042", "url": "https://glygen.org/publication/PubMed/12842042" } ] }, { "title": "Novel growth and death related interferon-stimulated genes (ISGs) in melanoma: greater potency of IFN-beta compared with IFN-alpha2.", "journal": "Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research", "date": "2003", "authors": "Leaman DW, Chawla-Sarkar M, Jacobs B, Vyas K, Sun Y, Ozdemir A, Yi T, Williams BR, Borden EC", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "14769151", "url": "https://glygen.org/publication/PubMed/14769151" } ] }, { "title": "Rabenosyn-5 and EHD1 interact and sequentially regulate protein recycling to the plasma membrane.", "journal": "Molecular biology of the cell", "date": "2004", "authors": "Naslavsky N, Boehm M, Backlund PS Jr, Caplan S", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "15020713", "url": "https://glygen.org/publication/PubMed/15020713" } ] }, { "title": "Human MxA protein inhibits the replication of Crimean-Congo hemorrhagic fever virus.", "journal": "Journal of virology", "date": "2004", "authors": "Andersson I, Bladh L, Mousavi-Jazi M, Magnusson KE, Lundkvist A, Haller O, Mirazimi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "15047845", "url": "https://glygen.org/publication/PubMed/15047845" } ] }, { "title": "The RNA helicase RIG-I has an essential function in double-stranded RNA-induced innate antiviral responses.", "journal": "Nature immunology", "date": "2004", "authors": "Yoneyama M, Kikuchi M, Natsukawa T, Shinobu N, Imaizumi T, Miyagishi M, Taira K, Akira S, Fujita T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "15208624", "url": "https://glygen.org/publication/PubMed/15208624" } ] }, { "title": "The novel Cdc42 guanine nucleotide exchange factor, zizimin1, dimerizes via the Cdc42-binding CZH2 domain.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Meller N, Irani-Tehrani M, Ratnikov BI, Paschal BM, Schwartz MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "15247287", "url": "https://glygen.org/publication/PubMed/15247287" } ] }, { "title": "Ligand-induced assembling of the type I interferon receptor on supported lipid bilayers.", "journal": "Journal of molecular biology", "date": "2004", "authors": "Lamken P, Lata S, Gavutis M, Piehler J", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "15312780", "url": "https://glygen.org/publication/PubMed/15312780" } ] }, { "title": "Signal peptide prediction based on analysis of experimentally verified cleavage sites.", "journal": "Protein Sci.", "date": "2004", "authors": "Zhang Z, Henzel WJ", "evidence": [ { "database": "UniProtKB", "id": "P01569", "url": "https://www.uniprot.org/uniprot/P01569" } ], "reference": [ { "type": "PubMed", "id": "15340161", "url": "https://glygen.org/publication/PubMed/15340161" } ] }, { "title": "Interferon-alpha induction through Toll-like receptors involves a direct interaction of IRF7 with MyD88 and TRAF6.", "journal": "Nature immunology", "date": "2004", "authors": "Kawai T, Sato S, Ishii KJ, Coban C, Hemmi H, Yamamoto M, Terai K, Matsuda M, Inoue J, Uematsu S, Takeuchi O, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-933541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933541" } ], "reference": [ { "type": "PubMed", "id": "15361868", "url": "https://glygen.org/publication/PubMed/15361868" } ] }, { "title": "Identification of residues of the IFNAR1 chain of the type I human interferon receptor critical for ligand binding and biological activity.", "journal": "Biochemistry", "date": "2004", "authors": "Cajean-Feroldi C, Nosal F, Nardeux PC, Gallet X, Guymarho J, Baychelier F, Sempe P, Tovey MG, Escary JL, Eid P", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "15449939", "url": "https://glygen.org/publication/PubMed/15449939" } ] }, { "title": "Zizimin2: a novel, DOCK180-related Cdc42 guanine nucleotide exchange factor expressed predominantly in lymphocytes.", "journal": "FEBS letters", "date": "2005", "authors": "Nishikimi A, Meller N, Uekawa N, Isobe K, Schwartz MA, Maruyama M", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "15710388", "url": "https://glygen.org/publication/PubMed/15710388" } ] }, { "title": "Lateral ligand-receptor interactions on membranes probed by simultaneous fluorescence-interference detection.", "journal": "Biophysical journal", "date": "2005", "authors": "Gavutis M, Lata S, Lamken P, Muller P, Piehler J", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "15778442", "url": "https://glygen.org/publication/PubMed/15778442" } ] }, { "title": "Human ISG15 conjugation targets both IFN-induced and constitutively expressed proteins functioning in diverse cellular pathways.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Zhao C, Denison C, Huibregtse JM, Gygi S, Krug RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "16009940", "url": "https://glygen.org/publication/PubMed/16009940" } ] }, { "title": "Mammalian CARMIL inhibits actin filament capping by capping protein.", "journal": "Developmental cell", "date": "2005", "authors": "Yang C, Pring M, Wear MA, Huang M, Cooper JA, Svitkina TM, Zigmond SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "16054028", "url": "https://glygen.org/publication/PubMed/16054028" } ] }, { "title": "Identification and characterization of MAVS, a mitochondrial antiviral signaling protein that activates NF-kappaB and IRF 3.", "journal": "Cell", "date": "2005", "authors": "Seth RB, Sun L, Ea CK, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833109", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833109" } ], "reference": [ { "type": "PubMed", "id": "16125763", "url": "https://glygen.org/publication/PubMed/16125763" } ] }, { "title": "IPS-1, an adaptor triggering RIG-I- and Mda5-mediated type I interferon induction.", "journal": "Nature immunology", "date": "2005", "authors": "Kawai T, Takahashi K, Sato S, Coban C, Kumar H, Kato H, Ishii KJ, Takeuchi O, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833109", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833109" } ], "reference": [ { "type": "PubMed", "id": "16127453", "url": "https://glygen.org/publication/PubMed/16127453" } ] }, { "title": "VISA is an adapter protein required for virus-triggered IFN-beta signaling.", "journal": "Molecular cell", "date": "2005", "authors": "Xu LG, Wang YY, Han KJ, Li LY, Zhai Z, Shu HB", "evidence": [ { "database": "Reactome", "id": "R-HSA-933541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933541" } ], "reference": [ { "type": "PubMed", "id": "16153868", "url": "https://glygen.org/publication/PubMed/16153868" } ] }, { "title": "Mutational analysis of the IFNAR1 binding site on IFNalpha2 reveals the architecture of a weak ligand-receptor binding-site.", "journal": "Journal of molecular biology", "date": "2005", "authors": "Roisman LC, Jaitin DA, Baker DP, Schreiber G", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "16171819", "url": "https://glygen.org/publication/PubMed/16171819" } ] }, { "title": "Inducible processing of interferon regulatory factor-2.", "journal": "Molecular and cellular biology", "date": "1992", "authors": "Palombella VJ, Maniatis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "1630448", "url": "https://glygen.org/publication/PubMed/1630448" } ] }, { "title": "UBP43 is a novel regulator of interferon signaling independent of its ISG15 isopeptidase activity.", "journal": "The EMBO journal", "date": "2006", "authors": "Malakhova OA, Kim KI, Luo JK, Zou W, Kumar KG, Fuchs SY, Shuai K, Zhang DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-912694", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912694" } ], "reference": [ { "type": "PubMed", "id": "16710296", "url": "https://glygen.org/publication/PubMed/16710296" } ] }, { "title": "Induction of IRF-3 and IRF-7 phosphorylation following activation of the RIG-I pathway.", "journal": "Cellular and molecular biology (Noisy-le-Grand, France)", "date": "2006", "authors": "Paz S, Sun Q, Nakhaei P, Romieu-Mourez R, Goubau D, Julkunen I, Lin R, Hiscott J", "evidence": [ { "database": "Reactome", "id": "R-HSA-933541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933541" } ], "reference": [ { "type": "PubMed", "id": "16914100", "url": "https://glygen.org/publication/PubMed/16914100" } ] }, { "title": "The Epstein-Barr virus-encoded LMP-1 oncoprotein negatively affects Tyk2 phosphorylation and interferon signaling in human B cells.", "journal": "Journal of virology", "date": "2006", "authors": "Geiger TR, Martin JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "16987978", "url": "https://glygen.org/publication/PubMed/16987978" } ] }, { "title": "Dock4 is regulated by RhoG and promotes Rac-dependent cell migration.", "journal": "Experimental cell research", "date": "2006", "authors": "Hiramoto K, Negishi M, Katoh H", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "17027967", "url": "https://glygen.org/publication/PubMed/17027967" } ] }, { "title": "Dock6, a Dock-C subfamily guanine nucleotide exchanger, has the dual specificity for Rac1 and Cdc42 and regulates neurite outgrowth.", "journal": "Experimental cell research", "date": "2007", "authors": "Miyamoto Y, Yamauchi J, Sanbe A, Tanoue A", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "17196961", "url": "https://glygen.org/publication/PubMed/17196961" } ] }, { "title": "Respiratory syncytial virus NS1 protein degrades STAT2 by using the Elongin-Cullin E3 ligase.", "journal": "Journal of virology", "date": "2007-04", "authors": "Elliott Joanne, Lynch Oonagh T, Suessmuth Yvonne, Qian Ping, Boyd Caroline R, Burrows James F, Buick Richard, Stevenson Nigel J, Touzelet Olivier, Gadina Massimo, Power Ultan F, Johnston James A", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "17251292", "url": "https://glygen.org/publication/PubMed/17251292" } ] }, { "title": "Regulation of the Egr-1 gene by tumor necrosis factor and interferons in primary human fibroblasts.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Cao XM, Guy GR, Sukhatme VP, Tan YH", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "1730654", "url": "https://glygen.org/publication/PubMed/1730654" } ] }, { "title": "Modulation of the interferon antiviral response by the TBK1/IKKi adaptor protein TANK.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Guo B, Cheng G", "evidence": [ { "database": "Reactome", "id": "R-HSA-933541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933541" } ], "reference": [ { "type": "PubMed", "id": "17327220", "url": "https://glygen.org/publication/PubMed/17327220" } ] }, { "title": "STAT activation and differential complex formation dictate selectivity of interferon responses.", "journal": "Acta biochimica Polonica", "date": "2007", "authors": "Wesoly J, Szweykowska-Kulinska Z, Bluyssen HA", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "17351669", "url": "https://glygen.org/publication/PubMed/17351669" } ] }, { "title": "TRIM25 RING-finger E3 ubiquitin ligase is essential for RIG-I-mediated antiviral activity.", "journal": "Nature", "date": "2007", "authors": "Gack MU, Shin YC, Joo CH, Urano T, Liang C, Sun L, Takeuchi O, Akira S, Chen Z, Inoue S, Jung JU", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833109", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833109" } ], "reference": [ { "type": "PubMed", "id": "17392790", "url": "https://glygen.org/publication/PubMed/17392790" } ] }, { "title": "Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.", "journal": "The Journal of infectious diseases", "date": "2007", "authors": "Janssen R, Bont L, Siezen CL, Hodemaekers HM, Ermers MJ, Doornbos G, van 't Slot R, Wijmenga C, Goeman JJ, Kimpen JL, van Houwelingen HC, Kimman TG, Hoebee B", "evidence": [ { "database": "RefSeq", "id": "NP_002160", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002160" } ], "reference": [ { "type": "PubMed", "id": "17703412", "url": "https://glygen.org/publication/PubMed/17703412" } ] }, { "title": "The receptor of the type I interferon family.", "journal": "Current topics in microbiology and immunology", "date": "2007", "authors": "Uze G, Schreiber G, Piehler J, Pellegrini S", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "17969444", "url": "https://glygen.org/publication/PubMed/17969444" } ] }, { "title": "Full results of the Evidence of Interferon Dose-Response-European North American Comparative Efficacy (EVIDENCE) study: a multicenter, randomized, assessor-blinded comparison of low-dose weekly versus high-dose, high-frequency interferon beta-1a for relapsing multiple sclerosis.", "journal": "Clinical therapeutics", "date": "2007", "authors": "Schwid SR, Panitch HS", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "18035202", "url": "https://glygen.org/publication/PubMed/18035202" } ] }, { "title": "Protein tyrosine phosphatases in the JAK/STAT pathway.", "journal": "Frontiers in bioscience : a journal and virtual library", "date": "2008", "authors": "Xu D, Qu CK", "evidence": [ { "database": "Reactome", "id": "R-HSA-912694", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912694" } ], "reference": [ { "type": "PubMed", "id": "18508557", "url": "https://glygen.org/publication/PubMed/18508557" } ] }, { "title": "Interferon-inducible antiviral effectors.", "journal": "Nature reviews. Immunology", "date": "2008", "authors": "Sadler AJ, Williams BR", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "18575461", "url": "https://glygen.org/publication/PubMed/18575461" } ] }, { "title": "Polymorphisms of interferons and their receptors in the genetics of severe RSV-associated diseases.", "journal": "Archives of virology", "date": "2008", "authors": "Mailaparambil B, Jochum J, Forster J, Heinze J, Krueger M, Heinzmann A", "evidence": [ { "database": "RefSeq", "id": "NP_002160", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002160" } ], "reference": [ { "type": "PubMed", "id": "18953482", "url": "https://glygen.org/publication/PubMed/18953482" } ] }, { "title": "Genetic association of interferon-alpha subtypes 1, 2 and 5 in systemic lupus erythematosus.", "journal": "Tissue antigens", "date": "2008", "authors": "Hirankarn N, Tangwattanachuleeporn M, Wongpiyabovorn J, Wongchinsri J, Avihingsanon Y", "evidence": [ { "database": "RefSeq", "id": "NP_002160", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002160" } ], "reference": [ { "type": "PubMed", "id": "19000144", "url": "https://glygen.org/publication/PubMed/19000144" } ] }, { "title": "Human respiratory syncytial virus nonstructural protein NS2 antagonizes the activation of beta interferon transcription by interacting with RIG-I.", "journal": "Journal of virology", "date": "2009-04", "authors": "Ling Zhenhua, Tran Kim C, Teng Michael N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833109", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833109" } ], "reference": [ { "type": "PubMed", "id": "19193793", "url": "https://glygen.org/publication/PubMed/19193793" } ] }, { "title": "Lnk inhibits myeloproliferative disorder-associated JAK2 mutant, JAK2V617F.", "journal": "Journal of leukocyte biology", "date": "2009", "authors": "Gery S, Cao Q, Gueller S, Xing H, Tefferi A, Koeffler HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "19293402", "url": "https://glygen.org/publication/PubMed/19293402" } ] }, { "title": "TRAF6 establishes innate immune responses by activating NF-kappaB and IRF7 upon sensing cytosolic viral RNA and DNA.", "journal": "PloS one", "date": "2009", "authors": "Konno H, Yamamoto T, Yamazaki K, Gohda J, Akiyama T, Semba K, Goto H, Kato A, Yujiri T, Imai T, Kawaguchi Y, Su B, Takeuchi O, Akira S, Tsunetsugu-Yokota Y, Inoue J", "evidence": [ { "database": "Reactome", "id": "R-HSA-933541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933541" } ], "reference": [ { "type": "PubMed", "id": "19479062", "url": "https://glygen.org/publication/PubMed/19479062" } ] }, { "title": "TANK is a negative regulator of Toll-like receptor signaling and is critical for the prevention of autoimmune nephritis.", "journal": "Nature immunology", "date": "2009", "authors": "Kawagoe T, Takeuchi O, Takabatake Y, Kato H, Isaka Y, Tsujimura T, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-933541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933541" } ], "reference": [ { "type": "PubMed", "id": "19668221", "url": "https://glygen.org/publication/PubMed/19668221" } ] }, { "title": "Structural insights into interferon regulatory factor activation.", "journal": "Cellular signalling", "date": "2010", "authors": "Chen W, Royer WE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-933541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933541" } ], "reference": [ { "type": "PubMed", "id": "20043992", "url": "https://glygen.org/publication/PubMed/20043992" } ] }, { "title": "Preclinical characterization of the selective JAK1/2 inhibitor INCB018424: therapeutic implications for the treatment of myeloproliferative neoplasms.", "journal": "Blood", "date": "2010", "authors": "Quintas-Cardama A, Vaddi K, Liu P, Manshouri T, Li J, Scherle PA, Caulder E, Wen X, Li Y, Waeltz P, Rupar M, Burn T, Lo Y, Kelley J, Covington M, Shepard S, Rodgers JD, Haley P, Kantarjian H, Fridman JS, Verstovsek S", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "20130243", "url": "https://glygen.org/publication/PubMed/20130243" } ] }, { "title": "Selective inhibition of JAK1 and JAK2 is efficacious in rodent models of arthritis: preclinical characterization of INCB028050.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2010", "authors": "Fridman JS, Scherle PA, Collins R, Burn TC, Li Y, Li J, Covington MB, Thomas B, Collier P, Favata MF, Wen X, Shi J, McGee R, Haley PJ, Shepard S, Rodgers JD, Yeleswaram S, Hollis G, Newton RC, Metcalf B, Friedman SM, Vaddi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "20363976", "url": "https://glygen.org/publication/PubMed/20363976" } ] }, { "title": "Regulation of mouse steroidogenesis by WHISTLE and JMJD1C through histone methylation balance.", "journal": "Nucleic acids research", "date": "2010", "authors": "Kim SM, Kim JY, Choe NW, Cho IH, Kim JR, Kim DW, Seol JE, Lee SE, Kook H, Nam KI, Kook H, Bhak YY, Seo SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "20530532", "url": "https://glygen.org/publication/PubMed/20530532" } ] }, { "title": "Regulation of immune cell homeostasis by type I interferons.", "journal": "Cytokine & growth factor reviews", "date": "2010", "authors": "Mattei F, Schiavoni G, Tough DF", "evidence": [ { "database": "Reactome", "id": "R-HSA-933541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933541" } ], "reference": [ { "type": "PubMed", "id": "20627800", "url": "https://glygen.org/publication/PubMed/20627800" } ] }, { "title": "Molecular basis for the recognition of phosphorylated STAT1 by importin alpha5.", "journal": "Journal of molecular biology", "date": "2010", "authors": "Nardozzi J, Wenta N, Yasuhara N, Vinkemeier U, Cingolani G", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "20643137", "url": "https://glygen.org/publication/PubMed/20643137" } ] }, { "title": "A novel mechanism for the inhibition of interferon regulatory factor-3-dependent gene expression by human respiratory syncytial virus NS1 protein.", "journal": "The Journal of general virology", "date": "2011-09", "authors": "Ren Junping, Liu Tianshuang, Pang Lan, Li Kui, Garofalo Roberto P, Casola Antonella, Bao Xiaoyong", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833109", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833109" } ], "reference": [ { "type": "PubMed", "id": "21632562", "url": "https://glygen.org/publication/PubMed/21632562" } ] }, { "title": "Mitochondrial GTP-AMP phosphotransferase. 2. Kinetic and equilibrium dialysis studies.", "journal": "European journal of biochemistry", "date": "1979", "authors": "Tomasselli AG, Noda LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "218813", "url": "https://glygen.org/publication/PubMed/218813" } ] }, { "title": "Differential expression and distinct structure of 69- and 100-kDa forms of 2-5A synthetase in human cells treated with interferon.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Marie I, Svab J, Robert N, Galabru J, Hovanessian AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "2211721", "url": "https://glygen.org/publication/PubMed/2211721" } ] }, { "title": "Respiratory syncytial virus NS1 protein colocalizes with mitochondrial antiviral signaling protein MAVS following infection.", "journal": "PloS one", "date": "2012", "authors": "Boyapalle Sandhya, Wong Terianne, Garay Julio, Teng Michael, San Juan-Vergara Homero, Mohapatra Subhra, Mohapatra Shyam", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833109", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833109" } ], "reference": [ { "type": "PubMed", "id": "22383950", "url": "https://glygen.org/publication/PubMed/22383950" } ] }, { "title": "Molecular basis of Tank-binding kinase 1 activation by transautophosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Ma X, Helgason E, Phung QT, Quan CL, Iyer RS, Lee MW, Bowman KK, Starovasnik MA, Dueber EC", "evidence": [ { "database": "Reactome", "id": "R-HSA-933541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933541" } ], "reference": [ { "type": "PubMed", "id": "22619329", "url": "https://glygen.org/publication/PubMed/22619329" } ] }, { "title": "TAK1, more than just innate immunity.", "journal": "IUBMB life", "date": "2012", "authors": "Dai L, Aye Thu C, Liu XY, Xi J, Cheung PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "22941947", "url": "https://glygen.org/publication/PubMed/22941947" } ] }, { "title": "Discovery of potent and selective pyrazolopyrimidine janus kinase 2 inhibitors.", "journal": "Journal of medicinal chemistry", "date": "2012", "authors": "Hanan EJ, van Abbema A, Barrett K, Blair WS, Blaney J, Chang C, Eigenbrot C, Flynn S, Gibbons P, Hurley CA, Kenny JR, Kulagowski J, Lee L, Magnuson SR, Morris C, Murray J, Pastor RM, Rawson T, Siu M, Ultsch M, Zhou A, Sampath D, Lyssikatos JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "23061660", "url": "https://glygen.org/publication/PubMed/23061660" } ] }, { "title": "Distinct and overlapping genomic profiles and antiviral effects of Interferon-lambda and -alpha on HCV-infected and noninfected hepatoma cells.", "journal": "Journal of viral hepatitis", "date": "2012", "authors": "Kohli A, Zhang X, Yang J, Russell RS, Donnelly RP, Sheikh F, Sherman A, Young H, Imamichi T, Lempicki RA, Masur H, Kottilil S", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "23121362", "url": "https://glygen.org/publication/PubMed/23121362" } ] }, { "title": "Crystal structure and mechanism of activation of TANK-binding kinase 1.", "journal": "Cell reports", "date": "2013", "authors": "Larabi A, Devos JM, Ng SL, Nanao MH, Round A, Maniatis T, Panne D", "evidence": [ { "database": "Reactome", "id": "R-HSA-933541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933541" } ], "reference": [ { "type": "PubMed", "id": "23453971", "url": "https://glygen.org/publication/PubMed/23453971" } ] }, { "title": "Discovery and development of Janus kinase (JAK) inhibitors for inflammatory diseases.", "journal": "Journal of medicinal chemistry", "date": "2014", "authors": "Clark JD, Flanagan ME, Telliez JB", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "24417533", "url": "https://glygen.org/publication/PubMed/24417533" } ] }, { "title": "Functionally distinct effects of the C-terminal regions of IKKepsilon and TBK1 on type I IFN production.", "journal": "PloS one", "date": "2014", "authors": "Nakatsu Y, Matsuoka M, Chang TH, Otsuki N, Noda M, Kimura H, Sakai K, Kato H, Takeda M, Kubota T", "evidence": [ { "database": "Reactome", "id": "R-HSA-933541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933541" } ], "reference": [ { "type": "PubMed", "id": "24722368", "url": "https://glygen.org/publication/PubMed/24722368" } ] }, { "title": "Evidence for the efficacy of interferon beta-1b in delaying the onset of clinically definite multiple sclerosis in individuals with clinically isolated syndrome.", "journal": "Therapeutic advances in neurological disorders", "date": "2014", "authors": "Freedman MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "25371710", "url": "https://glygen.org/publication/PubMed/25371710" } ] }, { "title": "Properties and catalytic activities of MICAL1, the flavoenzyme involved in cytoskeleton dynamics, and modulation by its CH, LIM and C-terminal domains.", "journal": "Archives of biochemistry and biophysics", "date": "2016", "authors": "Vitali T, Maffioli E, Tedeschi G, Vanoni MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "26845023", "url": "https://glygen.org/publication/PubMed/26845023" } ] }, { "title": "Differential induction of interferon stimulated genes between type I and type III interferons is independent of interferon receptor abundance.", "journal": "PLoS pathogens", "date": "2018", "authors": "Pervolaraki K, Rastgou Talemi S, Albrecht D, Bormann F, Bamford C, Mendoza JL, Garcia KC, McLauchlan J, Hofer T, Stanifer ML, Boulant S", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "30485383", "url": "https://glygen.org/publication/PubMed/30485383" } ] }, { "title": "Human Respiratory Syncytial Virus NS 1 Targets TRIM25 to Suppress RIG-I Ubiquitination and Subsequent RIG-I-Mediated Antiviral Signaling.", "journal": "Viruses", "date": "2018", "authors": "Ban J, Lee NR, Lee NJ, Lee JK, Quan FS, Inn KS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833109", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833109" } ], "reference": [ { "type": "PubMed", "id": "30558248", "url": "https://glygen.org/publication/PubMed/30558248" } ] }, { "title": "ZBP1 and TAK1: Master Regulators of NLRP3 Inflammasome/Pyroptosis, Apoptosis, and Necroptosis (PAN-optosis).", "journal": "Frontiers in cellular and infection microbiology", "date": "2019", "authors": "Malireddi RKS, Kesavardhana S, Kanneganti TD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "31850239", "url": "https://glygen.org/publication/PubMed/31850239" } ] }, { "title": "Baricitinib as potential treatment for 2019-nCoV acute respiratory disease.", "journal": "Lancet (London, England)", "date": "2020", "authors": "Richardson P, Griffin I, Tucker C, Smith D, Oechsle O, Phelan A, Rawling M, Savory E, Stebbing J", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "32032529", "url": "https://glygen.org/publication/PubMed/32032529" } ] }, { "title": "COVID-19: combining antiviral and anti-inflammatory treatments.", "journal": "The Lancet. Infectious diseases", "date": "2020", "authors": "Stebbing J, Phelan A, Griffin I, Tucker C, Oechsle O, Smith D, Richardson P", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "32113509", "url": "https://glygen.org/publication/PubMed/32113509" } ] }, { "title": "A SARS-CoV-2 protein interaction map reveals targets for drug repurposing.", "journal": "Nature", "date": "2020", "authors": "Gordon DE, Jang GM, Bouhaddou M, Xu J, Obernier K, White KM, O'Meara MJ, Rezelj VV, Guo JZ, Swaney DL, Tummino TA, Huttenhain R, Kaake RM, Richards AL, Tutuncuoglu B, Foussard H, Batra J, Haas K, Modak M, Kim M, Haas P, Polacco BJ, Braberg H, Fabius JM, Eckhardt M, Soucheray M, Bennett MJ, Cakir M, McGregor MJ, Li Q, Meyer B, Roesch F, Vallet T, Mac Kain A, Miorin L, Moreno E, Naing ZZC, Zhou Y, Peng S, Shi Y, Zhang Z, Shen W, Kirby IT, Melnyk JE, Chorba JS, Lou K, Dai SA, Barrio-Hernandez I, Memon D, Hernandez-Armenta C, Lyu J, Mathy CJP, Perica T, Pilla KB, Ganesan SJ, Saltzberg DJ, Rakesh R, Liu X, Rosenthal SB, Calviello L, Venkataramanan S, Liboy-Lugo J, Lin Y, Huang XP, Liu Y, Wankowicz SA, Bohn M, Safari M, Ugur FS, Koh C, Savar NS, Tran QD, Shengjuler D, Fletcher SJ, O'Neal MC, Cai Y, Chang JCJ, Broadhurst DJ, Klippsten S, Sharp PP, Wenzell NA, Kuzuoglu-Ozturk D, Wang HY, Trenker R, Young JM, Cavero DA, Hiatt J, Roth TL, Rathore U, Subramanian A, Noack J, Hubert M, Stroud RM, Frankel AD, Rosenberg OS, Verba KA, Agard DA, Ott M, Emerman M, Jura N, von Zastrow M, Verdin E, Ashworth A, Schwartz O, d'Enfert C, Mukherjee S, Jacobson M, Malik HS, Fujimori DG, Ideker T, Craik CS, Floor SN, Fraser JS, Gross JD, Sali A, Roth BL, Ruggero D, Taunton J, Kortemme T, Beltrao P, Vignuzzi M, Garcia-Sastre A, Shokat KM, Shoichet BK, Krogan NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "32353859", "url": "https://glygen.org/publication/PubMed/32353859" } ] }, { "title": "Characterization and Noncovalent Inhibition of the Deubiquitinase and deISGylase Activity of SARS-CoV-2 Papain-Like Protease.", "journal": "ACS infectious diseases", "date": "2020", "authors": "Freitas BT, Durie IA, Murray J, Longo JE, Miller HC, Crich D, Hogan RJ, Tripp RA, Pegan SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "32428392", "url": "https://glygen.org/publication/PubMed/32428392" } ] }, { "title": "Discovery of a Janus Kinase Inhibitor Bearing a Highly Three-Dimensional Spiro Scaffold: JTE-052 (Delgocitinib) as a New Dermatological Agent to Treat Inflammatory Skin Disorders.", "journal": "Journal of medicinal chemistry", "date": "2020", "authors": "Noji S, Hara Y, Miura T, Yamanaka H, Maeda K, Hori A, Yamamoto H, Obika S, Inoue M, Hase Y, Orita T, Doi S, Adachi T, Tanimoto A, Oki C, Kimoto Y, Ogawa Y, Negoro T, Hashimoto H, Shiozaki M", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "32511913", "url": "https://glygen.org/publication/PubMed/32511913" } ] }, { "title": "Interferon-alpha2b Treatment for COVID-19.", "journal": "Frontiers in immunology", "date": "2020", "authors": "Zhou Q, Chen V, Shannon CP, Wei XS, Xiang X, Wang X, Wang ZH, Tebbutt SJ, Kollmann TR, Fish EN", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "32574262", "url": "https://glygen.org/publication/PubMed/32574262" } ] }, { "title": "The ORF6, ORF8 and nucleocapsid proteins of SARS-CoV-2 inhibit type I interferon signaling pathway.", "journal": "Virus research", "date": "2020", "authors": "Li JY, Liao CH, Wang Q, Tan YJ, Luo R, Qiu Y, Ge XY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "32589897", "url": "https://glygen.org/publication/PubMed/32589897" } ] }, { "title": "A Randomized Clinical Trial of the Efficacy and Safety of Interferon beta-1a in Treatment of Severe COVID-19.", "journal": "Antimicrobial agents and chemotherapy", "date": "2020", "authors": "Davoudi-Monfared E, Rahmani H, Khalili H, Hajiabdolbaghi M, Salehi M, Abbasian L, Kazemzadeh H, Yekaninejad MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "32661006", "url": "https://glygen.org/publication/PubMed/32661006" } ] }, { "title": "Papain-like protease regulates SARS-CoV-2 viral spread and innate immunity.", "journal": "Nature", "date": "2020", "authors": "Shin D, Mukherjee R, Grewe D, Bojkova D, Baek K, Bhattacharya A, Schulz L, Widera M, Mehdipour AR, Tascher G, Geurink PP, Wilhelm A, van der Heden van Noort GJ, Ovaa H, Muller S, Knobeloch KP, Rajalingam K, Schulman BA, Cinatl J, Hummer G, Ciesek S, Dikic I", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "32726803", "url": "https://glygen.org/publication/PubMed/32726803" } ] }, { "title": "SARS-CoV-2 Orf9b suppresses type I interferon responses by targeting TOM70.", "journal": "Cellular & molecular immunology", "date": "2020", "authors": "Jiang HW, Zhang HN, Meng QF, Xie J, Li Y, Chen H, Zheng YX, Wang XN, Qi H, Zhang J, Wang PH, Han ZG, Tao SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "32728199", "url": "https://glygen.org/publication/PubMed/32728199" } ] }, { "title": "SARS-CoV-2 clearance in COVID-19 patients with Novaferon treatment: A randomized, open-label, parallel-group trial.", "journal": "International journal of infectious diseases : IJID : official publication of the International Society for Infectious Diseases", "date": "2020", "authors": "Zheng F, Zhou Y, Zhou Z, Ye F, Huang B, Huang Y, Ma J, Zuo Q, Tan X, Xie J, Niu P, Wang W, Xu Y, Peng F, Zhou N, Cai C, Tang W, Xiao X, Li Y, Zhou Z, Jiang Y, Xie Y, Tan W, Gong G", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "32758689", "url": "https://glygen.org/publication/PubMed/32758689" } ] }, { "title": "Interferon beta-1b in treatment of severe COVID-19: A randomized clinical trial.", "journal": "International immunopharmacology", "date": "2020", "authors": "Rahmani H, Davoudi-Monfared E, Nourian A, Khalili H, Hajizadeh N, Jalalabadi NZ, Fazeli MR, Ghazaeian M, Yekaninejad MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "32862111", "url": "https://glygen.org/publication/PubMed/32862111" } ] }, { "title": "SARS-CoV-2 N protein antagonizes type I interferon signaling by suppressing phosphorylation and nuclear translocation of STAT1 and STAT2.", "journal": "Cell discovery", "date": "2020", "authors": "Mu J, Fang Y, Yang Q, Shu T, Wang A, Huang M, Jin L, Deng F, Qiu Y, Zhou X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "32953130", "url": "https://glygen.org/publication/PubMed/32953130" } ] }, { "title": "Evasion of Type I Interferon by SARS-CoV-2.", "journal": "Cell reports", "date": "2020", "authors": "Xia H, Cao Z, Xie X, Zhang X, Chen JY, Wang H, Menachery VD, Rajsbaum R, Shi PY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "32979938", "url": "https://glygen.org/publication/PubMed/32979938" } ] }, { "title": "Main protease of SARS-CoV-2 serves as a bifunctional molecule in restricting type I interferon antiviral signaling.", "journal": "Signal transduction and targeted therapy", "date": "2020", "authors": "Wu Y, Ma L, Zhuang Z, Cai S, Zhao Z, Zhou L, Zhang J, Wang PH, Zhao J, Cui J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33024073", "url": "https://glygen.org/publication/PubMed/33024073" } ] }, { "title": "Comparative host-coronavirus protein interaction networks reveal pan-viral disease mechanisms.", "journal": "Science (New York, N.Y.)", "date": "2020", "authors": "Gordon DE, Hiatt J, Bouhaddou M, Rezelj VV, Ulferts S, Braberg H, Jureka AS, Obernier K, Guo JZ, Batra J, Kaake RM, Weckstein AR, Owens TW, Gupta M, Pourmal S, Titus EW, Cakir M, Soucheray M, McGregor M, Cakir Z, Jang G, O'Meara MJ, Tummino TA, Zhang Z, Foussard H, Rojc A, Zhou Y, Kuchenov D, Huttenhain R, Xu J, Eckhardt M, Swaney DL, Fabius JM, Ummadi M, Tutuncuoglu B, Rathore U, Modak M, Haas P, Haas KM, Naing ZZC, Pulido EH, Shi Y, Barrio-Hernandez I, Memon D, Petsalaki E, Dunham A, Marrero MC, Burke D, Koh C, Vallet T, Silvas JA, Azumaya CM, Billesbolle C, Brilot AF, Campbell MG, Diallo A, Dickinson MS, Diwanji D, Herrera N, Hoppe N, Kratochvil HT, Liu Y, Merz GE, Moritz M, Nguyen HC, Nowotny C, Puchades C, Rizo AN, Schulze-Gahmen U, Smith AM, Sun M, Young ID, Zhao J, Asarnow D, Biel J, Bowen A, Braxton JR, Chen J, Chio CM, Chio US, Deshpande I, Doan L, Faust B, Flores S, Jin M, Kim K, Lam VL, Li F, Li J, Li YL, Li Y, Liu X, Lo M, Lopez KE, Melo AA, Moss FR 3rd, Nguyen P, Paulino J, Pawar KI, Peters JK, Pospiech TH Jr, Safari M, Sangwan S, Schaefer K, Thomas PV, Thwin AC, Trenker R, Tse E, Tsui TKM, Wang F, Whitis N, Yu Z, Zhang K, Zhang Y, Zhou F, Saltzberg D, Hodder AJ, Shun-Shion AS, Williams DM, White KM, Rosales R, Kehrer T, Miorin L, Moreno E, Patel AH, Rihn S, Khalid MM, Vallejo-Gracia A, Fozouni P, Simoneau CR, Roth TL, Wu D, Karim MA, Ghoussaini M, Dunham I, Berardi F, Weigang S, Chazal M, Park J, Logue J, McGrath M, Weston S, Haupt R, Hastie CJ, Elliott M, Brown F, Burness KA, Reid E, Dorward M, Johnson C, Wilkinson SG, Geyer A, Giesel DM, Baillie C, Raggett S, Leech H, Toth R, Goodman N, Keough KC, Lind AL, Klesh RJ, Hemphill KR, Carlson-Stevermer J, Oki J, Holden K, Maures T, Pollard KS, Sali A, Agard DA, Cheng Y, Fraser JS, Frost A, Jura N, Kortemme T, Manglik A, Southworth DR, Stroud RM, Alessi DR, Davies P, Frieman MB, Ideker T, Abate C, Jouvenet N, Kochs G, Shoichet B, Ott M, Palmarini M, Shokat KM, Garcia-Sastre A, Rassen JA, Grosse R, Rosenberg OS, Verba KA, Basler CF, Vignuzzi M, Peden AA, Beltrao P, Krogan NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33060197", "url": "https://glygen.org/publication/PubMed/33060197" } ] }, { "title": "SARS-CoV-2 Orf6 hijacks Nup98 to block STAT nuclear import and antagonize interferon signaling.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2020", "authors": "Miorin L, Kehrer T, Sanchez-Aparicio MT, Zhang K, Cohen P, Patel RS, Cupic A, Makio T, Mei M, Moreno E, Danziger O, White KM, Rathnasinghe R, Uccellini M, Gao S, Aydillo T, Mena I, Yin X, Martin-Sancho L, Krogan NJ, Chanda SK, Schotsaert M, Wozniak RW, Ren Y, Rosenberg BR, Fontoura BMA, Garcia-Sastre A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33097660", "url": "https://glygen.org/publication/PubMed/33097660" } ] }, { "title": "SARS-CoV-2 membrane glycoprotein M antagonizes the MAVS-mediated innate antiviral response.", "journal": "Cellular & molecular immunology", "date": "2021", "authors": "Fu YZ, Wang SY, Zheng ZQ, Yi Huang, Li WW, Xu ZS, Wang YY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33110251", "url": "https://glygen.org/publication/PubMed/33110251" } ] }, { "title": "The Role of Type I Interferons in the Pathogenesis and Treatment of COVID-19.", "journal": "Frontiers in immunology", "date": "2020", "authors": "Schreiber G", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "33117408", "url": "https://glygen.org/publication/PubMed/33117408" } ] }, { "title": "Safety and efficacy of inhaled nebulised interferon beta-1a (SNG001) for treatment of SARS-CoV-2 infection: a randomised, double-blind, placebo-controlled, phase 2 trial.", "journal": "The Lancet. Respiratory medicine", "date": "2021", "authors": "Monk PD, Marsden RJ, Tear VJ, Brookes J, Batten TN, Mankowski M, Gabbay FJ, Davies DE, Holgate ST, Ho LP, Clark T, Djukanovic R, Wilkinson TMA", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "33189161", "url": "https://glygen.org/publication/PubMed/33189161" } ] }, { "title": "Corrigendum: Interferon-alpha2b Treatment for COVID-19.", "journal": "Frontiers in immunology", "date": "2020", "authors": "Zhou Q, Chen V, Shannon CP, Wei XS, Xiang X, Wang X, Wang ZH, Tebbutt SJ, Kollmann TR, Fish EN", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "33193462", "url": "https://glygen.org/publication/PubMed/33193462" } ] }, { "title": "The SARS-CoV-2 RNA-protein interactome in infected human cells.", "journal": "Nature microbiology", "date": "2021", "authors": "Schmidt N, Lareau CA, Keshishian H, Ganskih S, Schneider C, Hennig T, Melanson R, Werner S, Wei Y, Zimmer M, Ade J, Kirschner L, Zielinski S, Dolken L, Lander ES, Caliskan N, Fischer U, Vogel J, Carr SA, Bodem J, Munschauer M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33349665", "url": "https://glygen.org/publication/PubMed/33349665" } ] }, { "title": "Overexpression of SARS-CoV-2 protein ORF6 dislocates RAE1 and NUP98 from the nuclear pore complex.", "journal": "Biochemical and biophysical research communications", "date": "2021", "authors": "Kato K, Ikliptikawati DK, Kobayashi A, Kondo H, Lim K, Hazawa M, Wong RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33360543", "url": "https://glygen.org/publication/PubMed/33360543" } ] }, { "title": "Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) membrane (M) protein inhibits type I and III interferon production by targeting RIG-I/MDA-5 signaling.", "journal": "Signal transduction and targeted therapy", "date": "2020", "authors": "Zheng Y, Zhuang MW, Han L, Zhang J, Nan ML, Zhan P, Kang D, Liu X, Gao C, Wang PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33372174", "url": "https://glygen.org/publication/PubMed/33372174" } ] }, { "title": "SARS-CoV-2 proteases PLpro and 3CLpro cleave IRF3 and critical modulators of inflammatory pathways (NLRP12 and TAB1): implications for disease presentation across species.", "journal": "Emerging microbes & infections", "date": "2021", "authors": "Moustaqil M, Ollivier E, Chiu HP, Van Tol S, Rudolffi-Soto P, Stevens C, Bhumkar A, Hunter DJB, Freiberg AN, Jacques D, Lee B, Sierecki E, Gambin Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33372854", "url": "https://glygen.org/publication/PubMed/33372854" } ] }, { "title": "Interferon-alpha2b Treatment for COVID-19 Is Associated with Improvements in Lung Abnormalities.", "journal": "Viruses", "date": "2020", "authors": "Zhou Q, MacArthur MR, He X, Wei X, Zarin P, Hanna BS, Wang ZH, Xiang X, Fish EN", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "33396578", "url": "https://glygen.org/publication/PubMed/33396578" } ] }, { "title": "SARS-CoV-2 Nucleocapsid Protein Interacts with RIG-I and Represses RIG-Mediated IFN-beta Production.", "journal": "Viruses", "date": "2020", "authors": "Chen K, Xiao F, Hu D, Ge W, Tian M, Wang W, Pan P, Wu K, Wu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33396605", "url": "https://glygen.org/publication/PubMed/33396605" } ] }, { "title": "MDA5 Governs the Innate Immune Response to SARS-CoV-2 in Lung Epithelial Cells.", "journal": "Cell reports", "date": "2021", "authors": "Yin X, Riva L, Pu Y, Martin-Sancho L, Kanamune J, Yamamoto Y, Sakai K, Gotoh S, Miorin L, De Jesus PD, Yang CC, Herbert KM, Yoh S, Hultquist JF, Garcia-Sastre A, Chanda SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33440148", "url": "https://glygen.org/publication/PubMed/33440148" } ] }, { "title": "SARS-CoV-2 nucleocapsid protein undergoes liquid-liquid phase separation into stress granules through its N-terminal intrinsically disordered region.", "journal": "Cell discovery", "date": "2021", "authors": "Wang J, Shi C, Xu Q, Yin H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33479219", "url": "https://glygen.org/publication/PubMed/33479219" } ] }, { "title": "SARS-CoV-2 nucleocapsid protein phase separates with G3BPs to disassemble stress granules and facilitate viral production.", "journal": "Science bulletin", "date": "2021", "authors": "Luo L, Li Z, Zhao T, Ju X, Ma P, Jin B, Zhou Y, He S, Huang J, Xu X, Zou Y, Li P, Liang A, Liu J, Chi T, Huang X, Ding Q, Jin Z, Huang C, Zhang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33495715", "url": "https://glygen.org/publication/PubMed/33495715" } ] }, { "title": "SARS-CoV-2 triggers an MDA-5-dependent interferon response which is unable to control replication in lung epithelial cells.", "journal": "Journal of virology", "date": "2021", "authors": "Rebendenne A, Valadao ALC, Tauziet M, Maarifi G, Bonaventure B, McKellar J, Planes R, Nisole S, Arnaud-Arnould M, Moncorge O, Goujon C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33514628", "url": "https://glygen.org/publication/PubMed/33514628" } ] }, { "title": "SARS-CoV-2 ORF9b inhibits RIG-I-MAVS antiviral signaling by interrupting K63-linked ubiquitination of NEMO.", "journal": "Cell reports", "date": "2021", "authors": "Wu J, Shi Y, Pan X, Wu S, Hou R, Zhang Y, Zhong T, Tang H, Du W, Wang L, Wo J, Mu J, Qiu Y, Yang K, Zhang LK, Ye BC, Qi N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33567255", "url": "https://glygen.org/publication/PubMed/33567255" } ] }, { "title": "SARS-CoV-2, SARS-CoV-1, and HIV-1 derived ssRNA sequences activate the NLRP3 inflammasome in human macrophages through a non-classical pathway.", "journal": "iScience", "date": "2021", "authors": "Campbell GR, To RK, Hanna J, Spector SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33718825", "url": "https://glygen.org/publication/PubMed/33718825" } ] }, { "title": "Unique and complementary suppression of cGAS-STING and RNA sensing- triggered innate immune responses by SARS-CoV-2 proteins.", "journal": "Signal transduction and targeted therapy", "date": "2021", "authors": "Rui Y, Su J, Shen S, Hu Y, Huang D, Zheng W, Lou M, Shi Y, Wang M, Chen S, Zhao N, Dong Q, Cai Y, Xu R, Zheng S, Yu XF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33723219", "url": "https://glygen.org/publication/PubMed/33723219" } ] }, { "title": "ORF8 contributes to cytokine storm during SARS-CoV-2 infection by activating IL-17 pathway.", "journal": "iScience", "date": "2021", "authors": "Lin X, Fu B, Yin S, Li Z, Liu H, Zhang H, Xing N, Wang Y, Xue W, Xiong Y, Zhang S, Zhao Q, Xu S, Zhang J, Wang P, Nian W, Wang X, Wu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33723527", "url": "https://glygen.org/publication/PubMed/33723527" } ] }, { "title": "ISG15-dependent activation of the sensor MDA5 is antagonized by the SARS-CoV-2 papain-like protease to evade host innate immunity.", "journal": "Nature microbiology", "date": "2021", "authors": "Liu G, Lee JH, Parker ZM, Acharya D, Chiang JJ, van Gent M, Riedl W, Davis-Gardner ME, Wies E, Chiang C, Gack MU", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33727702", "url": "https://glygen.org/publication/PubMed/33727702" } ] }, { "title": "SARS-CoV-2 Nucleocapsid Protein Targets RIG-I-Like Receptor Pathways to Inhibit the Induction of Interferon Response.", "journal": "Cells", "date": "2021", "authors": "Oh SJ, Shin OS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33801464", "url": "https://glygen.org/publication/PubMed/33801464" } ] }, { "title": "CNBP Binds and Unfolds In Vitro G-Quadruplexes Formed in the SARS-CoV-2 Positive and Negative Genome Strands.", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Bezzi G, Piga EJ, Binolfi A, Armas P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33807682", "url": "https://glygen.org/publication/PubMed/33807682" } ] }, { "title": "SARS-CoV-2 ORF6 Disrupts Bidirectional Nucleocytoplasmic Transport through Interactions with Rae1 and Nup98.", "journal": "mBio", "date": "2021", "authors": "Addetia A, Lieberman NAP, Phung Q, Hsiang TY, Xie H, Roychoudhury P, Shrestha L, Loprieno MA, Huang ML, Gale M Jr, Jerome KR, Greninger AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33849972", "url": "https://glygen.org/publication/PubMed/33849972" } ] }, { "title": "RNA-induced liquid phase separation of SARS-CoV-2 nucleocapsid protein facilitates NF-kappaB hyper-activation and inflammation.", "journal": "Signal transduction and targeted therapy", "date": "2021", "authors": "Wu Y, Ma L, Cai S, Zhuang Z, Zhao Z, Jin S, Xie W, Zhou L, Zhang L, Zhao J, Cui J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33895773", "url": "https://glygen.org/publication/PubMed/33895773" } ] }, { "title": "TLR2 senses the SARS-CoV-2 envelope protein to produce inflammatory cytokines.", "journal": "Nature immunology", "date": "2021", "authors": "Zheng M, Karki R, Williams EP, Yang D, Fitzpatrick E, Vogel P, Jonsson CB, Kanneganti TD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33963333", "url": "https://glygen.org/publication/PubMed/33963333" } ] }, { "title": "The SARS-CoV-2 RNA interactome.", "journal": "Molecular cell", "date": "2021", "authors": "Lee S, Lee YS, Choi Y, Son A, Park Y, Lee KM, Kim J, Kim JS, Kim VN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33989516", "url": "https://glygen.org/publication/PubMed/33989516" } ] }, { "title": "Crystal structure of SARS-CoV-2 Orf9b in complex with human TOM70 suggests unusual virus-host interactions.", "journal": "Nature communications", "date": "2021", "authors": "Gao X, Zhu K, Qin B, Olieric V, Wang M, Cui S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33990585", "url": "https://glygen.org/publication/PubMed/33990585" } ] }, { "title": "The ORF8 protein of SARS-CoV-2 mediates immune evasion through down-regulating MHC-Iota.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2021", "authors": "Zhang Y, Chen Y, Li Y, Huang F, Luo B, Yuan Y, Xia B, Ma X, Yang T, Yu F, Liu J, Liu B, Song Z, Chen J, Yan S, Wu L, Pan T, Zhang X, Li R, Huang W, He X, Xiao F, Zhang J, Zhang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34021074", "url": "https://glygen.org/publication/PubMed/34021074" } ] }, { "title": "Human Surfactant Protein D Binds Spike Protein and Acts as an Entry Inhibitor of SARS-CoV-2 Pseudotyped Viral Particles.", "journal": "Frontiers in immunology", "date": "2021", "authors": "Hsieh MH, Beirag N, Murugaiah V, Chou YC, Kuo WS, Kao HF, Madan T, Kishore U, Wang JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34054808", "url": "https://glygen.org/publication/PubMed/34054808" } ] }, { "title": "SARS-CoV-2 Membrane Protein Inhibits Type I Interferon Production Through Ubiquitin-Mediated Degradation of TBK1.", "journal": "Frontiers in immunology", "date": "2021", "authors": "Sui L, Zhao Y, Wang W, Wu P, Wang Z, Yu Y, Hou Z, Tan G, Liu Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34084167", "url": "https://glygen.org/publication/PubMed/34084167" } ] }, { "title": "Regulated expression of a gene encoding a nuclear factor, IRF-1, that specifically binds to IFN-beta gene regulatory elements.", "journal": "Cell", "date": "1988", "authors": "Miyamoto M, Fujita T, Kimura Y, Maruyama M, Harada H, Sudo Y, Miyata T, Taniguchi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "3409321", "url": "https://glygen.org/publication/PubMed/3409321" } ] }, { "title": "Conformational Dynamics in the Interaction of SARS-CoV-2 Papain-like Protease with Human Interferon-Stimulated Gene 15 Protein.", "journal": "The journal of physical chemistry letters", "date": "2021", "authors": "Leite WC, Weiss KL, Phillips G, Zhang Q, Qian S, Tsutakawa SE, Coates L, O'Neill H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34110168", "url": "https://glygen.org/publication/PubMed/34110168" } ] }, { "title": "SARS-CoV-2 viral proteins NSP1 and NSP13 inhibit interferon activation through distinct mechanisms.", "journal": "PloS one", "date": "2021", "authors": "Vazquez C, Swanson SE, Negatu SG, Dittmar M, Miller J, Ramage HR, Cherry S, Jurado KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34166398", "url": "https://glygen.org/publication/PubMed/34166398" } ] }, { "title": "Targeting liquid-liquid phase separation of SARS-CoV-2 nucleocapsid protein promotes innate antiviral immunity by elevating MAVS activity.", "journal": "Nature cell biology", "date": "2021", "authors": "Wang S, Dai T, Qin Z, Pan T, Chu F, Lou L, Zhang L, Yang B, Huang H, Lu H, Zhou F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34239064", "url": "https://glygen.org/publication/PubMed/34239064" } ] }, { "title": "Lectin Pathway Mediates Complement Activation by SARS-CoV-2 Proteins.", "journal": "Frontiers in immunology", "date": "2021", "authors": "Ali YM, Ferrari M, Lynch NJ, Yaseen S, Dudler T, Gragerov S, Demopulos G, Heeney JL, Schwaeble WJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34290717", "url": "https://glygen.org/publication/PubMed/34290717" } ] }, { "title": "SARS-CoV-2 N protein promotes NLRP3 inflammasome activation to induce hyperinflammation.", "journal": "Nature communications", "date": "2021", "authors": "Pan P, Shen M, Yu Z, Ge W, Chen K, Tian M, Xiao F, Wang Z, Wang J, Jia Y, Wang W, Wan P, Zhang J, Chen W, Lei Z, Chen X, Luo Z, Zhang Q, Xu M, Li G, Li Y, Wu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34341353", "url": "https://glygen.org/publication/PubMed/34341353" } ] }, { "title": "SARS-CoV-2-associated ssRNAs activate inflammation and immunity via TLR7/8.", "journal": "JCI insight", "date": "2021", "authors": "Salvi V, Nguyen HO, Sozio F, Schioppa T, Gaudenzi C, Laffranchi M, Scapini P, Passari M, Barbazza I, Tiberio L, Tamassia N, Garlanda C, Del Prete A, Cassatella MA, Mantovani A, Sozzani S, Bosisio D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34375313", "url": "https://glygen.org/publication/PubMed/34375313" } ] }, { "title": "Molecular determinants for regulation of G3BP1/2 phase separation by the SARS-CoV-2 nucleocapsid protein.", "journal": "Cell discovery", "date": "2021", "authors": "Huang W, Ju X, Tian M, Li X, Yu Y, Sun Q, Ding Q, Jia D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34400613", "url": "https://glygen.org/publication/PubMed/34400613" } ] }, { "title": "Full-Length Recombinant hSP-D Binds and Inhibits SARS-CoV-2.", "journal": "Biomolecules", "date": "2021", "authors": "Arroyo R, Grant SN, Colombo M, Salvioni L, Corsi F, Truffi M, Ottolina D, Hurst B, Salzberg M, Prosperi D, Kingma PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34439781", "url": "https://glygen.org/publication/PubMed/34439781" } ] }, { "title": "SARS-CoV-2 N Protein Targets TRIM25-Mediated RIG-I Activation to Suppress Innate Immunity.", "journal": "Viruses", "date": "2021", "authors": "Gori Savellini G, Anichini G, Gandolfo C, Cusi MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34452305", "url": "https://glygen.org/publication/PubMed/34452305" } ] }, { "title": "A dual-role of SARS-CoV-2 nucleocapsid protein in regulating innate immune response.", "journal": "Signal transduction and targeted therapy", "date": "2021", "authors": "Zhao Y, Sui L, Wu P, Wang W, Wang Z, Yu Y, Hou Z, Tan G, Liu Q, Wang G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34471099", "url": "https://glygen.org/publication/PubMed/34471099" } ] }, { "title": "Phosphorylation of SARS-CoV-2 Orf9b Regulates Its Targeting to Two Binding Sites in TOM70 and Recruitment of Hsp90.", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Brandherm L, Kobas AM, Klohn M, Bruggemann Y, Pfaender S, Rassow J, Kreimendahl S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34502139", "url": "https://glygen.org/publication/PubMed/34502139" } ] }, { "title": "The proximal proteome of 17 SARS-CoV-2 proteins links to disrupted antiviral signaling and host translation.", "journal": "PLoS pathogens", "date": "2021", "authors": "Meyers JM, Ramanathan M, Shanderson RL, Beck A, Donohue L, Ferguson I, Guo MG, Rao DS, Miao W, Reynolds D, Yang X, Zhao Y, Yang YY, Blish C, Wang Y, Khavari PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34597346", "url": "https://glygen.org/publication/PubMed/34597346" } ] }, { "title": "Binding of SARS-CoV-2 protein ORF9b to mitochondrial translocase TOM70 prevents its interaction with chaperone HSP90.", "journal": "Biochimie", "date": "2022-09", "authors": "Ayinde Kehinde S, Pinheiro Glaucia M S, Ramos Carlos H I", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "35643212", "url": "https://glygen.org/publication/PubMed/35643212" } ] }, { "title": "Structural relationship of human interferon alpha genes and pseudogenes.", "journal": "J. Mol. Biol.", "date": "1985", "authors": "Henco K, Brosius J, Fujisawa A, Fujisawa JI, Haynes JR, Hochstadt J, Kovacic T, Pasek M, Schambock A, Schmid J, et al.", "evidence": [ { "database": "UniProtKB", "id": "P01569", "url": "https://www.uniprot.org/uniprot/P01569" } ], "reference": [ { "type": "PubMed", "id": "4057246", "url": "https://glygen.org/publication/PubMed/4057246" } ] }, { "title": "Interferon action--sequence specificity of the ppp(A2'p)nA-dependent ribonuclease.", "journal": "Nature", "date": "1981", "authors": "Wreschner DH, McCauley JW, Skehel JJ, Kerr IM", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "6162102", "url": "https://glygen.org/publication/PubMed/6162102" } ] }, { "title": "The structure of eight distinct cloned human leukocyte interferon cDNAs.", "journal": "Nature", "date": "1981", "authors": "Goeddel DV, Leung DW, Dull TJ, Gross M, Lawn RM, McCandliss R, Seeburg PH, Ullrich A, Yelverton E, Gray PW", "evidence": [ { "database": "UniProtKB", "id": "P01569", "url": "https://www.uniprot.org/uniprot/P01569" } ], "reference": [ { "type": "PubMed", "id": "6163083", "url": "https://glygen.org/publication/PubMed/6163083" } ] }, { "title": "Transcriptional and posttranscriptional regulation of interferon-induced gene expression in human cells.", "journal": "Cell", "date": "1984", "authors": "Friedman RL, Manly SP, McMahon M, Kerr IM, Stark GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "6548414", "url": "https://glygen.org/publication/PubMed/6548414" } ] }, { "title": "Interferon-associated, dsRNA-dependent enzyme activities in a mutant 3T6 cell engaged in the semiconstitutive synthesis of interferon.", "journal": "Cell", "date": "1978-08", "authors": "Jarvis A P, White C, Ball A, Gupta S L, Ratner L, Sen G C, Colby C", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "688397", "url": "https://glygen.org/publication/PubMed/688397" } ] }, { "title": "Interferon activation of the transcription factor Stat91 involves dimerization through SH2-phosphotyrosyl peptide interactions.", "journal": "Cell", "date": "1994", "authors": "Shuai K, Horvath CM, Huang LH, Qureshi SA, Cowburn D, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "7510216", "url": "https://glygen.org/publication/PubMed/7510216" } ] }, { "title": "Direct binding to and tyrosine phosphorylation of the alpha subunit of the type I interferon receptor by p135tyk2 tyrosine kinase.", "journal": "Molecular and cellular biology", "date": "1994", "authors": "Colamonici O, Yan H, Domanski P, Handa R, Smalley D, Mullersman J, Witte M, Krishnan K, Krolewski J", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "7526154", "url": "https://glygen.org/publication/PubMed/7526154" } ] }, { "title": "Tyrosine-phosphorylated Stat1 and Stat2 plus a 48-kDa protein all contact DNA in forming interferon-stimulated-gene factor 3.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Qureshi SA, Salditt-Georgieff M, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "7537377", "url": "https://glygen.org/publication/PubMed/7537377" } ] }, { "title": "Transcription factors in interferon signaling.", "journal": "Pharmacology & therapeutics", "date": "1995", "authors": "David M", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "7540766", "url": "https://glygen.org/publication/PubMed/7540766" } ] }, { "title": "Transcription factor ISGF-3 formation requires phosphorylated Stat91 protein, but Stat113 protein is phosphorylated independently of Stat91 protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Improta T, Schindler C, Horvath CM, Kerr IM, Stark GR, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "8197134", "url": "https://glygen.org/publication/PubMed/8197134" } ] }, { "title": "The protein tyrosine kinase JAK1 complements defects in interferon-alpha/beta and -gamma signal transduction.", "journal": "Nature", "date": "1993", "authors": "Muller M, Briscoe J, Laxton C, Guschin D, Ziemiecki A, Silvennoinen O, Harpur AG, Barbieri G, Witthuhn BA, Schindler C, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "8232552", "url": "https://glygen.org/publication/PubMed/8232552" } ] }, { "title": "Phosphorylated interferon-alpha receptor 1 subunit (IFNaR1) acts as a docking site for the latent form of the 113 kDa STAT2 protein.", "journal": "The EMBO journal", "date": "1996", "authors": "Yan H, Krishnan K, Greenlund AC, Gupta S, Lim JT, Schreiber RD, Schindler CW, Krolewski JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "8605876", "url": "https://glygen.org/publication/PubMed/8605876" } ] }, { "title": "Formation of STAT1-STAT2 heterodimers and their role in the activation of IRF-1 gene transcription by interferon-alpha.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Li X, Leung S, Qureshi S, Darnell JE Jr, Stark GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "8621447", "url": "https://glygen.org/publication/PubMed/8621447" } ] }, { "title": "Isolation of inositol 1,3,4-trisphosphate 5/6-kinase, cDNA cloning and expression of the recombinant enzyme.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Wilson MP, Majerus PW", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "8662638", "url": "https://glygen.org/publication/PubMed/8662638" } ] }, { "title": "Interferon-alpha-dependent activation of Tyk2 requires phosphorylation of positive regulatory tyrosines by another kinase.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Gauzzi MC, Velazquez L, McKendry R, Mogensen KE, Fellous M, Pellegrini S", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "8702790", "url": "https://glygen.org/publication/PubMed/8702790" } ] }, { "title": "NF-E2 disrupts chromatin structure at human beta-globin locus control region hypersensitive site 2 in vitro.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Armstrong JA, Emerson BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "8816476", "url": "https://glygen.org/publication/PubMed/8816476" } ] }, { "title": "Direct association with and dephosphorylation of Jak2 kinase by the SH2-domain-containing protein tyrosine phosphatase SHP-1.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Jiao H, Berrada K, Yang W, Tabrizi M, Platanias LC, Yi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-912694", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912694" } ], "reference": [ { "type": "PubMed", "id": "8943354", "url": "https://glygen.org/publication/PubMed/8943354" } ] }, { "title": "Identification of a novel protein kinase A anchoring protein that binds both type I and type II regulatory subunits.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Huang LJ, Durick K, Weiner JA, Chun J, Taylor SS", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "9065479", "url": "https://glygen.org/publication/PubMed/9065479" } ] }, { "title": "A double-stranded RNA-activated protein kinase-dependent pathway mediating stress-induced apoptosis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Der SD, Yang YL, Weissmann C, Williams BR", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "9096384", "url": "https://glygen.org/publication/PubMed/9096384" } ] }, { "title": "Functional subdomains of STAT2 required for preassociation with the alpha interferon receptor and for signaling.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Li X, Leung S, Kerr IM, Stark GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "9121453", "url": "https://glygen.org/publication/PubMed/9121453" } ] }, { "title": "FOG, a multitype zinc finger protein, acts as a cofactor for transcription factor GATA-1 in erythroid and megakaryocytic differentiation.", "journal": "Cell", "date": "1997", "authors": "Tsang AP, Visvader JE, Turner CA, Fujiwara Y, Yu C, Weiss MJ, Crossley M, Orkin SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "9230307", "url": "https://glygen.org/publication/PubMed/9230307" } ] }, { "title": "Distinct STAT structure promotes interaction of STAT2 with the p48 subunit of the interferon-alpha-stimulated transcription factor ISGF3.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Martinez-Moczygemba M, Gutch MJ, French DL, Reich NC", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "9242679", "url": "https://glygen.org/publication/PubMed/9242679" } ] }, { "title": "D-AKAP2, a novel protein kinase A anchoring protein with a putative RGS domain.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Huang LJ, Durick K, Weiner JA, Chun J, Taylor SS", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "9326583", "url": "https://glygen.org/publication/PubMed/9326583" } ] }, { "title": "Vertebrates have conserved capping protein alpha isoforms with specific expression patterns.", "journal": "Cell motility and the cytoskeleton", "date": "1997", "authors": "Hart MC, Korshunova YO, Cooper JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "9331217", "url": "https://glygen.org/publication/PubMed/9331217" } ] }, { "title": "A region of the beta subunit of the interferon alpha receptor different from box 1 interacts with Jak1 and is sufficient to activate the Jak-Stat pathway and induce an antiviral state.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Domanski P, Fish E, Nadeau OW, Witte M, Platanias LC, Yan H, Krolewski J, Pitha P, Colamonici OR", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "9334213", "url": "https://glygen.org/publication/PubMed/9334213" } ] }, { "title": "Structure of IRF-1 with bound DNA reveals determinants of interferon regulation.", "journal": "Nature", "date": "1998", "authors": "Escalante CR, Yie J, Thanos D, Aggarwal AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "9422515", "url": "https://glygen.org/publication/PubMed/9422515" } ] }, { "title": "RNase L inhibitor (RLI) antisense constructions block partially the down regulation of the 2-5A/RNase L pathway in encephalomyocarditis-virus-(EMCV)-infected cells.", "journal": "European journal of biochemistry", "date": "1998", "authors": "Martinand C, Salehzada T, Silhol M, Lebleu B, Bisbal C", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "9660177", "url": "https://glygen.org/publication/PubMed/9660177" } ] }, { "title": "Virus infection induces the assembly of coordinately activated transcription factors on the IFN-beta enhancer in vivo.", "journal": "Molecular cell", "date": "1998", "authors": "Wathelet MG, Lin CH, Parekh BS, Ronco LV, Howley PM, Maniatis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-933541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933541" } ], "reference": [ { "type": "PubMed", "id": "9660935", "url": "https://glygen.org/publication/PubMed/9660935" } ] }, { "title": "Differential viral induction of distinct interferon-alpha genes by positive feedback through interferon regulatory factor-7.", "journal": "The EMBO journal", "date": "1998", "authors": "Marie I, Durbin JE, Levy DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-933541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933541" } ], "reference": [ { "type": "PubMed", "id": "9822609", "url": "https://glygen.org/publication/PubMed/9822609" } ] }, { "title": "RNase L inhibitor is induced during human immunodeficiency virus type 1 infection and down regulates the 2-5A/RNase L pathway in human T cells.", "journal": "Journal of virology", "date": "1999", "authors": "Martinand C, Montavon C, Salehzada T, Silhol M, Lebleu B, Bisbal C", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "9847332", "url": "https://glygen.org/publication/PubMed/9847332" } ] }, { "title": "Identification of genes differentially regulated by interferon alpha, beta, or gamma using oligonucleotide arrays.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Der SD, Zhou A, Williams BR, Silverman RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "9861020", "url": "https://glygen.org/publication/PubMed/9861020" } ] }, { "title": "FOG-2: A novel GATA-family cofactor related to multitype zinc-finger proteins Friend of GATA-1 and U-shaped.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Tevosian SG, Deconinck AE, Cantor AB, Rieff HI, Fujiwara Y, Corfas G, Orkin SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "9927674", "url": "https://glygen.org/publication/PubMed/9927674" } ] } ], "pathway": [ { "id": "hsa:3442", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3442", "resource": "KEGG Pathway" }, { "id": "R-HSA-909733", "name": "Interferon alpha/beta signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733", "resource": "Reactome", "description": "Interferon alpha/beta signaling" }, { "id": "R-HSA-912694", "name": "Regulation of IFNA/IFNB signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912694", "resource": "Reactome", "description": "Regulation of IFNA/IFNB signaling" }, { "id": "R-HSA-933541", "name": "TRAF6 mediated IRF7 activation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933541", "resource": "Reactome", "description": "TRAF6 mediated IRF7 activation" }, { "id": "R-HSA-9705671", "name": "SARS-CoV-2 activates/modulates innate and adaptive immune responses", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671", "resource": "Reactome", "description": "SARS-CoV-2 activates/modulates innate and adaptive immune responses" }, { "id": "R-HSA-983231", "name": "Factors involved in megakaryocyte development and platelet production", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231", "resource": "Reactome", "description": "Factors involved in megakaryocyte development and platelet production" }, { "id": "R-HSA-9833109", "name": "Evasion by RSV of host interferon responses", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833109", "resource": "Reactome", "description": "Evasion by RSV of host interferon responses" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A8I6ANZ6-1", "protein_name": "Uncharacterized protein", "gene_name": "ENSRNOG00000065554", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MARACTSLMALLVVSYSSTCCLGCDLPHTRNLRNKRAFTLLVRQDFGFPQEKVGAQQIQKAQAISVLYELMQQILNIFTSKESSAAWDASLLDSFCNDLQQQLSGLQACLMQQVGVQEPPLTQEDSLLAVREYFHRITVYLREKKHSPCAWEVVRAQVWRALSSSANFEQEKCT", "length": 174 }, "evidence": [ { "id": "P01569", "url": "https://omabrowser.org/oma/group/P01569/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "C8CKA0-1", "protein_name": "Interferon-alpha-9", "gene_name": "IFN-alpha-9", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MAPTSAFLMALVLLSCKAICSLGCDLPQTHSLAHTRALRLLAQMRRISPFSCLDHRRDFGFPQEALGGNQVQKAQAMALVHEMLQQTFQLFSTEGSAAAWNESLLHQFCTGLDQQLRDLEACVMQEVGLEGTPLLEEDSILAVRKYFHRLTLYLQEKSYSPCAWEIVRAEVMRAFSSSTNLQDRLRKKE", "length": 189 }, "evidence": [ { "id": "P01569", "url": "https://omabrowser.org/oma/group/P01569/", "database": "OMA" } ], "common_name": "Pig" }, { "uniprot_canonical_ac": "D3ZFH0-1", "protein_name": "Interferon 1ai2", "gene_name": "Ifna4", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MARLCAFLMVLVVMSYWSACCLGCDLPPTLNLRNKRAFTLLAQMRRLSPVSCLKDRQDFGFPQEKVDAQQIQKAQTIPVLHELSQQVLNIFTSKDSSAAWNATLLDSFCNDLHQQLSDLKVCLMQQVGMQEPPLTQEDSLLAVREYFHRITVYLTEKKHSPCAWEVVRAEVWRALSSSVYLLAKLSEEK", "length": 189 }, "evidence": [ { "id": "45921988", "url": "http://www.informatics.jax.org/homology/45921988", "database": "MGI" }, { "id": "45921984", "url": "http://www.informatics.jax.org/homology/45921984", "database": "MGI" }, { "id": "45921978", "url": "http://www.informatics.jax.org/homology/45921978", "database": "MGI" }, { "id": "45921977", "url": "http://www.informatics.jax.org/homology/45921977", "database": "MGI" }, { "id": "45921976", "url": "http://www.informatics.jax.org/homology/45921976", "database": "MGI" }, { "id": "45921986", "url": "http://www.informatics.jax.org/homology/45921986", "database": "MGI" }, { "id": "45921987", "url": "http://www.informatics.jax.org/homology/45921987", "database": "MGI" }, { "id": "45921985", "url": "http://www.informatics.jax.org/homology/45921985", "database": "MGI" }, { "id": "45921983", "url": "http://www.informatics.jax.org/homology/45921983", "database": "MGI" }, { "id": "45921980", "url": "http://www.informatics.jax.org/homology/45921980", "database": "MGI" }, { "id": "45921981", "url": "http://www.informatics.jax.org/homology/45921981", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "L7MTU6-1", "protein_name": "Interferon 1ai8", "gene_name": "Ifnab", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MARLSTFLMVLAVMSYWSTCPLGCDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIQEAQAIPVLTELTQQMLTLFTSKASSAAWNATLLDSFCNDLHQQLNDLKTCLMQEVGVQESPLTQEDSLLAVRKYFHSITVYLREKKHSPCAWEVVRAEVWRALSSSAKLLASLSEEKE", "length": 190 }, "evidence": [ { "id": "45921987", "url": "http://www.informatics.jax.org/homology/45921987", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P01562-1", "protein_name": "Interferon alpha-1/13", "gene_name": "IFNA13", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MASPFALLMVLVVLSCKSSCSLGCDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE", "length": 189 }, "evidence": [ { "id": "45921988", "url": "http://www.informatics.jax.org/homology/45921988", "database": "MGI" }, { "id": "45921989", "url": "http://www.informatics.jax.org/homology/45921989", "database": "MGI" }, { "id": "45921984", "url": "http://www.informatics.jax.org/homology/45921984", "database": "MGI" }, { "id": "45921979", "url": "http://www.informatics.jax.org/homology/45921979", "database": "MGI" }, { "id": "45921978", "url": "http://www.informatics.jax.org/homology/45921978", "database": "MGI" }, { "id": "45921977", "url": "http://www.informatics.jax.org/homology/45921977", "database": "MGI" }, { "id": "45921976", "url": "http://www.informatics.jax.org/homology/45921976", "database": "MGI" }, { "id": "45921986", "url": "http://www.informatics.jax.org/homology/45921986", "database": "MGI" }, { "id": "45921987", "url": "http://www.informatics.jax.org/homology/45921987", "database": "MGI" }, { "id": "45921985", "url": "http://www.informatics.jax.org/homology/45921985", "database": "MGI" }, { "id": "45921982", "url": "http://www.informatics.jax.org/homology/45921982", "database": "MGI" }, { "id": "45921983", "url": "http://www.informatics.jax.org/homology/45921983", "database": "MGI" }, { "id": "45921980", "url": "http://www.informatics.jax.org/homology/45921980", "database": "MGI" }, { "id": "45921981", "url": "http://www.informatics.jax.org/homology/45921981", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MALTFALLVALLVLSCKSSCSVGCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE", "length": 188 }, "evidence": [ { "id": "45921988", "url": "http://www.informatics.jax.org/homology/45921988", "database": "MGI" }, { "id": "45921989", "url": "http://www.informatics.jax.org/homology/45921989", "database": "MGI" }, { "id": "45921984", "url": "http://www.informatics.jax.org/homology/45921984", "database": "MGI" }, { "id": "45921979", "url": "http://www.informatics.jax.org/homology/45921979", "database": "MGI" }, { "id": "45921978", "url": "http://www.informatics.jax.org/homology/45921978", "database": "MGI" }, { "id": "45921977", "url": "http://www.informatics.jax.org/homology/45921977", "database": "MGI" }, { "id": "45921976", "url": "http://www.informatics.jax.org/homology/45921976", "database": "MGI" }, { "id": "45921986", "url": "http://www.informatics.jax.org/homology/45921986", "database": "MGI" }, { "id": "45921987", "url": "http://www.informatics.jax.org/homology/45921987", "database": "MGI" }, { "id": "45921985", "url": "http://www.informatics.jax.org/homology/45921985", "database": "MGI" }, { "id": "45921982", "url": "http://www.informatics.jax.org/homology/45921982", "database": "MGI" }, { "id": "45921983", "url": "http://www.informatics.jax.org/homology/45921983", "database": "MGI" }, { "id": "45921980", "url": "http://www.informatics.jax.org/homology/45921980", "database": "MGI" }, { "id": "45921981", "url": "http://www.informatics.jax.org/homology/45921981", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLGQMGRISPFSCLKDRHDFRIPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLEACVIQEVGVEETPLMNEDSILAVRKYFQRITLYLIERKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD", "length": 189 }, "evidence": [ { "id": "45921988", "url": "http://www.informatics.jax.org/homology/45921988", "database": "MGI" }, { "id": "45921989", "url": "http://www.informatics.jax.org/homology/45921989", "database": "MGI" }, { "id": "45921984", "url": "http://www.informatics.jax.org/homology/45921984", "database": "MGI" }, { "id": "45921979", "url": "http://www.informatics.jax.org/homology/45921979", "database": "MGI" }, { "id": "45921978", "url": "http://www.informatics.jax.org/homology/45921978", "database": "MGI" }, { "id": "45921977", "url": "http://www.informatics.jax.org/homology/45921977", "database": "MGI" }, { "id": "45921976", "url": "http://www.informatics.jax.org/homology/45921976", "database": "MGI" }, { "id": "45921986", "url": "http://www.informatics.jax.org/homology/45921986", "database": "MGI" }, { "id": "45921987", "url": "http://www.informatics.jax.org/homology/45921987", "database": "MGI" }, { "id": "45921985", "url": "http://www.informatics.jax.org/homology/45921985", "database": "MGI" }, { "id": "45921982", "url": "http://www.informatics.jax.org/homology/45921982", "database": "MGI" }, { "id": "45921983", "url": "http://www.informatics.jax.org/homology/45921983", "database": "MGI" }, { "id": "45921980", "url": "http://www.informatics.jax.org/homology/45921980", "database": "MGI" }, { "id": "45921981", "url": "http://www.informatics.jax.org/homology/45921981", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MARSFSLLMVVLVLSYKSICSLGCDLPQTHSLRNRRALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLEACVIQEVGVEETPLMNEDFILAVRKYFQRITLYLMEKKYSPCAWEVVRAEIMRSFSFSTNLKKGLRRKD", "length": 189 }, "evidence": [ { "id": "45921988", "url": "http://www.informatics.jax.org/homology/45921988", "database": "MGI" }, { "id": "45921989", "url": "http://www.informatics.jax.org/homology/45921989", "database": "MGI" }, { "id": "45921984", "url": "http://www.informatics.jax.org/homology/45921984", "database": "MGI" }, { "id": "45921979", "url": "http://www.informatics.jax.org/homology/45921979", "database": "MGI" }, { "id": "45921978", "url": "http://www.informatics.jax.org/homology/45921978", "database": "MGI" }, { "id": "45921977", "url": "http://www.informatics.jax.org/homology/45921977", "database": "MGI" }, { "id": "45921976", "url": "http://www.informatics.jax.org/homology/45921976", "database": "MGI" }, { "id": "45921986", "url": "http://www.informatics.jax.org/homology/45921986", "database": "MGI" }, { "id": "45921987", "url": "http://www.informatics.jax.org/homology/45921987", "database": "MGI" }, { "id": "45921985", "url": "http://www.informatics.jax.org/homology/45921985", "database": "MGI" }, { "id": "45921982", "url": "http://www.informatics.jax.org/homology/45921982", "database": "MGI" }, { "id": "45921983", "url": "http://www.informatics.jax.org/homology/45921983", "database": "MGI" }, { "id": "45921980", "url": "http://www.informatics.jax.org/homology/45921980", "database": "MGI" }, { "id": "45921981", "url": "http://www.informatics.jax.org/homology/45921981", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE", "length": 189 }, "evidence": [ { "id": "45921988", "url": "http://www.informatics.jax.org/homology/45921988", "database": "MGI" }, { "id": "45921989", "url": "http://www.informatics.jax.org/homology/45921989", "database": "MGI" }, { "id": "45921984", "url": "http://www.informatics.jax.org/homology/45921984", "database": "MGI" }, { "id": "45921979", "url": "http://www.informatics.jax.org/homology/45921979", "database": "MGI" }, { "id": "45921978", "url": "http://www.informatics.jax.org/homology/45921978", "database": "MGI" }, { "id": "45921977", "url": "http://www.informatics.jax.org/homology/45921977", "database": "MGI" }, { "id": "45921976", "url": "http://www.informatics.jax.org/homology/45921976", "database": "MGI" }, { "id": "45921986", "url": "http://www.informatics.jax.org/homology/45921986", "database": "MGI" }, { "id": "45921987", "url": "http://www.informatics.jax.org/homology/45921987", "database": "MGI" }, { "id": "45921985", "url": "http://www.informatics.jax.org/homology/45921985", "database": "MGI" }, { "id": "45921982", "url": "http://www.informatics.jax.org/homology/45921982", "database": "MGI" }, { "id": "45921983", "url": "http://www.informatics.jax.org/homology/45921983", "database": "MGI" }, { "id": "45921980", "url": "http://www.informatics.jax.org/homology/45921980", "database": "MGI" }, { "id": "45921981", "url": "http://www.informatics.jax.org/homology/45921981", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MALPFALMMALVVLSCKSSCSLGCNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD", "length": 189 }, "evidence": [ { "id": "45921988", "url": "http://www.informatics.jax.org/homology/45921988", "database": "MGI" }, { "id": "45921989", "url": "http://www.informatics.jax.org/homology/45921989", "database": "MGI" }, { "id": "45921984", "url": "http://www.informatics.jax.org/homology/45921984", "database": "MGI" }, { "id": "45921979", "url": "http://www.informatics.jax.org/homology/45921979", "database": "MGI" }, { "id": "45921978", "url": "http://www.informatics.jax.org/homology/45921978", "database": "MGI" }, { "id": "45921977", "url": "http://www.informatics.jax.org/homology/45921977", "database": "MGI" }, { "id": "45921976", "url": "http://www.informatics.jax.org/homology/45921976", "database": "MGI" }, { "id": "45921986", "url": "http://www.informatics.jax.org/homology/45921986", "database": "MGI" }, { "id": "45921987", "url": "http://www.informatics.jax.org/homology/45921987", "database": "MGI" }, { "id": "45921985", "url": "http://www.informatics.jax.org/homology/45921985", "database": "MGI" }, { "id": "45921982", "url": "http://www.informatics.jax.org/homology/45921982", "database": "MGI" }, { "id": "45921983", "url": "http://www.informatics.jax.org/homology/45921983", "database": "MGI" }, { "id": "45921980", "url": "http://www.informatics.jax.org/homology/45921980", "database": "MGI" }, { "id": "45921981", "url": "http://www.informatics.jax.org/homology/45921981", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGLPQEEFDGNQFQKTQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNNLEACVIQEVGMEETPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTNLQKILRRKD", "length": 189 }, "evidence": [ { "id": "45921988", "url": "http://www.informatics.jax.org/homology/45921988", "database": "MGI" }, { "id": "45921989", "url": "http://www.informatics.jax.org/homology/45921989", "database": "MGI" }, { "id": "45921984", "url": "http://www.informatics.jax.org/homology/45921984", "database": "MGI" }, { "id": "45921979", "url": "http://www.informatics.jax.org/homology/45921979", "database": "MGI" }, { "id": "45921978", "url": "http://www.informatics.jax.org/homology/45921978", "database": "MGI" }, { "id": "45921977", "url": "http://www.informatics.jax.org/homology/45921977", "database": "MGI" }, { "id": "45921976", "url": "http://www.informatics.jax.org/homology/45921976", "database": "MGI" }, { "id": "45921986", "url": "http://www.informatics.jax.org/homology/45921986", "database": "MGI" }, { "id": "45921987", "url": "http://www.informatics.jax.org/homology/45921987", "database": "MGI" }, { "id": "45921985", "url": "http://www.informatics.jax.org/homology/45921985", "database": "MGI" }, { "id": "45921982", "url": "http://www.informatics.jax.org/homology/45921982", "database": "MGI" }, { "id": "45921983", "url": "http://www.informatics.jax.org/homology/45921983", "database": "MGI" }, { "id": "45921980", "url": "http://www.informatics.jax.org/homology/45921980", "database": "MGI" }, { "id": "45921981", "url": "http://www.informatics.jax.org/homology/45921981", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P01572-1", "protein_name": "Interferon alpha-1", "gene_name": "Ifna1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MARLCAFLMVLAVLSYWPTCSLGCDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQGCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEK", "length": 189 }, "evidence": [ { "id": "45921989", "url": "http://www.informatics.jax.org/homology/45921989", "database": "MGI" }, { "id": "P01569", "url": "https://omabrowser.org/oma/group/P01569/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P01573-1", "protein_name": "Interferon alpha-2", "gene_name": "Ifna2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MARLCAFLVMLIVMSYWSICSLGCDLPHTYNLRNKRALKVLAQMRRLPFLSCLKDRQDFGFPLEKVDNQQIQKAQAIPVLRDLTQQTLNLFTSKASSAAWNATLLDSFCNDLHQQLNDLQTCLMQQVGVQEPPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVNLLPRLSEEKE", "length": 190 }, "evidence": [ { "id": "45921979", "url": "http://www.informatics.jax.org/homology/45921979", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P05011-1", "protein_name": "Interferon alpha-1", "gene_name": "Ifna1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MARLCAFLMSLVVVSYWSACCLGCDLPHTHNLRNKRVFTLLAQMRRLSPVSCLKDRKYFGFPLEKVDGQQIQKAQAIPVLHELTQQILSLFTSKESSTAWDATLLDSFCNDLQQQLSGLQACLMQQVGVQESPLTQEDSLLAVREYFHRITVYLRENKHSPCAWEVVKAEVWRALSSSANLMGRLREERNES", "length": 192 }, "evidence": [ { "id": "45921988", "url": "http://www.informatics.jax.org/homology/45921988", "database": "MGI" }, { "id": "45921989", "url": "http://www.informatics.jax.org/homology/45921989", "database": "MGI" }, { "id": "45921979", "url": "http://www.informatics.jax.org/homology/45921979", "database": "MGI" }, { "id": "45921977", "url": "http://www.informatics.jax.org/homology/45921977", "database": "MGI" }, { "id": "45921985", "url": "http://www.informatics.jax.org/homology/45921985", "database": "MGI" }, { "id": "45921982", "url": "http://www.informatics.jax.org/homology/45921982", "database": "MGI" }, { "id": "45921980", "url": "http://www.informatics.jax.org/homology/45921980", "database": "MGI" }, { "id": "45921981", "url": "http://www.informatics.jax.org/homology/45921981", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MALPFALLMALVVLSCKSSCSLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKE", "length": 189 }, "evidence": [ { "id": "45921988", "url": "http://www.informatics.jax.org/homology/45921988", "database": "MGI" }, { "id": "45921989", "url": "http://www.informatics.jax.org/homology/45921989", "database": "MGI" }, { "id": "45921984", "url": "http://www.informatics.jax.org/homology/45921984", "database": "MGI" }, { "id": "45921979", "url": "http://www.informatics.jax.org/homology/45921979", "database": "MGI" }, { "id": "45921978", "url": "http://www.informatics.jax.org/homology/45921978", "database": "MGI" }, { "id": "45921977", "url": "http://www.informatics.jax.org/homology/45921977", "database": "MGI" }, { "id": "45921976", "url": "http://www.informatics.jax.org/homology/45921976", "database": "MGI" }, { "id": "45921986", "url": "http://www.informatics.jax.org/homology/45921986", "database": "MGI" }, { "id": "45921987", "url": "http://www.informatics.jax.org/homology/45921987", "database": "MGI" }, { "id": "45921985", "url": "http://www.informatics.jax.org/homology/45921985", "database": "MGI" }, { "id": "45921982", "url": "http://www.informatics.jax.org/homology/45921982", "database": "MGI" }, { "id": "45921983", "url": "http://www.informatics.jax.org/homology/45921983", "database": "MGI" }, { "id": "45921980", "url": "http://www.informatics.jax.org/homology/45921980", "database": "MGI" }, { "id": "45921981", "url": "http://www.informatics.jax.org/homology/45921981", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISHFSCLKDRHDFGFPEEEFDGHQFQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLEACVIQEVGVEETPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD", "length": 189 }, "evidence": [ { "id": "45921988", "url": "http://www.informatics.jax.org/homology/45921988", "database": "MGI" }, { "id": "45921989", "url": "http://www.informatics.jax.org/homology/45921989", "database": "MGI" }, { "id": "45921984", "url": "http://www.informatics.jax.org/homology/45921984", "database": "MGI" }, { "id": "45921979", "url": "http://www.informatics.jax.org/homology/45921979", "database": "MGI" }, { "id": "45921978", "url": "http://www.informatics.jax.org/homology/45921978", "database": "MGI" }, { "id": "45921977", "url": "http://www.informatics.jax.org/homology/45921977", "database": "MGI" }, { "id": "45921976", "url": "http://www.informatics.jax.org/homology/45921976", "database": "MGI" }, { "id": "45921986", "url": "http://www.informatics.jax.org/homology/45921986", "database": "MGI" }, { "id": "45921987", "url": "http://www.informatics.jax.org/homology/45921987", "database": "MGI" }, { "id": "45921985", "url": "http://www.informatics.jax.org/homology/45921985", "database": "MGI" }, { "id": "45921982", "url": "http://www.informatics.jax.org/homology/45921982", "database": "MGI" }, { "id": "45921983", "url": "http://www.informatics.jax.org/homology/45921983", "database": "MGI" }, { "id": "45921980", "url": "http://www.informatics.jax.org/homology/45921980", "database": "MGI" }, { "id": "45921981", "url": "http://www.informatics.jax.org/homology/45921981", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISHFSCLKDRYDFGFPQEVFDGNQFQKAQAISAFHEMIQQTFNLFSTKDSSAAWDETLLDKFYIELFQQLNDLEACVTQEVGVEEIALMNEDSILAVRKYFQRITLYLMGKKYSPCAWEVVRAEIMRSFSFSTNLQKGLRRKD", "length": 189 }, "evidence": [ { "id": "45921988", "url": "http://www.informatics.jax.org/homology/45921988", "database": "MGI" }, { "id": "45921989", "url": "http://www.informatics.jax.org/homology/45921989", "database": "MGI" }, { "id": "45921984", "url": "http://www.informatics.jax.org/homology/45921984", "database": "MGI" }, { "id": "45921979", "url": "http://www.informatics.jax.org/homology/45921979", "database": "MGI" }, { "id": "45921978", "url": "http://www.informatics.jax.org/homology/45921978", "database": "MGI" }, { "id": "45921977", "url": "http://www.informatics.jax.org/homology/45921977", "database": "MGI" }, { "id": "45921976", "url": "http://www.informatics.jax.org/homology/45921976", "database": "MGI" }, { "id": "45921986", "url": "http://www.informatics.jax.org/homology/45921986", "database": "MGI" }, { "id": "45921987", "url": "http://www.informatics.jax.org/homology/45921987", "database": "MGI" }, { "id": "45921985", "url": "http://www.informatics.jax.org/homology/45921985", "database": "MGI" }, { "id": "45921982", "url": "http://www.informatics.jax.org/homology/45921982", "database": "MGI" }, { "id": "45921983", "url": "http://www.informatics.jax.org/homology/45921983", "database": "MGI" }, { "id": "45921980", "url": "http://www.informatics.jax.org/homology/45921980", "database": "MGI" }, { "id": "45921981", "url": "http://www.informatics.jax.org/homology/45921981", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P06799-1", "protein_name": "Interferon alpha-7", "gene_name": "Ifna7", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MARLCAFLMVLAVMSYWPTCCLGCDLPQTHNLRNKRALTLLVKMRRLSPLSCLKDRKDFGFPQAKVDAQQIQEAQAIPVLSELTQQILNIFTSKDSSAAWNATLLDSVCNDLHQQLNDLQGCLMQEVGVQELSLTQEDSLLAVRKYFHRITVFLREKKHSPCAWEVVRAEIWRALSSSANLLARLSEKKE", "length": 190 }, "evidence": [ { "id": "45921984", "url": "http://www.informatics.jax.org/homology/45921984", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P07349-1", "protein_name": "Interferon alpha-5", "gene_name": "Ifna5", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MARLCAFLMVLPVLSYWPTCSLGCDLPQTHNLRNKRALTLLVKMRRLSPLSCLKDRKDFGFPQEKVGAQQIQEAQAIPVLSELTQQVLNIFTSKDSSAAWNATLLDSFCNEVHQQLNDLKACVMQQVGVQESPLTQEDSLLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVNLLARLSKEE", "length": 189 }, "evidence": [ { "id": "45921986", "url": "http://www.informatics.jax.org/homology/45921986", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P07350-1", "protein_name": "Interferon alpha-6", "gene_name": "Ifna6", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MARLCAFLMVLAVLSYWPTCSLGCDLPQTHNLRNKRALTLLVKMRRLSPLSCLKDRKDFGFPQEKVGAQQIQEAQAIPVLTELTQQILTLFTSKDSSAAWNATLLDSFCNDLHQLLNDLQGCLMQQVEIQALPLTQEDSLLAVRTYFHRITVFLREKKHSPCAWEVVRAEVWRALSSSAKLLARLNEDE", "length": 189 }, "evidence": [ { "id": "45921985", "url": "http://www.informatics.jax.org/homology/45921985", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P07351-1", "protein_name": "Interferon alpha-4", "gene_name": "Ifna4", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MARLCAFLMILVMMSYYWSACSLGCDLPHTYNLGNKRALTVLEEMRRLPPLSCLKDRKDFGFPLEKVDNQQIQKAQAILVLRDLTQQILNLFTSKDLSATWNATLLDSFCNDLHQQLNDLKACVMQEPPLTQEDSLLAVRTYFHRITVYLRKKKHSLCAWEVIRAEVWRALSSSTNLLARLSEEKE", "length": 186 }, "evidence": [ { "id": "45921981", "url": "http://www.informatics.jax.org/homology/45921981", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P09235-1", "protein_name": "Interferon alpha-9", "gene_name": "Ifna9", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MARPFAFLMVLVVISYWSTCSLGCDLPQTHNLRNKKILTLLAQMRRLSPLSCLKDRKDFGFPQEKVDAQQIQEAQAIPVLSELTQQILTLFTSKDSSAAWNATLLDSFCTGLHQLLNDLQGCLMQLVGMKELPLTQEDSQLAMKKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVNLLARLSEEKE", "length": 190 }, "evidence": [ { "id": "45921977", "url": "http://www.informatics.jax.org/homology/45921977", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MALTFYLLVALVVLSYKSFSSLGCDLPQTHSLGNRRALILLAQMRRISPFSCLKDRHDFEFPQEEFDDKQFQKAQAISVLHEMIQQTFNLFSTKDSSAALDETLLDEFYIELDQQLNDLESCVMQEVGVIESPLMYEDSILAVRKYFQRITLYLTEKKYSSCAWEVVRAEIMRSFSLSINLQKRLKSKE", "length": 189 }, "evidence": [ { "id": "45921988", "url": "http://www.informatics.jax.org/homology/45921988", "database": "MGI" }, { "id": "45921989", "url": "http://www.informatics.jax.org/homology/45921989", "database": "MGI" }, { "id": "45921984", "url": "http://www.informatics.jax.org/homology/45921984", "database": "MGI" }, { "id": "45921979", "url": "http://www.informatics.jax.org/homology/45921979", "database": "MGI" }, { "id": "45921978", "url": "http://www.informatics.jax.org/homology/45921978", "database": "MGI" }, { "id": "45921977", "url": "http://www.informatics.jax.org/homology/45921977", "database": "MGI" }, { "id": "45921976", "url": "http://www.informatics.jax.org/homology/45921976", "database": "MGI" }, { "id": "45921986", "url": "http://www.informatics.jax.org/homology/45921986", "database": "MGI" }, { "id": "45921987", "url": "http://www.informatics.jax.org/homology/45921987", "database": "MGI" }, { "id": "45921985", "url": "http://www.informatics.jax.org/homology/45921985", "database": "MGI" }, { "id": "45921982", "url": "http://www.informatics.jax.org/homology/45921982", "database": "MGI" }, { "id": "45921983", "url": "http://www.informatics.jax.org/homology/45921983", "database": "MGI" }, { "id": "45921980", "url": "http://www.informatics.jax.org/homology/45921980", "database": "MGI" }, { "id": "45921981", "url": "http://www.informatics.jax.org/homology/45921981", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q61716-1", "protein_name": "Interferon alpha-11", "gene_name": "Ifna11", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MARLCAFLMILIVMSYWSTCSLGCDLPHTYNLRNKRALKVLAQMRRLTPLSCLKDRKDFGFPLEKVDAQQIQKAQSIPVLRDLTQQILNLFASKDSSAAWNATLLDSFCNDLHQQLNDLQGCLMQQVGVQESPLTQEDSLLAVRIYFHRITVFLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEKA", "length": 190 }, "evidence": [ { "id": "45921982", "url": "http://www.informatics.jax.org/homology/45921982", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q61718-1", "protein_name": "Interferon 1ai1", "gene_name": "Ifna15", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MARLCAFLMTLLVMSYWSTCSLGCDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFRFPQEKVDAQQIQNAQAIPVLQELTQQVLNIFTSKDSSAAWDASLLDSFCNDLHQQLNDLKACVMQEVGVQEPPLTQEDYLLAVRTYFHRITVYLREKKHSPCAWEVVRAEVWRAMSSSAKLLARLSEEKE", "length": 190 }, "evidence": [ { "id": "45921978", "url": "http://www.informatics.jax.org/homology/45921978", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q80SS5-1", "protein_name": "Interferon alpha-12", "gene_name": "Ifna12", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MARLCAFLMTLLVMSYWSTCSLGCDLPQTHNLRNKRALTLLAQMRRLSPLSCLKDRKNFRFPQEKVDAQQIKKAQVIPVLSELTQQILTLFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQGCLMQQVGVQEPPLTQEDSLLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRTLSSSAKLLARLSEKE", "length": 189 }, "evidence": [ { "id": "45921983", "url": "http://www.informatics.jax.org/homology/45921983", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q80SU4-1", "protein_name": "Interferon alpha-13", "gene_name": "Ifna13", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MARPCAFLMVLVVLSYWSACSLGCDLPQTHNLRNKRALTLLEQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPFVHELTQQILTLFTSNDSSAAWNATLLDSFCNDLHQQLNDLKACLMQQVGVQEFPLTQEDSLLAVRKYFHSITVYLREKKHSPCAWEVVRAEVQRTLSSSANLLARLSKEE", "length": 189 }, "evidence": [ { "id": "45921980", "url": "http://www.informatics.jax.org/homology/45921980", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q810G1-1", "protein_name": "Interferon 1ai6", "gene_name": "Ifna16", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MARLCAFLMVLAVMSYWSTCSLGCDLPQTHKLRNKRALTLLIQMRRLSPLSCLKDRKDFGFPQEKVDTLKIQKEKAIPVLSEVTQQILNIFTSKDSSAAWDATLLDTFCNDLYQQLNDLQACLVQQVRLQEPPLTQEVSLLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEK", "length": 189 }, "evidence": [ { "id": "45921988", "url": "http://www.informatics.jax.org/homology/45921988", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q810G3-1", "protein_name": "Interferon 1ai2", "gene_name": "Ifna14", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MARLCAFLMTLLVMSYWSTCCLGCDLPQTHNLRNKRALTLLVKMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILTLFTSKDSSAAWDATLLDSFCNDLNTQLNDLQGCLMQQVEIQAPPLTQEDSLLAVRKYFHRITVYLREKKHSPCAWEVVRAEIWRALSSSAKLLTSLKEEK", "length": 189 }, "evidence": [ { "id": "45921976", "url": "http://www.informatics.jax.org/homology/45921976", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P01569", "url": "https://www.uniprot.org/uniprot/P01569" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P01569", "url": "https://www.uniprot.org/uniprot/P01569" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 12, "go_terms": [ { "name": "defense response to virus", "id": "GO:0051607", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051607", "evidence": [ { "database": "UniProtKB", "id": "P01569", "url": "https://www.uniprot.org/uniprot/P01569" } ], "pmid": "" }, { "name": "type I interferon-mediated signaling pathway", "id": "GO:0060337", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060337", "evidence": [ { "database": "UniProtKB", "id": "P01569", "url": "https://www.uniprot.org/uniprot/P01569" } ], "pmid": "" }, { "name": "adaptive immune response", "id": "GO:0002250", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002250", "evidence": [ { "database": "UniProtKB", "id": "P01569", "url": "https://www.uniprot.org/uniprot/P01569" } ], "pmid": "" }, { "name": "B cell differentiation", "id": "GO:0030183", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030183", "evidence": [ { "database": "UniProtKB", "id": "P01569", "url": "https://www.uniprot.org/uniprot/P01569" } ], "pmid": "" }, { "name": "response to exogenous dsRNA", "id": "GO:0043330", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043330", "evidence": [ { "database": "UniProtKB", "id": "P01569", "url": "https://www.uniprot.org/uniprot/P01569" } ], "pmid": "" }, { "name": "humoral immune response", "id": "GO:0006959", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006959", "evidence": [ { "database": "UniProtKB", "id": "P01569", "url": "https://www.uniprot.org/uniprot/P01569" } ], "pmid": "" }, { "name": "cellular response to virus", "id": "GO:0098586", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098586", "evidence": [ { "database": "UniProtKB", "id": "P01569", "url": "https://www.uniprot.org/uniprot/P01569" } ], "pmid": "" }, { "name": "cytokine-mediated signaling pathway", "id": "GO:0019221", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019221", "evidence": [ { "database": "UniProtKB", "id": "P01569", "url": "https://www.uniprot.org/uniprot/P01569" } ], "pmid": "" }, { "name": "B cell proliferation", "id": "GO:0042100", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042100", "evidence": [ { "database": "UniProtKB", "id": "P01569", "url": "https://www.uniprot.org/uniprot/P01569" } ], "pmid": "" }, { "name": "T cell activation involved in immune response", "id": "GO:0002286", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002286", "evidence": [ { "database": "UniProtKB", "id": "P01569", "url": "https://www.uniprot.org/uniprot/P01569" } ], "pmid": "" }, { "name": "natural killer cell activation involved in immune response", "id": "GO:0002323", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002323", "evidence": [ { "database": "UniProtKB", "id": "P01569", "url": "https://www.uniprot.org/uniprot/P01569" } ], "pmid": "" }, { "name": "positive regulation of peptidyl-serine phosphorylation of STAT protein", "id": "GO:0033141", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033141", "evidence": [ { "database": "UniProtKB", "id": "P01569", "url": "https://www.uniprot.org/uniprot/P01569" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "cytokine activity", "id": "GO:0005125", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005125", "evidence": [ { "database": "UniProtKB", "id": "P01569", "url": "https://www.uniprot.org/uniprot/P01569" } ], "pmid": "" }, { "name": "type I interferon receptor binding", "id": "GO:0005132", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005132", "evidence": [ { "database": "UniProtKB", "id": "P01569", "url": "https://www.uniprot.org/uniprot/P01569" } ], "pmid": "" }, { "name": "cytokine receptor binding", "id": "GO:0005126", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005126", "evidence": [ { "database": "UniProtKB", "id": "P01569", "url": "https://www.uniprot.org/uniprot/P01569" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 184 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }