{ "uniprot_canonical_ac": "P01375-1", "uniprot_ac": "P01375", "uniprot_id": "TNFA_HUMAN", "mass": { "chemical_mass": 25644.0, "monoisotopic_mass": 25644.0 }, "refseq": { "ac": "NP_000585", "name": "tumor necrosis factor", "summary": "This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, psoriasis, rheumatoid arthritis ankylosing spondylitis, tuberculosis, autosomal dominant polycystic kidney disease, and cancer. Mutations in this gene affect susceptibility to cerebral malaria, septic shock, and Alzheimer disease. Knockout studies in mice also suggested the neuroprotective function of this cytokine. [provided by RefSeq, Aug 2020].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000585" }, "gene_names": [ { "name": "TNF", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P01375", "id": "P01375" }, { "name": "DIF; TNF-alpha; TNFA; TNFSF2; TNLG1F", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000585", "id": "NP_000585" }, { "name": "TNFA", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P01375", "id": "P01375" }, { "name": "TNFSF2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P01375", "id": "P01375" }, { "name": "TNF", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000585", "id": "NP_000585" } ], "protein_names": [ { "name": "Tumor necrosis factor", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P01375" }, { "name": "Cachectin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01375" }, { "name": "N-terminal fragment", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01375" }, { "name": "NTF", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01375" }, { "name": "TNF, monocyte-derived; TNF, macrophage-derived; APC1 protein; tumor necrosis factor-alpha; TNF-a; tumor necrosis factor ligand superfamily member 2; tumor necrosis factor ligand 1F; tumor necrotic factor alpha", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000585", "id": "NP_000585" }, { "name": "TNF-alpha", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01375" }, { "name": "TNF-a", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01375" }, { "name": "Tumor necrosis factor ligand superfamily member 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01375" }, { "name": "tumor necrosis factor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000585", "id": "NP_000585" } ], "function": [ { "annotation": "Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Induces insulin resistance in adipocytes via inhibition of insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake. Induces GKAP42 protein degradation in adipocytes which is partially responsible for TNF-induced insulin resistance. Plays a role in angiogenesis by inducing VEGF production synergistically with IL1B and IL6.", "evidence": [ { "database": "UniProtKB", "id": "A0A8V8TNL2", "url": "https://www.uniprot.org/uniprot/A0A8V8TNL2#function" }, { "database": "UniProtKB", "id": "RU368112", "url": "https://www.uniprot.org/uniprot/RU368112#function" }, { "database": "UniProtKB", "id": "A0A140T922", "url": "https://www.uniprot.org/uniprot/A0A140T922#function" }, { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375#function" }, { "database": "PubMed", "id": "22517918", "url": "https://glygen.org/publication/PubMed/22517918" }, { "database": "PubMed", "id": "16829952", "url": "https://glygen.org/publication/PubMed/16829952" }, { "database": "PubMed", "id": "23396208", "url": "https://glygen.org/publication/PubMed/23396208" }, { "database": "UniProtKB", "id": "P06804", "url": "https://www.uniprot.org/uniprot/P06804#function" }, { "database": "PubMed", "id": "12794819", "url": "https://glygen.org/publication/PubMed/12794819" } ] }, { "annotation": "Does TNF-alpha 308 G/A (rs1800629) gene polymorphism associate with liver and pancreas disorders in Iraqi adults with beta thalassemia major?", "evidence": [ { "database": "RefSeq", "id": "NP_000585", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000585" }, { "database": "PubMed", "id": "38217591", "url": "https://glygen.org/publication/PubMed/38217591" } ] }, { "annotation": "Evaluating the Concentration of MMP-9 and TNF- alpha in Pulpal Blood at Various Stages of Pulpal Inflammation in Diabetics: A Cross Sectional Study.", "evidence": [ { "database": "RefSeq", "id": "NP_000585", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000585" }, { "database": "PubMed", "id": "38219033", "url": "https://glygen.org/publication/PubMed/38219033" } ] }, { "annotation": "Influence of polymorphisms in TNF-alpha and IL1beta on susceptibility to alcohol induced liver diseases and therapeutic potential of miR-124-3p impeding TNF-alpha/IL1beta mediated multi-cellular signaling in liver microenvironment. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000585", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000585" }, { "database": "PubMed", "id": "38146363", "url": "https://glygen.org/publication/PubMed/38146363" } ] }, { "annotation": "Knockouts of TNFRSF1A and TNFRSF1B Genes in K562 Cell Line Lead to Diverse Long-Lasting Responses to TNF-alpha. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000585", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000585" }, { "database": "PubMed", "id": "38138998", "url": "https://glygen.org/publication/PubMed/38138998" } ] }, { "annotation": "The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.", "evidence": [ { "database": "UniProtKB", "id": "A0A8V8TNL2", "url": "https://www.uniprot.org/uniprot/A0A8V8TNL2#function" }, { "database": "UniProtKB", "id": "RU368112", "url": "https://www.uniprot.org/uniprot/RU368112#function" }, { "database": "UniProtKB", "id": "A0A140T922", "url": "https://www.uniprot.org/uniprot/A0A140T922#function" }, { "database": "UniProtKB", "id": "ARBA00003559", "url": "https://www.uniprot.org/uniprot/ARBA00003559#function" }, { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375#function" }, { "database": "PubMed", "id": "16829952", "url": "https://glygen.org/publication/PubMed/16829952" } ] }, { "annotation": "This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, psoriasis, rheumatoid arthritis ankylosing spondylitis, tuberculosis, autosomal dominant polycystic kidney disease, and cancer. Mutations in this gene affect susceptibility to cerebral malaria, septic shock, and Alzheimer disease. Knockout studies in mice also suggested the neuroprotective function of this cytokine. [provided by RefSeq, Aug 2020].", "evidence": [ { "database": "RefSeq", "id": "NP_000585", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000585" } ] }, { "annotation": "Tumor necrosis factor mediates the impact of PM2.5 on bone mineral density: Inflammatory proteome Mendelian randomization and colocalization analyses.", "evidence": [ { "database": "RefSeq", "id": "NP_000585", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000585" }, { "database": "PubMed", "id": "38184974", "url": "https://glygen.org/publication/PubMed/38184974" } ] } ], "disease": [ { "disease_id": "DOID:9008", "recommended_name": { "id": "DOID:9008", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9008", "name": "psoriatic arthritis", "description": "An arthritis that is characterized by joint inflammation that usually occurs in combination with psoriasis." }, "synonyms": [ { "id": "DOID:9008", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9008", "name": "arthritis psoriatica", "description": "" }, { "id": "DOID:9008", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9008", "name": "arthropathic psoriasis", "description": "" }, { "id": "MONDO:0011849", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011849", "name": "psoriatic arthritis", "description": "Joint inflammation associated with psoriasis." }, { "id": "MONDO:0011849", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011849", "name": "arthritis psoriatica", "description": "" }, { "id": "MONDO:0011849", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011849", "name": "arthropathic psoriasis", "description": "" }, { "id": "MONDO:0011849", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011849", "name": "psoriatic arthritis, susceptibility to", "description": "" }, { "id": "MONDO:0011849", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011849", "name": "psoriatic arthritis, susceptibility to, 1", "description": "" }, { "id": "MONDO:0011849", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011849", "name": "psoriatic arthropathy", "description": "" }, { "id": "MONDO:0011849", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011849", "name": "susceptibility to psoriatic arthritis", "description": "" }, { "id": "MONDO:0100232", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100232", "name": "psoriatic arthritis, susceptibility to", "description": "An inherited susceptibility or predisposition to developing psoriatic arthritis." }, { "id": "MONDO:0100232", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100232", "name": "psoriatic arthritis, susceptibility", "description": "" }, { "id": "MONDO:0100232", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100232", "name": "psoriatic arthritis, susceptibility to", "description": "" }, { "id": "MIM:607507", "resource": "MIM", "url": "https://www.omim.org/entry/607507", "name": "Psoriatic arthritis", "description": "Psoriatic arthritis" }, { "id": "MIM:607507", "resource": "MIM", "url": "https://www.omim.org/entry/607507", "name": "Psoriatic arthritis", "description": "Psoriatic arthritis" } ], "evidence": [ { "id": "607507", "database": "MIM", "url": "https://www.omim.org/entry/607507" } ] }, { "disease_id": "MONDO:0012488", "recommended_name": { "id": "MONDO:0012488", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012488", "name": "hepatitis B virus, susceptibility to", "description": "" }, "synonyms": [ { "id": "MONDO:0012488", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012488", "name": "hepatitis B virus infection, susceptibility to", "description": "" }, { "id": "MONDO:0012488", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012488", "name": "hepatitis b virus, susceptibility to", "description": "" }, { "id": "MONDO:0012488", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012488", "name": "HBV, resistance to", "description": "" }, { "id": "MONDO:0012488", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012488", "name": "HBV, susceptibility to", "description": "" }, { "id": "MONDO:0012488", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012488", "name": "Hepatitis B Virus, resistance to", "description": "" } ], "evidence": [ { "id": "610424", "database": "MIM", "url": "https://www.omim.org/entry/610424" } ] }, { "disease_id": "MONDO:0021024", "recommended_name": { "id": "MONDO:0021024", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021024", "name": "malaria, susceptibility to", "description": "" }, "synonyms": [ { "id": "MONDO:0021024", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021024", "name": "malaria, Severe, resistance to", "description": "" }, { "id": "MONDO:0021024", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021024", "name": "malaria, Severe, susceptibility to", "description": "" }, { "id": "MONDO:0021024", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021024", "name": "malaria, cerebral, reduced risk of", "description": "" }, { "id": "MONDO:0021024", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021024", "name": "malaria, cerebral, resistance to", "description": "" }, { "id": "MONDO:0021024", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021024", "name": "malaria, cerebral, susceptibility to", "description": "" }, { "id": "MONDO:0021024", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021024", "name": "malaria, protection against", "description": "" }, { "id": "MONDO:0021024", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021024", "name": "malaria, resistance to", "description": "" }, { "id": "MONDO:0021024", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021024", "name": "malaria, susceptibility to", "description": "" }, { "id": "MONDO:0021024", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021024", "name": "malaria, vivax, protection against", "description": "" }, { "id": "MONDO:0021024", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021024", "name": "resistance to malaria due to G6PD deficiency", "description": "" } ], "evidence": [ { "id": "611162", "database": "MIM", "url": "https://www.omim.org/entry/611162" } ] } ], "snv": [ { "evidence": [ { "id": "rs776692566", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776692566" }, { "id": "rs776692566", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776692566" }, { "id": "rs776692566", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs776692566#frequency_tab" }, { "id": "rs776692566", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776692566" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 66, "end_pos": 66, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DLS->NLS).", "chr_id": "6", "chr_pos": "31576543", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D66", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs369783162", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs369783162" }, { "id": "rs369783162", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs369783162" }, { "id": "rs369783162", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs369783162" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 80, "end_pos": 80, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->P).", "chr_id": "6", "chr_pos": "31576772", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S80", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 105, "end_pos": 105, "sequence_org": "L", "sequence_mut": "S", "comment": "Low activity.", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" }, { "database": "PubMed", "id": "2009860", "url": "https://glygen.org/publication/PubMed/2009860" } ] }, { "start_pos": 108, "end_pos": 108, "sequence_org": "R", "sequence_mut": "W", "comment": "Biologically inactive.", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" }, { "database": "PubMed", "id": "2009860", "url": "https://glygen.org/publication/PubMed/2009860" } ] }, { "start_pos": 112, "end_pos": 112, "sequence_org": "L", "sequence_mut": "F", "comment": "Biologically inactive.", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" }, { "database": "PubMed", "id": "2009860", "url": "https://glygen.org/publication/PubMed/2009860" } ] }, { "start_pos": 160, "end_pos": 160, "sequence_org": "A", "sequence_mut": "V", "comment": "Biologically inactive.", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" }, { "database": "PubMed", "id": "2009860", "url": "https://glygen.org/publication/PubMed/2009860" } ] }, { "start_pos": 162, "end_pos": 162, "sequence_org": "S", "sequence_mut": "F", "comment": "Biologically inactive.", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" }, { "database": "PubMed", "id": "2009860", "url": "https://glygen.org/publication/PubMed/2009860" } ] }, { "start_pos": 167, "end_pos": 167, "sequence_org": "V", "sequence_mut": "A", "comment": "Biologically inactive.", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" }, { "database": "PubMed", "id": "2009860", "url": "https://glygen.org/publication/PubMed/2009860" } ] }, { "start_pos": 167, "end_pos": 167, "sequence_org": "V", "sequence_mut": "D", "comment": "Biologically inactive.", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" }, { "database": "PubMed", "id": "2009860", "url": "https://glygen.org/publication/PubMed/2009860" } ] }, { "start_pos": 19, "end_pos": 20, "sequence_org": "KK", "sequence_mut": "RR", "comment": "Abolished myristoylation.", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" }, { "database": "PubMed", "id": "23552949", "url": "https://glygen.org/publication/PubMed/23552949" } ] }, { "start_pos": 222, "end_pos": 222, "sequence_org": "E", "sequence_mut": "K", "comment": "Biologically inactive.", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" }, { "database": "PubMed", "id": "2009860", "url": "https://glygen.org/publication/PubMed/2009860" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "59.48", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000232810", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000232810" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "44.66", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000232810", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000232810" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "48.12", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000232810", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000232810" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000232810", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000232810" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "54.87", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000232810", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000232810" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "66.3", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000232810", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000232810" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000232810", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000232810" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "41.61", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000232810", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000232810" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "46.42", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000232810", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000232810" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000232810", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000232810" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "45.98", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000232810", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000232810" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "47.12", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000232810", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000232810" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "55.94", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000232810", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000232810" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P01375", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01375" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P01375", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01375" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P01375", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01375" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P01375", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01375" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P01375", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01375" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P01375", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01375" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P01375", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01375" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P01375", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01375" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P01375", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01375" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P01375", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01375" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P01375", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01375" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P01375", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01375" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "common_name": "Human" } ], "gene": [ { "name": "TNF", "url": "https://www.uniprot.org/uniprot/P01375", "locus": { "chromosome": "HSCHR6_MHC_SSTO_CTG1", "start_pos": 2877616, "end_pos": 2874847, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000230108", "url": "https://www.ensembl.org/id/ENSG00000230108" } ] } } ], "crossref": [ { "id": "ENSG00000232810", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000232810", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00184", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00184", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL1825", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL1825", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "TNF", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=TNF", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "7124", "url": "https://www.ncbi.nlm.nih.gov/gene/7124", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "609", "url": "https://glyconnect.expasy.org/browser/proteins/609", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "11892", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=11892", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P01375", "url": "https://www.ebi.ac.uk/intact/interactors/id:P01375*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002959", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002959", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006052", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006052", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006053", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006053", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008983", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008983", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR021184", "url": "https://www.ebi.ac.uk/interpro/entry/IPR021184", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:7124", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7124", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "191160", "url": "http://www.omim.org/entry/191160", "database": "MIM", "categories": [ "Other" ] }, { "id": "607507", "url": "http://www.omim.org/entry/607507", "database": "MIM", "categories": [ "Other" ] }, { "id": "610424", "url": "http://www.omim.org/entry/610424", "database": "MIM", "categories": [ "Other" ] }, { "id": "611162", "url": "http://www.omim.org/entry/611162", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P01375", "url": "https://www.nextprot.org/entry/NX_P01375", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "GATMLFC", "url": "https://omabrowser.org/oma/group/GATMLFC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2909163at2759", "url": "http://www.orthodb.org/?query=2909163at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11471", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11471", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11471:SF23", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11471:SF23", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1A8M", "url": "https://www.rcsb.org/structure/1A8M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1TNF", "url": "https://www.rcsb.org/structure/1TNF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2AZ5", "url": "https://www.rcsb.org/structure/2AZ5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2E7A", "url": "https://www.rcsb.org/structure/2E7A", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2TUN", "url": "https://www.rcsb.org/structure/2TUN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2ZJC", "url": "https://www.rcsb.org/structure/2ZJC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2ZPX", "url": "https://www.rcsb.org/structure/2ZPX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3ALQ", "url": "https://www.rcsb.org/structure/3ALQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3IT8", "url": "https://www.rcsb.org/structure/3IT8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3L9J", "url": "https://www.rcsb.org/structure/3L9J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3WD5", "url": "https://www.rcsb.org/structure/3WD5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4G3Y", "url": "https://www.rcsb.org/structure/4G3Y", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4TSV", "url": "https://www.rcsb.org/structure/4TSV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4TWT", "url": "https://www.rcsb.org/structure/4TWT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4Y6O", "url": "https://www.rcsb.org/structure/4Y6O", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5M2I", "url": "https://www.rcsb.org/structure/5M2I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5M2J", "url": "https://www.rcsb.org/structure/5M2J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5M2M", "url": "https://www.rcsb.org/structure/5M2M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5MU8", "url": "https://www.rcsb.org/structure/5MU8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5TSW", "url": "https://www.rcsb.org/structure/5TSW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5UUI", "url": "https://www.rcsb.org/structure/5UUI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5WUX", "url": "https://www.rcsb.org/structure/5WUX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5YOY", "url": "https://www.rcsb.org/structure/5YOY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6OOY", "url": "https://www.rcsb.org/structure/6OOY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6OOZ", "url": "https://www.rcsb.org/structure/6OOZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6OP0", "url": "https://www.rcsb.org/structure/6OP0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6RMJ", "url": "https://www.rcsb.org/structure/6RMJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6X81", "url": "https://www.rcsb.org/structure/6X81", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6X82", "url": "https://www.rcsb.org/structure/6X82", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6X83", "url": "https://www.rcsb.org/structure/6X83", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6X85", "url": "https://www.rcsb.org/structure/6X85", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6X86", "url": "https://www.rcsb.org/structure/6X86", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7ASY", "url": "https://www.rcsb.org/structure/7ASY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7AT7", "url": "https://www.rcsb.org/structure/7AT7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7ATB", "url": "https://www.rcsb.org/structure/7ATB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7JRA", "url": "https://www.rcsb.org/structure/7JRA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7KP9", "url": "https://www.rcsb.org/structure/7KP9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7KPA", "url": "https://www.rcsb.org/structure/7KPA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7KPB", "url": "https://www.rcsb.org/structure/7KPB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7QLF", "url": "https://www.rcsb.org/structure/7QLF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7TA3", "url": "https://www.rcsb.org/structure/7TA3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7TA6", "url": "https://www.rcsb.org/structure/7TA6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00229", "url": "http://pfam.xfam.org/family/PF00229", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P01375", "url": "https://pharos.nih.gov/targets/P01375", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000051774", "url": "https://proconsortium.org/app/entry/PR:000051774", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051775", "url": "https://proconsortium.org/app/entry/PR:000051775", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P01375", "url": "http://purl.obolibrary.org/obo/PR_P01375", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5357786", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357786", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5357956", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357956", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5626978", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5626978", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-75893", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75893", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_000585", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000585", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P01375", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "A0A140T922", "url": "https://www.uniprot.org/uniprot/A0A140T922", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140T922-1", "url": "https://www.uniprot.org/uniprot/A0A140T922-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TNL2", "url": "https://www.uniprot.org/uniprot/A0A8V8TNL2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TNL2-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TNL2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01375-1", "url": "https://www.uniprot.org/uniprot/P01375-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL", "length": 233, "header": "sp|P01375-1|TNFA_HUMAN Isoform 1 of Tumor necrosis factor OS=Homo sapiens OX=9606 GN=TNF PE=1 SV=1 CANONICAL=P01375-1" }, "isoforms": [ { "isoform_ac": "A0A140T922-1", "url": "", "sequence": { "sequence": "FPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL", "length": 171, "header": "tr|A0A140T922-1|TNFA_HUMAN Computationally mapped isoform of Tumor necrosis factor OS=Homo sapiens OX=9606 GN=TNF PE=1 SV=1 CANONICAL=P01375-1" }, "locus": { "chromosome": "HSCHR6_MHC_APD_CTG1", "start_pos": 2910113, "end_pos": 2909113, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000445232.2", "url": "https://www.ensembl.org/id/ENST00000445232.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000389265.2", "url": "https://www.ensembl.org/id/ENSP00000389265.2" } ] } }, { "isoform_ac": "A0A8V8TNL2-1", "url": "", "sequence": { "sequence": "MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEDHLLEPRVTSL", "length": 73, "header": "tr|A0A8V8TNL2-1|TNFA_HUMAN Computationally mapped isoform of Tumor necrosis factor OS=Homo sapiens OX=9606 GN=TNF PE=1 SV=1 CANONICAL=P01375-1" }, "locus": { "chromosome": "6", "start_pos": 31576799, "end_pos": 31575742, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000699334.1", "url": "https://www.ensembl.org/id/ENST00000699334.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000514308.1", "url": "https://www.ensembl.org/id/ENSP00000514308.1" } ] } }, { "isoform_ac": "P01375-1", "url": "", "sequence": { "sequence": "MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL", "length": 233, "header": "sp|P01375-1|TNFA_HUMAN Isoform 1 of Tumor necrosis factor OS=Homo sapiens OX=9606 GN=TNF PE=1 SV=1 CANONICAL=P01375-1" }, "locus": { "chromosome": "HSCHR6_MHC_QBL_CTG1", "start_pos": 2833355, "end_pos": 2831561, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000383496.4", "url": "https://www.ensembl.org/id/ENST00000383496.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000372988.4", "url": "https://www.ensembl.org/id/ENSP00000372988.4" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-80", "start_pos": 80, "start_aa": "Ser", "end_pos": 80, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser80", "evidence": [ { "id": "P01375", "database": "UniCarbKB", "url": "" }, { "id": "8631363", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8631363" }, { "id": "609", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/609" } ] }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 80, "start_aa": "Ser", "end_pos": 80, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser80", "evidence": [ { "id": "609", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/609" }, { "id": "8631363", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8631363" } ] }, { "glytoucan_ac": "G48818KL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-80", "start_pos": 80, "start_aa": "Ser", "end_pos": 80, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser80", "evidence": [ { "id": "P01375", "database": "UniCarbKB", "url": "" }, { "id": "8631363", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8631363" }, { "id": "609", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/609" } ] }, { "glytoucan_ac": "G56682BC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-80", "start_pos": 80, "start_aa": "Ser", "end_pos": 80, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser80", "evidence": [ { "id": "P01375", "database": "UniCarbKB", "url": "" }, { "id": "8631363", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8631363" }, { "id": "609", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/609" } ] }, { "glytoucan_ac": "G74722FL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 80, "start_aa": "Ser", "end_pos": 80, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser80", "evidence": [ { "id": "609", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/609" }, { "id": "8631363", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8631363" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc...) serine; in soluble form O-GalNAcylation", "start_pos": 80, "start_aa": "Ser", "end_pos": 80, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser80", "evidence": [ { "id": "P01375", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01375#ptm_processing" }, { "id": "8631363", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8631363" } ] } ], "phosphorylation": [ { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "Q8N165-1", "kinase_gene_name": "PDIK1L", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01375", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01375" }, { "database": "PubMed", "id": "8597870", "url": "https://glygen.org/publication/PubMed/8597870" } ], "site_lbl": "Ser2" }, { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CK1", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" }, { "database": "phospho.ELM", "id": "P01375", "url": "http://phospho.elm.eu.org/byAccession/P01375.html" }, { "database": "iPTMnet", "id": "P01375", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01375" }, { "database": "PubMed", "id": "8597870", "url": "https://glygen.org/publication/PubMed/8597870" }, { "database": "PRO", "id": "P01375", "url": "http://purl.obolibrary.org/obo/P01375" }, { "database": "PubMed", "id": "10205166", "url": "https://glygen.org/publication/PubMed/10205166" } ], "site_lbl": "Ser2" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "Constitutive activation of Stat3 signaling confers resistance to apoptosis in human U266 myeloma cells.", "journal": "Immunity", "date": "1999", "authors": "Catlett-Falcone R, Landowski TH, Oshiro MM, Turkson J, Levitzki A, Savino R, Ciliberto G, Moscinski L, Fernandez-Luna JL, Nunez G, Dalton WS, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10023775", "url": "https://glygen.org/publication/PubMed/10023775" } ] }, { "title": "p300 interacts with the N- and C-terminal part of PPARgamma2 in a ligand-independent and -dependent manner, respectively.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Gelman L, Zhou G, Fajas L, Raspe E, Fruchart JC, Auwerx J", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "10075656", "url": "https://glygen.org/publication/PubMed/10075656" } ] }, { "title": "Modulation of formyl peptide receptor expression by IL-10 in human monocytes and neutrophils.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Thivierge M, Parent JL, Stankova J, Rola-Pleszczynski M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "10092818", "url": "https://glygen.org/publication/PubMed/10092818" } ] }, { "title": "A new member of the Ig superfamily and a V-ATPase G subunit are among the predicted products of novel genes close to the TNF locus in the human MHC.", "journal": "J. Immunol.", "date": "1999", "authors": "Neville MJ, Campbell RD", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "reference": [ { "type": "PubMed", "id": "10202016", "url": "https://glygen.org/publication/PubMed/10202016" } ] }, { "title": "A casein kinase I motif present in the cytoplasmic domain of members of the tumour necrosis factor ligand family is implicated in 'reverse signalling'.", "journal": "The EMBO journal", "date": "1999", "authors": "Watts AD, Hunt NH, Wanigasekara Y, Bloomfield G, Wallach D, Roufogalis BD, Chaudhri G", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" }, { "database": "iPTMnet", "id": "P01375-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01375-1" } ], "reference": [ { "type": "PubMed", "id": "10205166", "url": "https://glygen.org/publication/PubMed/10205166" } ] }, { "title": "Crystal structure of the interleukin-4/receptor alpha chain complex reveals a mosaic binding interface.", "journal": "Cell", "date": "1999", "authors": "Hage T, Sebald W, Reinemer P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10219247", "url": "https://glygen.org/publication/PubMed/10219247" } ] }, { "title": "A polymorphism that affects OCT-1 binding to the TNF promoter region is associated with severe malaria.", "journal": "Nat. Genet.", "date": "1999", "authors": "Knight J C, Udalova I, Hill A V, Greenwood B M, Peshu N, Marsh K, Kwiatkowski D", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "reference": [ { "type": "PubMed", "id": "10369255", "url": "https://glygen.org/publication/PubMed/10369255" } ] }, { "title": "Regulation of the germline immunoglobulin Cgamma1 promoter by CD40 ligand and IL-4: dual role for tandem NF-kappaB binding sites.", "journal": "Molecular immunology", "date": "1999", "authors": "Warren WD, Roberts KL, Linehan LA, Berton MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10369418", "url": "https://glygen.org/publication/PubMed/10369418" } ] }, { "title": "Regulation of macrophage chemokine expression by lipopolysaccharide in vitro and in vivo.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Kopydlowski KM, Salkowski CA, Cody MJ, van Rooijen N, Major J, Hamilton TA, Vogel SN", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "10415057", "url": "https://glygen.org/publication/PubMed/10415057" } ] }, { "title": "PPARgamma activation induces the expression of the adipocyte fatty acid binding protein gene in human monocytes.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Pelton PD, Zhou L, Demarest KT, Burris TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "10425206", "url": "https://glygen.org/publication/PubMed/10425206" } ] }, { "title": "The interleukin-10 signal transduction pathway and regulation of gene expression in mononuclear phagocytes.", "journal": "Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research", "date": "1999", "authors": "Donnelly RP, Dickensheets H, Finbloom DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "10433356", "url": "https://glygen.org/publication/PubMed/10433356" } ] }, { "title": "Functional synergism of STAT6 with either NF-kappa B or PU.1 to mediate IL-4-induced activation of IgE germline gene transcription.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Stutz AM, Woisetschlager M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10510379", "url": "https://glygen.org/publication/PubMed/10510379" } ] }, { "title": "Cleavage of the death domain kinase RIP by caspase-8 prompts TNF-induced apoptosis.", "journal": "Genes & development", "date": "1999", "authors": "Lin Y, Devin A, Rodriguez Y, Liu ZG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "10521396", "url": "https://glygen.org/publication/PubMed/10521396" } ] }, { "title": "Activation of eotaxin gene transcription by NF-kappa B and STAT6 in human airway epithelial cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Matsukura S, Stellato C, Plitt JR, Bickel C, Miura K, Georas SN, Casolaro V, Schleimer RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10586089", "url": "https://glygen.org/publication/PubMed/10586089" } ] }, { "title": "Ubiquitin protein ligase activity of IAPs and their degradation in proteasomes in response to apoptotic stimuli.", "journal": "Science (New York, N.Y.)", "date": "2000", "authors": "Yang Y, Fang S, Jensen JP, Weissman AM, Ashwell JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "10797013", "url": "https://glygen.org/publication/PubMed/10797013" } ] }, { "title": "The caspase-8 inhibitor FLIP promotes activation of NF-kappaB and Erk signaling pathways.", "journal": "Current biology : CB", "date": "2000", "authors": "Kataoka T, Budd RC, Holler N, Thome M, Martinon F, Irmler M, Burns K, Hahne M, Kennedy N, Kovacsovics M, Tschopp J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "10837247", "url": "https://glygen.org/publication/PubMed/10837247" } ] }, { "title": "Signal transducer and activator of transcription 3 activates CCAAT enhancer-binding protein delta gene transcription in G0 growth-arrested mouse mammary epithelial cells and in involuting mouse mammary gland.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Hutt JA, O'Rourke JP, DeWille J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10867011", "url": "https://glygen.org/publication/PubMed/10867011" } ] }, { "title": "Characterization of IL-4 and IL-13 signals dependent on the human IL-13 receptor alpha chain 1: redundancy of requirement of tyrosine residue for STAT3 activation.", "journal": "International immunology", "date": "2000", "authors": "Umeshita-Suyama R, Sugimoto R, Akaiwa M, Arima K, Yu B, Wada M, Kuwano M, Nakajima K, Hamasaki N, Izuhara K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11058569", "url": "https://glygen.org/publication/PubMed/11058569" } ] }, { "title": "A stat-responsive element in the promoter of the episialin/MUC1 gene is involved in its overexpression in carcinoma cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Gaemers IC, Vos HL, Volders HH, van der Valk SW, Hilkens J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11084045", "url": "https://glygen.org/publication/PubMed/11084045" } ] }, { "title": "Activation of human peroxisome proliferator-activated receptor (PPAR) subtypes by pioglitazone.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Sakamoto J, Kimura H, Moriyama S, Odaka H, Momose Y, Sugiyama Y, Sawada H", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "11095972", "url": "https://glygen.org/publication/PubMed/11095972" } ] }, { "title": "TRAF1 is a substrate of caspases activated during tumor necrosis factor receptor-alpha-induced apoptosis.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Leo E, Deveraux QL, Buchholtz C, Welsh K, Matsuzawa S, Stennicke HR, Salvesen GS, Reed JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "11098060", "url": "https://glygen.org/publication/PubMed/11098060" } ] }, { "title": "Direct regulation of pituitary proopiomelanocortin by STAT3 provides a novel mechanism for immuno-neuroendocrine interfacing.", "journal": "The Journal of clinical investigation", "date": "2000", "authors": "Bousquet C, Zatelli MC, Melmed S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11104795", "url": "https://glygen.org/publication/PubMed/11104795" } ] }, { "title": "Suppression of signal transducer and activator of transcription 3-dependent B lymphocyte terminal differentiation by BCL-6.", "journal": "The Journal of experimental medicine", "date": "2000", "authors": "Reljic R, Wagner SD, Peakman LJ, Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11120780", "url": "https://glygen.org/publication/PubMed/11120780" } ] }, { "title": "Caspase-cleaved TRAF1 negatively regulates the antiapoptotic signals of TRAF2 during TNF-induced cell death.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Jang HD, Chung YM, Baik JH, Choi YG, Park IS, Jung YK, Lee SY", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "11181075", "url": "https://glygen.org/publication/PubMed/11181075" } ] }, { "title": "Thrombin regulates vascular smooth muscle cell growth and heat shock proteins via the JAK-STAT pathway.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Madamanchi NR, Li S, Patterson C, Runge MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11278437", "url": "https://glygen.org/publication/PubMed/11278437" } ] }, { "title": "Co-operative effect of c-Src tyrosine kinase and Stat3 in activation of hepatocyte growth factor expression in mammary carcinoma cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Hung W, Elliott B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11278729", "url": "https://glygen.org/publication/PubMed/11278729" } ] }, { "title": "c-Jun and c-Fos cooperate with STAT3 in IL-6-induced transactivation of the IL-6 respone element (IRE).", "journal": "Cytokine", "date": "2001", "authors": "Schuringa JJ, Timmer H, Luttickhuizen D, Vellenga E, Kruijer W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11356008", "url": "https://glygen.org/publication/PubMed/11356008" } ] }, { "title": "Stat3-mediated Myc expression is required for Src transformation and PDGF-induced mitogenesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Bowman T, Broome MA, Sinibaldi D, Wharton W, Pledger WJ, Sedivy JM, Irby R, Yeatman T, Courtneidge SA, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11404481", "url": "https://glygen.org/publication/PubMed/11404481" } ] }, { "title": "A cytomegalovirus-encoded inhibitor of apoptosis that suppresses caspase-8 activation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Skaletskaya A, Bartle LM, Chittenden T, McCormick AL, Mocarski ES, Goldmacher VS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "11427719", "url": "https://glygen.org/publication/PubMed/11427719" } ] }, { "title": "Involvement of FAN in TNF-induced apoptosis.", "journal": "The Journal of clinical investigation", "date": "2001", "authors": "Segui B, Cuvillier O, Adam-Klages S, Garcia V, Malagarie-Cazenave S, Leveque S, Caspar-Bauguil S, Coudert J, Salvayre R, Kronke M, Levade T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5626978", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5626978" } ], "reference": [ { "type": "PubMed", "id": "11435466", "url": "https://glygen.org/publication/PubMed/11435466" } ] }, { "title": "Cooperation between STAT3 and c-jun suppresses Fas transcription.", "journal": "Molecular cell", "date": "2001", "authors": "Ivanov VN, Bhoumik A, Krasilnikov M, Raz R, Owen-Schaub LB, Levy D, Horvath CM, Ronai Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11463377", "url": "https://glygen.org/publication/PubMed/11463377" } ] }, { "title": "Contrasting effects of IG20 and its splice isoforms, MADD and DENN-SV, on tumor necrosis factor alpha-induced apoptosis and activation of caspase-8 and -3.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Al-Zoubi AM, Efimova EV, Kaithamana S, Martinez O, El-Idrissi Mel-A, Dogan RE, Prabhakar BS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "11577081", "url": "https://glygen.org/publication/PubMed/11577081" } ] }, { "title": "Regional differences in the response of human pre-adipocytes to PPARgamma and RXRalpha agonists.", "journal": "Diabetes", "date": "2002", "authors": "Sewter CP, Blows F, Vidal-Puig A, O'Rahilly S", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "11872672", "url": "https://glygen.org/publication/PubMed/11872672" } ] }, { "title": "Constitutive Stat3 activity up-regulates VEGF expression and tumor angiogenesis.", "journal": "Oncogene", "date": "2002", "authors": "Niu G, Wright KL, Huang M, Song L, Haura E, Turkson J, Zhang S, Wang T, Sinibaldi D, Coppola D, Heller R, Ellis LM, Karras J, Bromberg J, Pardoll D, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11960372", "url": "https://glygen.org/publication/PubMed/11960372" } ] }, { "title": "A20 inhibits tumor necrosis factor (TNF) alpha-induced apoptosis by disrupting recruitment of TRADD and RIP to the TNF receptor 1 complex in Jurkat T cells.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "He KL, Ting AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "12167698", "url": "https://glygen.org/publication/PubMed/12167698" } ] }, { "title": "Leptin gene expression in human preadipocytes is switched on by maturation-induced demethylation of distinct CpGs in its proximal promoter.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Melzner I, Scott V, Dorsch K, Fischer P, Wabitsch M, Bruderlein S, Hasel C, Moller P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "12213831", "url": "https://glygen.org/publication/PubMed/12213831" } ] }, { "title": "IL-13 signal transduction in human monocytes: phosphorylation of receptor components, association with Jaks, and phosphorylation/activation of Stats.", "journal": "Journal of leukocyte biology", "date": "2002", "authors": "Roy B, Bhattacharjee A, Xu B, Ford D, Maizel AL, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12223527", "url": "https://glygen.org/publication/PubMed/12223527" } ] }, { "title": "Expression of the suppressor of cytokine signaling-5 (SOCS5) negatively regulates IL-4-dependent STAT6 activation and Th2 differentiation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Seki Y, Hayashi K, Matsumoto A, Seki N, Tsukada J, Ransom J, Naka T, Kishimoto T, Yoshimura A, Kubo M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12242343", "url": "https://glygen.org/publication/PubMed/12242343" } ] }, { "title": "Interaction with factor associated with neutral sphingomyelinase activation, a WD motif-containing protein, identifies receptor for activated C-kinase 1 as a novel component of the signaling pathways of the p55 TNF receptor.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2002", "authors": "Tcherkasowa AE, Adam-Klages S, Kruse ML, Wiegmann K, Mathieu S, Kolanus W, Kronke M, Adam D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5626978", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5626978" } ], "reference": [ { "type": "PubMed", "id": "12391233", "url": "https://glygen.org/publication/PubMed/12391233" } ] }, { "title": "New microRNAs from mouse and human.", "journal": "RNA (New York, N.Y.)", "date": "2003", "authors": "Lagos-Quintana M, Rauhut R, Meyer J, Borkhardt A, Tuschl T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "12554859", "url": "https://glygen.org/publication/PubMed/12554859" } ] }, { "title": "Independent and cooperative activation of chromosomal c-fos promoter by STAT3.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Yang E, Lerner L, Besser D, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12600988", "url": "https://glygen.org/publication/PubMed/12600988" } ] }, { "title": "Activation of STAT3 by IL-6 and IL-10 in primary human macrophages is differentially modulated by suppressor of cytokine signaling 3.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2003", "authors": "Niemand C, Nimmesgern A, Haan S, Fischer P, Schaper F, Rossaint R, Heinrich PC, Muller-Newen G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "12626585", "url": "https://glygen.org/publication/PubMed/12626585" } ] }, { "title": "Caspase-mediated cleavage converts the tumor necrosis factor (TNF) receptor-associated factor (TRAF)-1 from a selective modulator of TNF receptor signaling to a general inhibitor of NF-kappaB activation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Henkler F, Baumann B, Fotin-Mleczek M, Weingartner M, Schwenzer R, Peters N, Graness A, Wirth T, Scheurich P, Schmid JA, Wajant H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "12709429", "url": "https://glygen.org/publication/PubMed/12709429" } ] }, { "title": "Fas-associated death domain protein and caspase-8 are not recruited to the tumor necrosis factor receptor 1 signaling complex during tumor necrosis factor-induced apoptosis.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Harper N, Hughes M, MacFarlane M, Cohen GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357786", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357786" } ], "reference": [ { "type": "PubMed", "id": "12721308", "url": "https://glygen.org/publication/PubMed/12721308" } ] }, { "title": "Cytokine gene polymorphisms: association with psoriatic arthritis susceptibility and severity.", "journal": "Arthritis Rheum.", "date": "2003", "authors": "Balding Joanna, Kane David, Livingstone Wendy, Mynett-Johnson Lesley, Bresnihan Barry, Smith Owen, FitzGerald Oliver", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "reference": [ { "type": "PubMed", "id": "12746914", "url": "https://glygen.org/publication/PubMed/12746914" } ] }, { "title": "Anti-interleukin-6 receptor antibody therapy reduces vascular endothelial growth factor production in rheumatoid arthritis.", "journal": "Arthritis and rheumatism", "date": "2003-06", "authors": "Nakahara Hideko, Song Jian, Sugimoto Masamichi, Hagihara Keisuke, Kishimoto Tadamitsu, Yoshizaki Kazuyuki, Nishimoto Norihiro", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "reference": [ { "type": "PubMed", "id": "12794819", "url": "https://glygen.org/publication/PubMed/12794819" } ] }, { "title": "Induction of adiponectin, a fat-derived antidiabetic and antiatherogenic factor, by nuclear receptors.", "journal": "Diabetes", "date": "2003", "authors": "Iwaki M, Matsuda M, Maeda N, Funahashi T, Matsuzawa Y, Makishima M, Shimomura I", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "12829629", "url": "https://glygen.org/publication/PubMed/12829629" } ] }, { "title": "STATs dimerize in the absence of phosphorylation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Braunstein J, Brutsaert S, Olson R, Schindler C", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "12832402", "url": "https://glygen.org/publication/PubMed/12832402" } ] }, { "title": "Induction of TNF receptor I-mediated apoptosis via two sequential signaling complexes.", "journal": "Cell", "date": "2003", "authors": "Micheau O, Tschopp J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357786", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357786" } ], "reference": [ { "type": "PubMed", "id": "12887920", "url": "https://glygen.org/publication/PubMed/12887920" } ] }, { "title": "Association of TNF-alpha promoter polymorphisms with the clearance of hepatitis B virus infection.", "journal": "Hum. Mol. Genet.", "date": "2003", "authors": "Kim Yoon Jun, Lee Hyo-Suk, Yoon Jung-Hwan, Kim Chung Yong, Park Myoung Hee, Kim Lyoung Hyo, Park Byung Lae, Shin Hyoung Doo", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "reference": [ { "type": "PubMed", "id": "12915457", "url": "https://glygen.org/publication/PubMed/12915457" } ] }, { "title": "Myristyl acylation of the tumor necrosis factor alpha precursor on specific lysine residues.", "journal": "J. Exp. Med.", "date": "1992", "authors": "Stevenson FT, Bursten SL, Locksley RM, Lovett DH", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "reference": [ { "type": "PubMed", "id": "1402651", "url": "https://glygen.org/publication/PubMed/1402651" } ] }, { "title": "IL-10 stimulates monocyte Fc gamma R surface expression and cytotoxic activity. Distinct regulation of antibody-dependent cellular cytotoxicity by IFN-gamma, IL-4, and IL-10.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1992", "authors": "te Velde AA, de Waal Malefijt R, Huijbens RJ, de Vries JE, Figdor CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "1460289", "url": "https://glygen.org/publication/PubMed/1460289" } ] }, { "title": "IL-4 and IL-13 induce SOCS-1 gene expression in A549 cells by three functional STAT6-binding motifs located upstream of the transcription initiation site.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2003", "authors": "Hebenstreit D, Luft P, Schmiedlechner A, Regl G, Frischauf AM, Aberger F, Duschl A, Horejs-Hoeck J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "14634100", "url": "https://glygen.org/publication/PubMed/14634100" } ] }, { "title": "Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse.", "journal": "Genome Res.", "date": "2003", "authors": "Xie T, Rowen L, Aguado B, Ahearn ME, Madan A, Qin S, Campbell RD, Hood L", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "reference": [ { "type": "PubMed", "id": "14656967", "url": "https://glygen.org/publication/PubMed/14656967" } ] }, { "title": "Stat3 enhances vimentin gene expression by binding to the antisilencer element and interacting with the repressor protein, ZBP-89.", "journal": "Oncogene", "date": "2004", "authors": "Wu Y, Diab I, Zhang X, Izmailova ES, Zehner ZE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "14712222", "url": "https://glygen.org/publication/PubMed/14712222" } ] }, { "title": "IG20, in contrast to DENN-SV, (MADD splice variants) suppresses tumor cell survival, and enhances their susceptibility to apoptosis and cancer drugs.", "journal": "Oncogene", "date": "2004", "authors": "Efimova EV, Al-Zoubi AM, Martinez O, Kaithamana S, Lu S, Arima T, Prabhakar BS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "14716293", "url": "https://glygen.org/publication/PubMed/14716293" } ] }, { "title": "N-terminal fragment of c-FLIP(L) processed by caspase 8 specifically interacts with TRAF2 and induces activation of the NF-kappaB signaling pathway.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Kataoka T, Tschopp J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "15024054", "url": "https://glygen.org/publication/PubMed/15024054" } ] }, { "title": "Regulation of the NF-kappaB-inducing kinase by tumor necrosis factor receptor-associated factor 3-induced degradation.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Liao G, Zhang M, Harhaj EW, Sun SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "15084608", "url": "https://glygen.org/publication/PubMed/15084608" } ] }, { "title": "Stat3 activation regulates the expression of matrix metalloproteinase-2 and tumor invasion and metastasis.", "journal": "Oncogene", "date": "2004", "authors": "Xie TX, Wei D, Liu M, Gao AC, Ali-Osman F, Sawaya R, Huang S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15116091", "url": "https://glygen.org/publication/PubMed/15116091" } ] }, { "title": "De-ubiquitination and ubiquitin ligase domains of A20 downregulate NF-kappaB signalling.", "journal": "Nature", "date": "2004", "authors": "Wertz IE, O'Rourke KM, Zhou H, Eby M, Aravind L, Seshagiri S, Wu P, Wiesmann C, Baker R, Boone DL, Ma A, Koonin EV, Dixit VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "15258597", "url": "https://glygen.org/publication/PubMed/15258597" } ] }, { "title": "STAT-1 is activated by IL-4 and IL-13 in multiple cell types.", "journal": "Molecular immunology", "date": "2004", "authors": "Wang IM, Lin H, Goldman SJ, Kobayashi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15261459", "url": "https://glygen.org/publication/PubMed/15261459" } ] }, { "title": "Human adipocyte fatty acid-binding protein (aP2) gene promoter-driven reporter assay discriminates nonlipogenic peroxisome proliferator-activated receptor gamma ligands.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2004", "authors": "Rival Y, Stennevin A, Puech L, Rouquette A, Cathala C, Lestienne F, Dupont-Passelaigue E, Patoiseau JF, Wurch T, Junquero D", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "15273253", "url": "https://glygen.org/publication/PubMed/15273253" } ] }, { "title": "Release of tumour necrosis factor alpha (TNFalpha) by TNFalpha cleaving enzyme (TACE) in response to septic stimuli in vitro.", "journal": "British journal of anaesthesia", "date": "2005", "authors": "Robertshaw HJ, Brennan FM", "evidence": [ { "database": "Reactome", "id": "R-HSA-75893", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75893" } ], "reference": [ { "type": "PubMed", "id": "15556967", "url": "https://glygen.org/publication/PubMed/15556967" } ] }, { "title": "STAT6 transcription factor binding sites with mismatches within the canonical 5'-TTC...GAA-3' motif involved in regulation of delta- and mu-opioid receptors.", "journal": "Journal of neurochemistry", "date": "2004", "authors": "Borner C, Woltje M, Hollt V, Kraus J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15584925", "url": "https://glygen.org/publication/PubMed/15584925" } ] }, { "title": "Aberrant Stat3 signaling by interleukin-4 in malignant glioma cells: involvement of IL-13Ralpha2.", "journal": "Cancer research", "date": "2005", "authors": "Rahaman SO, Vogelbaum MA, Haque SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15805299", "url": "https://glygen.org/publication/PubMed/15805299" } ] }, { "title": "Identification of the promoter region required for human adiponectin gene transcription: Association with CCAAT/enhancer binding protein-beta and tumor necrosis factor-alpha.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Kita A, Yamasaki H, Kuwahara H, Moriuchi A, Fukushima K, Kobayashi M, Fukushima T, Takahashi R, Abiru N, Uotani S, Kawasaki E, Eguchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "15850785", "url": "https://glygen.org/publication/PubMed/15850785" } ] }, { "title": "Gene expression alterations of human peripheral blood monocytes induced by medium-term treatment with the TH2-cytokines interleukin-4 and -13.", "journal": "Cytokine", "date": "2005", "authors": "Chaitidis P, O'Donnell V, Kuban RJ, Bermudez-Fajardo A, Ungethuem U, Kuhn H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15869882", "url": "https://glygen.org/publication/PubMed/15869882" } ] }, { "title": "Regulation of the deubiquitinating enzyme CYLD by IkappaB kinase gamma-dependent phosphorylation.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Reiley W, Zhang M, Wu X, Granger E, Sun SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "15870263", "url": "https://glygen.org/publication/PubMed/15870263" } ] }, { "title": "C/EBPalpha regulates human adiponectin gene transcription through an intronic enhancer.", "journal": "Diabetes", "date": "2005", "authors": "Qiao L, Maclean PS, Schaack J, Orlicky DJ, Darimont C, Pagliassotti M, Friedman JE, Shao J", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "15919796", "url": "https://glygen.org/publication/PubMed/15919796" } ] }, { "title": "STAT3 nuclear import is independent of tyrosine phosphorylation and mediated by importin-alpha3.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Liu L, McBride KM, Reich NC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "15919823", "url": "https://glygen.org/publication/PubMed/15919823" } ] }, { "title": "Nuclear interaction of EGFR and STAT3 in the activation of the iNOS/NO pathway.", "journal": "Cancer cell", "date": "2005", "authors": "Lo HW, Hsu SC, Ali-Seyed M, Gunduz M, Xia W, Wei Y, Bartholomeusz G, Shih JY, Hung MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15950906", "url": "https://glygen.org/publication/PubMed/15950906" } ] }, { "title": "Targeting Stat3 blocks both HIF-1 and VEGF expression induced by multiple oncogenic growth signaling pathways.", "journal": "Oncogene", "date": "2005", "authors": "Xu Q, Briggs J, Park S, Niu G, Kortylewski M, Zhang S, Gritsko T, Turkson J, Kay H, Semenza GL, Cheng JQ, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16007214", "url": "https://glygen.org/publication/PubMed/16007214" } ] }, { "title": "STAT3-mediated transcription of Bcl-2, Mcl-1 and c-IAP2 prevents apoptosis in polyamine-depleted cells.", "journal": "The Biochemical journal", "date": "2005", "authors": "Bhattacharya S, Ray RM, Johnson LR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16048438", "url": "https://glygen.org/publication/PubMed/16048438" } ] }, { "title": "Role of Stat3 in regulating p53 expression and function.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Niu G, Wright KL, Ma Y, Wright GM, Huang M, Irby R, Briggs J, Karras J, Cress WD, Pardoll D, Jove R, Chen J, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16107692", "url": "https://glygen.org/publication/PubMed/16107692" } ] }, { "title": "Requirement of STAT3 activation for maximal collagenase-1 (MMP-1) induction by epidermal growth factor and malignant characteristics in T24 bladder cancer cells.", "journal": "Oncogene", "date": "2006", "authors": "Itoh M, Murata T, Suzuki T, Shindoh M, Nakajima K, Imai K, Yoshida K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16205632", "url": "https://glygen.org/publication/PubMed/16205632" } ] }, { "title": "Essential role of STAT3 in cytokine-driven NF-kappaB-mediated serum amyloid A gene expression.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2005", "authors": "Hagihara K, Nishikawa T, Sugamata Y, Song J, Isobe T, Taga T, Yoshizaki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16236134", "url": "https://glygen.org/publication/PubMed/16236134" } ] }, { "title": "TAK1 is recruited to the tumor necrosis factor-alpha (TNF-alpha) receptor 1 complex in a receptor-interacting protein (RIP)-dependent manner and cooperates with MEKK3 leading to NF-kappaB activation.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Blonska M, Shambharkar PB, Kobayashi M, Zhang D, Sakurai H, Su B, Lin X", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357956", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357956" } ], "reference": [ { "type": "PubMed", "id": "16260783", "url": "https://glygen.org/publication/PubMed/16260783" } ] }, { "title": "Distinct BIR domains of cIAP1 mediate binding to and ubiquitination of tumor necrosis factor receptor-associated factor 2 and second mitochondrial activator of caspases.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Samuel T, Welsh K, Lober T, Togo SH, Zapata JM, Reed JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357956", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357956" } ], "reference": [ { "type": "PubMed", "id": "16282325", "url": "https://glygen.org/publication/PubMed/16282325" } ] }, { "title": "Identification of novel PPARgamma target genes in primary human adipocytes.", "journal": "Gene", "date": "2006", "authors": "Perera RJ, Marcusson EG, Koo S, Kang X, Kim Y, White N, Dean NM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "16380219", "url": "https://glygen.org/publication/PubMed/16380219" } ] }, { "title": "Persistent activation of stat3 signaling induces survivin gene expression and confers resistance to apoptosis in human breast cancer cells.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2006", "authors": "Gritsko T, Williams A, Turkson J, Kaneko S, Bowman T, Huang M, Nam S, Eweis I, Diaz N, Sullivan D, Yoder S, Enkemann S, Eschrich S, Lee JH, Beam CA, Cheng J, Minton S, Muro-Cacho CA, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16397018", "url": "https://glygen.org/publication/PubMed/16397018" } ] }, { "title": "SOCS1: a potent and multifaceted regulator of cytokines and cell-mediated inflammation.", "journal": "Tissue antigens", "date": "2006", "authors": "Davey GM, Heath WR, Starr R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16451196", "url": "https://glygen.org/publication/PubMed/16451196" } ] }, { "title": "Cyclin D1 is transcriptionally regulated by and required for transformation by activated signal transducer and activator of transcription 3.", "journal": "Cancer research", "date": "2006", "authors": "Leslie K, Lang C, Devgan G, Azare J, Berishaj M, Gerald W, Kim YB, Paz K, Darnell JE, Albanese C, Sakamaki T, Pestell R, Bromberg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16510571", "url": "https://glygen.org/publication/PubMed/16510571" } ] }, { "title": "Signaling mechanisms, interaction partners, and target genes of STAT6.", "journal": "Cytokine & growth factor reviews", "date": "2006", "authors": "Hebenstreit D, Wirnsberger G, Horejs-Hoeck J, Duschl A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16540365", "url": "https://glygen.org/publication/PubMed/16540365" } ] }, { "title": "Activation of IKK by TNFalpha requires site-specific ubiquitination of RIP1 and polyubiquitin binding by NEMO.", "journal": "Molecular cell", "date": "2006", "authors": "Ea CK, Deng L, Xia ZP, Pineda G, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357956", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357956" } ], "reference": [ { "type": "PubMed", "id": "16603398", "url": "https://glygen.org/publication/PubMed/16603398" } ] }, { "title": "Loss of SOCS3 in T helper cells resulted in reduced immune responses and hyperproduction of interleukin 10 and transforming growth factor-beta 1.", "journal": "The Journal of experimental medicine", "date": "2006", "authors": "Kinjyo I, Inoue H, Hamano S, Fukuyama S, Yoshimura T, Koga K, Takaki H, Himeno K, Takaesu G, Kobayashi T, Yoshimura A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16606674", "url": "https://glygen.org/publication/PubMed/16606674" } ] }, { "title": "MADD/DENN splice variant of the IG20 gene is necessary and sufficient for cancer cell survival.", "journal": "Oncogene", "date": "2006", "authors": "Mulherkar N, Ramaswamy M, Mordi DC, Prabhakar BS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "16682944", "url": "https://glygen.org/publication/PubMed/16682944" } ] }, { "title": "A gamma-secretase-like intramembrane cleavage of TNFalpha by the GxGD aspartyl protease SPPL2b.", "journal": "Nature cell biology", "date": "2006", "authors": "Fluhrer R, Grammer G, Israel L, Condron MM, Haffner C, Friedmann E, Bohland C, Imhof A, Martoglio B, Teplow DB, Haass C", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" }, { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "16829951", "url": "https://glygen.org/publication/PubMed/16829951" } ] }, { "title": "SPPL2a and SPPL2b promote intramembrane proteolysis of TNFalpha in activated dendritic cells to trigger IL-12 production.", "journal": "Nature cell biology", "date": "2006", "authors": "Friedmann E, Hauben E, Maylandt K, Schleeger S, Vreugde S, Lichtenthaler SF, Kuhn PH, Stauffer D, Rovelli G, Martoglio B", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" }, { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "16829952", "url": "https://glygen.org/publication/PubMed/16829952" } ] }, { "title": "Evidence that TNF-TNFR1-TRADD-TRAF2-RIP-TAK1-IKK pathway mediates constitutive NF-kappaB activation and proliferation in human head and neck squamous cell carcinoma.", "journal": "Oncogene", "date": "2007", "authors": "Jackson-Bernitsas DG, Ichikawa H, Takada Y, Myers JN, Lin XL, Darnay BG, Chaturvedi MM, Aggarwal BB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357956", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357956" } ], "reference": [ { "type": "PubMed", "id": "16953224", "url": "https://glygen.org/publication/PubMed/16953224" } ] }, { "title": "Conformational changes mediate interleukin-10 receptor 2 (IL-10R2) binding to IL-10 and assembly of the signaling complex.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Yoon SI, Logsdon NJ, Sheikh F, Donnelly RP, Walter MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "16982608", "url": "https://glygen.org/publication/PubMed/16982608" } ] }, { "title": "Transcriptional control of adipocyte formation.", "journal": "Cell metabolism", "date": "2006", "authors": "Farmer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "17011499", "url": "https://glygen.org/publication/PubMed/17011499" } ] }, { "title": "MADD/DENN splice variant of the IG20 gene is a negative regulator of caspase-8 activation. Knockdown enhances TRAIL-induced apoptosis of cancer cells.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Mulherkar N, Prasad KV, Prabhakar BS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "17314102", "url": "https://glygen.org/publication/PubMed/17314102" } ] }, { "title": "Diverse effects of Stat1 on the regulation of hsp90alpha gene under heat shock.", "journal": "Journal of cellular biochemistry", "date": "2007", "authors": "Chen XS, Zhang Y, Wang JS, Li XY, Cheng XK, Zhang Y, Wu NH, Shen YF", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "17427945", "url": "https://glygen.org/publication/PubMed/17427945" } ] }, { "title": "IL-13 induces expression of CD36 in human monocytes through PPARgamma activation.", "journal": "European journal of immunology", "date": "2007", "authors": "Berry A, Balard P, Coste A, Olagnier D, Lagane C, Authier H, Benoit-Vical F, Lepert JC, Seguela JP, Magnaval JF, Chambon P, Metzger D, Desvergne B, Wahli W, Auwerx J, Pipy B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "17458857", "url": "https://glygen.org/publication/PubMed/17458857" } ] }, { "title": "Fra-1 and Stat3 synergistically regulate activation of human MMP-9 gene.", "journal": "Molecular immunology", "date": "2008", "authors": "Song Y, Qian L, Song S, Chen L, Zhang Y, Yuan G, Zhang H, Xia Q, Hu M, Yu M, Shi M, Jiang Z, Guo N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "17572495", "url": "https://glygen.org/publication/PubMed/17572495" } ] }, { "title": "Mechanism of action of certolizumab pegol (CDP870): in vitro comparison with other anti-tumor necrosis factor alpha agents.", "journal": "Inflammatory bowel diseases", "date": "2007", "authors": "Nesbitt A, Fossati G, Bergin M, Stephens P, Stephens S, Foulkes R, Brown D, Robinson M, Bourne T", "evidence": [ { "database": "Reactome", "id": "R-HSA-75893", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75893" } ], "reference": [ { "type": "PubMed", "id": "17636564", "url": "https://glygen.org/publication/PubMed/17636564" } ] }, { "title": "Optineurin negatively regulates TNFalpha- induced NF-kappaB activation by competing with NEMO for ubiquitinated RIP.", "journal": "Current biology : CB", "date": "2007", "authors": "Zhu G, Wu CJ, Zhao Y, Ashwell JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "17702576", "url": "https://glygen.org/publication/PubMed/17702576" } ] }, { "title": "Effect of heterodimer partner RXRalpha on PPARgamma activation function-2 helix in solution.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Lu J, Chen M, Stanley SE, Li E", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "17980149", "url": "https://glygen.org/publication/PubMed/17980149" } ] }, { "title": "NF-kappaB suppression by the deubiquitinating enzyme Cezanne: a novel negative feedback loop in pro-inflammatory signaling.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Enesa K, Zakkar M, Chaudhury H, Luong le A, Rawlinson L, Mason JC, Haskard DO, Dean JL, Evans PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "18178551", "url": "https://glygen.org/publication/PubMed/18178551" } ] }, { "title": "Molecular and structural basis of cytokine receptor pleiotropy in the interleukin-4/13 system.", "journal": "Cell", "date": "2008", "authors": "LaPorte SL, Juo ZS, Vaclavikova J, Colf LA, Qi X, Heller NM, Keegan AD, Garcia KC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18243101", "url": "https://glygen.org/publication/PubMed/18243101" } ] }, { "title": "Twist is transcriptionally induced by activation of STAT3 and mediates STAT3 oncogenic function.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Cheng GZ, Zhang WZ, Sun M, Wang Q, Coppola D, Mansour M, Xu LM, Costanzo C, Cheng JQ, Wang LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18353781", "url": "https://glygen.org/publication/PubMed/18353781" } ] }, { "title": "Regulation of Sox2 by STAT3 initiates commitment to the neural precursor cell fate.", "journal": "Stem cells and development", "date": "2008", "authors": "Foshay KM, Gallicano GI", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18447642", "url": "https://glygen.org/publication/PubMed/18447642" } ] }, { "title": "Essential cytoplasmic translocation of a cytokine receptor-assembled signaling complex.", "journal": "Science (New York, N.Y.)", "date": "2008", "authors": "Matsuzawa A, Tseng PH, Vallabhapurapu S, Luo JL, Zhang W, Wang H, Vignali DA, Gallagher E, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "18635759", "url": "https://glygen.org/publication/PubMed/18635759" } ] }, { "title": "Signal transducer and activator of transcription 3 is required for hypoxia-inducible factor-1alpha RNA expression in both tumor cells and tumor-associated myeloid cells.", "journal": "Molecular cancer research : MCR", "date": "2008", "authors": "Niu G, Briggs J, Deng J, Ma Y, Lee H, Kortylewski M, Kujawski M, Kay H, Cress WD, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18644974", "url": "https://glygen.org/publication/PubMed/18644974" } ] }, { "title": "Identification of a novel distal enhancer in human adiponectin gene.", "journal": "The Journal of endocrinology", "date": "2009", "authors": "Segawa K, Matsuda M, Fukuhara A, Morita K, Okuno Y, Komuro R, Shimomura I", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "18931025", "url": "https://glygen.org/publication/PubMed/18931025" } ] }, { "title": "Nonredundant and complementary functions of TRAF2 and TRAF3 in a ubiquitination cascade that activates NIK-dependent alternative NF-kappaB signaling.", "journal": "Nature immunology", "date": "2008", "authors": "Vallabhapurapu S, Matsuzawa A, Zhang W, Tseng PH, Keats JJ, Wang H, Vignali DA, Bergsagel PL, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "18997792", "url": "https://glygen.org/publication/PubMed/18997792" } ] }, { "title": "Noncanonical NF-kappaB activation requires coordinated assembly of a regulatory complex of the adaptors cIAP1, cIAP2, TRAF2 and TRAF3 and the kinase NIK.", "journal": "Nature immunology", "date": "2008", "authors": "Zarnegar BJ, Wang Y, Mahoney DJ, Dempsey PW, Cheung HH, He J, Shiba T, Yang X, Yeh WC, Mak TW, Korneluk RG, Cheng G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "18997794", "url": "https://glygen.org/publication/PubMed/18997794" } ] }, { "title": "Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.", "journal": "Nature", "date": "2008", "authors": "Chandra V, Huang P, Hamuro Y, Raghuram S, Wang Y, Burris TP, Rastinejad F", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "19043829", "url": "https://glygen.org/publication/PubMed/19043829" } ] }, { "title": "A-FABP, a candidate progression marker of human transitional cell carcinoma of the bladder, is differentially regulated by PPAR in urothelial cancer cells.", "journal": "International journal of cancer", "date": "2009", "authors": "Boiteux G, Lascombe I, Roche E, Plissonnier ML, Clairotte A, Bittard H, Fauconnet S", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "19115207", "url": "https://glygen.org/publication/PubMed/19115207" } ] }, { "title": "Mechanism of interferon-gamma mediated down-regulation of interleukin-10 gene expression.", "journal": "Molecular immunology", "date": "2009", "authors": "Schaefer A, Unterberger C, Frankenberger M, Lohrum M, Staples KJ, Werner T, Stunnenberg H, Ziegler-Heitbrock L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "19124156", "url": "https://glygen.org/publication/PubMed/19124156" } ] }, { "title": "Structural basis for the activation of PPARgamma by oxidized fatty acids.", "journal": "Nature structural & molecular biology", "date": "2008", "authors": "Itoh T, Fairall L, Amin K, Inaba Y, Szanto A, Balint BL, Nagy L, Yamamoto K, Schwabe JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "19172745", "url": "https://glygen.org/publication/PubMed/19172745" } ] }, { "title": "Regulation of the IL-23 and IL-12 balance by Stat3 signaling in the tumor microenvironment.", "journal": "Cancer cell", "date": "2009", "authors": "Kortylewski M, Xin H, Kujawski M, Lee H, Liu Y, Harris T, Drake C, Pardoll D, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "19185846", "url": "https://glygen.org/publication/PubMed/19185846" } ] }, { "title": "Structural and biochemical studies on procaspase-8: new insights on initiator caspase activation.", "journal": "Structure (London, England : 1993)", "date": "2009", "authors": "Keller N, Mares J, Zerbe O, Grutter MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "19278658", "url": "https://glygen.org/publication/PubMed/19278658" } ] }, { "title": "MADD, a splice variant of IG20, is indispensable for MAPK activation and protection against apoptosis upon tumor necrosis factor-alpha treatment.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Kurada BR, Li LC, Mulherkar N, Subramanian M, Prasad KV, Prabhakar BS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "19289468", "url": "https://glygen.org/publication/PubMed/19289468" } ] }, { "title": "The RhoU/Wrch1 Rho GTPase gene is a common transcriptional target of both the gp130/STAT3 and Wnt-1 pathways.", "journal": "The Biochemical journal", "date": "2009", "authors": "Schiavone D, Dewilde S, Vallania F, Turkson J, Di Cunto F, Poli V", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "19397496", "url": "https://glygen.org/publication/PubMed/19397496" } ] }, { "title": "IL-10 inhibits cytokine production by activated macrophages.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1991", "authors": "Fiorentino DF, Zlotnik A, Mosmann TR, Howard M, O'Garra A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "1940369", "url": "https://glygen.org/publication/PubMed/1940369" } ] }, { "title": "Interleukin 10(IL-10) inhibits cytokine synthesis by human monocytes: an autoregulatory role of IL-10 produced by monocytes.", "journal": "The Journal of experimental medicine", "date": "1991", "authors": "de Waal Malefyt R, Abrams J, Bennett B, Figdor CG, de Vries JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "1940799", "url": "https://glygen.org/publication/PubMed/1940799" } ] }, { "title": "Mechanism of procaspase-8 activation by c-FLIPL.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Yu JW, Jeffrey PD, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "19416807", "url": "https://glygen.org/publication/PubMed/19416807" } ] }, { "title": "The structure of tumour necrosis factor -- implications for biological function.", "journal": "J. Cell Sci. Suppl.", "date": "1990", "authors": "Jones E Y, Stuart D I, Walker N P", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "reference": [ { "type": "PubMed", "id": "1964681", "url": "https://glygen.org/publication/PubMed/1964681" } ] }, { "title": "TRAF2 must bind to cellular inhibitors of apoptosis for tumor necrosis factor (tnf) to efficiently activate nf-{kappa}b and to prevent tnf-induced apoptosis.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Vince JE, Pantaki D, Feltham R, Mace PD, Cordier SM, Schmukle AC, Davidson AJ, Callus BA, Wong WW, Gentle IE, Carter H, Lee EF, Walczak H, Day CL, Vaux DL, Silke J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "19815541", "url": "https://glygen.org/publication/PubMed/19815541" } ] }, { "title": "Ubiquitin-specific peptidase 21 inhibits tumor necrosis factor alpha-induced nuclear factor kappaB activation via binding to and deubiquitinating receptor-interacting protein 1.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Xu G, Tan X, Wang H, Sun W, Shi Y, Burlingame S, Gu X, Cao G, Zhang T, Qin J, Yang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "19910467", "url": "https://glygen.org/publication/PubMed/19910467" } ] }, { "title": "Recruitment of the linear ubiquitin chain assembly complex stabilizes the TNF-R1 signaling complex and is required for TNF-mediated gene induction.", "journal": "Molecular cell", "date": "2009", "authors": "Haas TL, Emmerich CH, Gerlach B, Schmukle AC, Cordier SM, Rieser E, Feltham R, Vince J, Warnken U, Wenger T, Koschny R, Komander D, Silke J, Walczak H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357956", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357956" } ], "reference": [ { "type": "PubMed", "id": "20005846", "url": "https://glygen.org/publication/PubMed/20005846" } ] }, { "title": "The Polycomb group protein EED couples TNF receptor 1 to neutral sphingomyelinase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Philipp S, Puchert M, Adam-Klages S, Tchikov V, Winoto-Morbach S, Mathieu S, Deerberg A, Kolker L, Marchesini N, Kabelitz D, Hannun YA, Schutze S, Adam D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5626978", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5626978" } ], "reference": [ { "type": "PubMed", "id": "20080539", "url": "https://glygen.org/publication/PubMed/20080539" } ] }, { "title": "Localization of the active site of human tumour necrosis factor (hTNF) by mutational analysis.", "journal": "The EMBO journal", "date": "1991", "authors": "Van Ostade X, Tavernier J, Prange T, Fiers W", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "reference": [ { "type": "PubMed", "id": "2009860", "url": "https://glygen.org/publication/PubMed/2009860" } ] }, { "title": "Human fetal mesenchymal stem cells differentiate into brown and white adipocytes: a role for ERRalpha in human UCP1 expression.", "journal": "Cell research", "date": "2010", "authors": "Morganstein DL, Wu P, Mane MR, Fisk NM, White R, Parker MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "20101261", "url": "https://glygen.org/publication/PubMed/20101261" } ] }, { "title": "Cyclooxygenase-2 is a novel transcriptional target of the nuclear EGFR-STAT3 and EGFRvIII-STAT3 signaling axes.", "journal": "Molecular cancer research : MCR", "date": "2010", "authors": "Lo HW, Cao X, Zhu H, Ali-Osman F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "20145033", "url": "https://glygen.org/publication/PubMed/20145033" } ] }, { "title": "Inhibition of NF-kappaB signaling by A20 through disruption of ubiquitin enzyme complexes.", "journal": "Science (New York, N.Y.)", "date": "2010", "authors": "Shembade N, Ma A, Harhaj EW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "20185725", "url": "https://glygen.org/publication/PubMed/20185725" } ] }, { "title": "The human cytomegalovirus UL36 gene controls caspase-dependent and -independent cell death programs activated by infection of monocytes differentiating to macrophages.", "journal": "Journal of virology", "date": "2010", "authors": "McCormick AL, Roback L, Livingston-Rosanoff D, St Clair C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "20219915", "url": "https://glygen.org/publication/PubMed/20219915" } ] }, { "title": "TAX1BP1 and A20 inhibit antiviral signaling by targeting TBK1-IKKi kinases.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Parvatiyar K, Barber GN, Harhaj EW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "20304918", "url": "https://glygen.org/publication/PubMed/20304918" } ] }, { "title": "Crystal structures of the TRAF2: cIAP2 and the TRAF1: TRAF2: cIAP2 complexes: affinity, specificity, and regulation.", "journal": "Molecular cell", "date": "2010", "authors": "Zheng C, Kabaleeswaran V, Wang Y, Cheng G, Wu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357956", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357956" } ], "reference": [ { "type": "PubMed", "id": "20385093", "url": "https://glygen.org/publication/PubMed/20385093" } ] }, { "title": "Diverse targets of the transcription factor STAT3 contribute to T cell pathogenicity and homeostasis.", "journal": "Immunity", "date": "2010", "authors": "Durant L, Watford WT, Ramos HL, Laurence A, Vahedi G, Wei L, Takahashi H, Sun HW, Kanno Y, Powrie F, O'Shea JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "20493732", "url": "https://glygen.org/publication/PubMed/20493732" } ] }, { "title": "Solution of the structure of the TNF-TNFR2 complex.", "journal": "Science signaling", "date": "2010", "authors": "Mukai Y, Nakamura T, Yoshikawa M, Yoshioka Y, Tsunoda S, Nakagawa S, Yamagata Y, Tsutsumi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "21081755", "url": "https://glygen.org/publication/PubMed/21081755" } ] }, { "title": "Anti-TNF-alpha agents in the treatment of immune-mediated inflammatory diseases: mechanisms of action and pitfalls.", "journal": "Immunotherapy", "date": "2010", "authors": "Silva LC, Ortigosa LC, Benard G", "evidence": [ { "database": "Reactome", "id": "R-HSA-75893", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75893" } ], "reference": [ { "type": "PubMed", "id": "21091114", "url": "https://glygen.org/publication/PubMed/21091114" } ] }, { "title": "STAT3-induced S1PR1 expression is crucial for persistent STAT3 activation in tumors.", "journal": "Nature medicine", "date": "2010", "authors": "Lee H, Deng J, Kujawski M, Yang C, Liu Y, Herrmann A, Kortylewski M, Horne D, Somlo G, Forman S, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21102457", "url": "https://glygen.org/publication/PubMed/21102457" } ] }, { "title": "FLIP(L) induces caspase 8 activity in the absence of interdomain caspase 8 cleavage and alters substrate specificity.", "journal": "The Biochemical journal", "date": "2011", "authors": "Pop C, Oberst A, Drag M, Van Raam BJ, Riedl SJ, Green DR, Salvesen GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "21235526", "url": "https://glygen.org/publication/PubMed/21235526" } ] }, { "title": "alphaMbeta(2) integrin activation prevents alternative activation of human and murine macrophages and impedes foam cell formation.", "journal": "Circulation research", "date": "2011", "authors": "Yakubenko VP, Bhattacharjee A, Pluskota E, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21252155", "url": "https://glygen.org/publication/PubMed/21252155" } ] }, { "title": "Optineurin is required for CYLD-dependent inhibition of TNF\u03b1-induced NF-\u03baB activation.", "journal": "PloS one", "date": "2011-03-07", "authors": "Nagabhushana Ananthamurthy, Bansal Megha, Swarup Ghanshyam", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "21408173", "url": "https://glygen.org/publication/PubMed/21408173" } ] }, { "title": "TRIM8 regulates Nanog via Hsp90beta-mediated nuclear translocation of STAT3 in embryonic stem cells.", "journal": "Biochimica et biophysica acta", "date": "2011", "authors": "Okumura F, Okumura AJ, Matsumoto M, Nakayama KI, Hatakeyama S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21689689", "url": "https://glygen.org/publication/PubMed/21689689" } ] }, { "title": "STAT3 protein promotes T-cell survival and inhibits interleukin-2 production through up-regulation of Class O Forkhead transcription factors.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Oh HM, Yu CR, Golestaneh N, Amadi-Obi A, Lee YS, Eseonu A, Mahdi RM, Egwuagu CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21730069", "url": "https://glygen.org/publication/PubMed/21730069" } ] }, { "title": "Signal transducers and activators of transcription 3 (STAT3) directly regulates cytokine-induced fascin expression and is required for breast cancer cell migration.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Snyder M, Huang XY, Zhang JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21937440", "url": "https://glygen.org/publication/PubMed/21937440" } ] }, { "title": "Cytokine induction of tumor necrosis factor receptor 2 is mediated by STAT3 in colon cancer cells.", "journal": "Molecular cancer research : MCR", "date": "2011", "authors": "Hamilton KE, Simmons JG, Ding S, Van Landeghem L, Lund PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21994466", "url": "https://glygen.org/publication/PubMed/21994466" } ] }, { "title": "Necdin, a negative growth regulator, is a novel STAT3 target gene down-regulated in human cancer.", "journal": "PloS one", "date": "2011", "authors": "Haviland R, Eschrich S, Bloom G, Ma Y, Minton S, Jove R, Cress WD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22046235", "url": "https://glygen.org/publication/PubMed/22046235" } ] }, { "title": "De-ubiquitinating protease USP2a targets RIP1 and TRAF2 to mediate cell death by TNF.", "journal": "Cell death and differentiation", "date": "2012", "authors": "Mahul-Mellier AL, Pazarentzos E, Datler C, Iwasawa R, AbuAli G, Lin B, Grimm S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "22179575", "url": "https://glygen.org/publication/PubMed/22179575" } ] }, { "title": "Roles of STAT3 and ZEB1 proteins in E-cadherin down-regulation and human colorectal cancer epithelial-mesenchymal transition.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Xiong H, Hong J, Du W, Lin YW, Ren LL, Wang YC, Su WY, Wang JL, Cui Y, Wang ZH, Fang JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22205702", "url": "https://glygen.org/publication/PubMed/22205702" } ] }, { "title": "CLIPR-59 regulates TNF-alpha-induced apoptosis by controlling ubiquitination of RIP1.", "journal": "Cell death & disease", "date": "2012", "authors": "Fujikura D, Ito M, Chiba S, Harada T, Perez F, Reed JC, Uede T, Miyazaki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "22297296", "url": "https://glygen.org/publication/PubMed/22297296" } ] }, { "title": "The Jak/STAT pathway.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2012", "authors": "Harrison DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22383755", "url": "https://glygen.org/publication/PubMed/22383755" } ] }, { "title": "Regulation of NF-kappaB by deubiquitinases.", "journal": "Immunological reviews", "date": "2012", "authors": "Harhaj EW, Dixit VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "22435550", "url": "https://glygen.org/publication/PubMed/22435550" } ] }, { "title": "Unlike for human monocytes after LPS activation, release of TNF-alpha by THP-1 cells is produced by a TACE catalytically different from constitutive TACE.", "journal": "PloS one", "date": "2012", "authors": "Moreira-Tabaka H, Peluso J, Vonesch JL, Hentsch D, Kessler P, Reimund JM, Dumont S, Muller CD", "evidence": [ { "database": "Reactome", "id": "R-HSA-75893", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75893" } ], "reference": [ { "type": "PubMed", "id": "22479555", "url": "https://glygen.org/publication/PubMed/22479555" } ] }, { "title": "Smac mimetic enables the anticancer action of BCG-stimulated neutrophils through TNF-\u03b1 but not through TRAIL and FasL.", "journal": "Journal of leukocyte biology", "date": "2012-07", "authors": "Jinesh G Goodwin, Chunduru Srinivas, Kamat Ashish M", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "reference": [ { "type": "PubMed", "id": "22517918", "url": "https://glygen.org/publication/PubMed/22517918" } ] }, { "title": "STAT1 gene expression is enhanced by nuclear EGFR and HER2 via cooperation with STAT3.", "journal": "Molecular carcinogenesis", "date": "2013", "authors": "Han W, Carpenter RL, Cao X, Lo HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22693070", "url": "https://glygen.org/publication/PubMed/22693070" } ] }, { "title": "NEMO inhibits programmed necrosis in an NFkappaB-independent manner by restraining RIP1.", "journal": "PloS one", "date": "2012", "authors": "O'Donnell MA, Hase H, Legarda D, Ting AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "22848449", "url": "https://glygen.org/publication/PubMed/22848449" } ] }, { "title": "Interleukin-10-induced neutrophil gelatinase-associated lipocalin production in macrophages with consequences for tumor growth.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Jung M, Weigert A, Tausendschon M, Mora J, Oren B, Sola A, Hotter G, Muta T, Brune B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22851691", "url": "https://glygen.org/publication/PubMed/22851691" } ] }, { "title": "STAT1 activation by venous malformations mutant Tie2-R849W antagonizes VEGF-A-mediated angiogenic response partly via reduced bFGF production.", "journal": "Angiogenesis", "date": "2013", "authors": "Huang YH, Wu MP, Pan SC, Su WC, Chen YW, Wu LW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23086340", "url": "https://glygen.org/publication/PubMed/23086340" } ] }, { "title": "IL-4 and IL-13 employ discrete signaling pathways for target gene expression in alternatively activated monocytes/macrophages.", "journal": "Free radical biology & medicine", "date": "2013", "authors": "Bhattacharjee A, Shukla M, Yakubenko VP, Mulya A, Kundu S, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23124025", "url": "https://glygen.org/publication/PubMed/23124025" } ] }, { "title": "STAT3 is involved in esophageal carcinogenesis through regulation of Oct-1.", "journal": "Carcinogenesis", "date": "2013", "authors": "Wang Z, Zhu S, Shen M, Liu J, Wang M, Li C, Wang Y, Deng A, Mei Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23172665", "url": "https://glygen.org/publication/PubMed/23172665" } ] }, { "title": "A Novel pro-adipogenesis factor abundant in adipose tissues and over-expressed in obesity acts upstream of PPARgamma and C/EBPalpha.", "journal": "Journal of bioenergetics and biomembranes", "date": "2013", "authors": "Ni Y, Ji C, Wang B, Qiu J, Wang J, Guo X", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "23239344", "url": "https://glygen.org/publication/PubMed/23239344" } ] }, { "title": "Ubiquitin-specific protease 4 promotes TNF-alpha-induced apoptosis by deubiquitination of RIP1 in head and neck squamous cell carcinoma.", "journal": "FEBS letters", "date": "2013", "authors": "Hou X, Wang L, Zhang L, Pan X, Zhao W", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "23313255", "url": "https://glygen.org/publication/PubMed/23313255" } ] }, { "title": "Phosphorylation of FOXP3 controls regulatory T cell function and is inhibited by TNF-alpha in rheumatoid arthritis.", "journal": "Nature medicine", "date": "2013", "authors": "Nie H, Zheng Y, Li R, Guo TB, He D, Fang L, Liu X, Xiao L, Chen X, Wan B, Chin YE, Zhang JZ", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "reference": [ { "type": "PubMed", "id": "23396208", "url": "https://glygen.org/publication/PubMed/23396208" } ] }, { "title": "Mutant B-RAF-Mcl-1 survival signaling depends on the STAT3 transcription factor.", "journal": "Oncogene", "date": "2014", "authors": "Becker TM, Boyd SC, Mijatov B, Gowrishankar K, Snoyman S, Pupo GM, Scolyer RA, Mann GJ, Kefford RF, Zhang XD, Rizos H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23455323", "url": "https://glygen.org/publication/PubMed/23455323" } ] }, { "title": "SIRT6 regulates TNF-alpha secretion through hydrolysis of long-chain fatty acyl lysine.", "journal": "Nature", "date": "2013", "authors": "Jiang H, Khan S, Wang Y, Charron G, He B, Sebastian C, Du J, Kim R, Ge E, Mostoslavsky R, Hang HC, Hao Q, Lin H", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "reference": [ { "type": "PubMed", "id": "23552949", "url": "https://glygen.org/publication/PubMed/23552949" } ] }, { "title": "Tissue inhibitor of metalloproteinase 1 is preferentially expressed in Th1 and Th17 T-helper cell subsets and is a direct STAT target gene.", "journal": "PloS one", "date": "2013", "authors": "Adamson A, Ghoreschi K, Rittler M, Chen Q, Sun HW, Vahedi G, Kanno Y, Stetler-Stevenson WG, O'Shea JJ, Laurence A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23555662", "url": "https://glygen.org/publication/PubMed/23555662" } ] }, { "title": "OTULIN antagonizes LUBAC signaling by specifically hydrolyzing Met1-linked polyubiquitin.", "journal": "Cell", "date": "2013", "authors": "Keusekotten K, Elliott PR, Glockner L, Fiil BK, Damgaard RB, Kulathu Y, Wauer T, Hospenthal MK, Gyrd-Hansen M, Krappmann D, Hofmann K, Komander D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "23746843", "url": "https://glygen.org/publication/PubMed/23746843" } ] }, { "title": "STAT3 regulates MMP3 in heme-induced endothelial cell apoptosis.", "journal": "PloS one", "date": "2013", "authors": "Liu M, Wilson NO, Hibbert JM, Stiles JK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23967200", "url": "https://glygen.org/publication/PubMed/23967200" } ] }, { "title": "The signal transducers Stat1 and Stat3 and their novel target Jmjd3 drive the expression of inflammatory genes in microglia.", "journal": "Journal of molecular medicine (Berlin, Germany)", "date": "2014", "authors": "Przanowski P, Dabrowski M, Ellert-Miklaszewska A, Kloss M, Mieczkowski J, Kaza B, Ronowicz A, Hu F, Piotrowski A, Kettenmann H, Komorowski J, Kaminska B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "24097101", "url": "https://glygen.org/publication/PubMed/24097101" } ] }, { "title": "CYLD deubiquitinates RIP1 in the TNFalpha-induced necrosome to facilitate kinase activation and programmed necrosis.", "journal": "PloS one", "date": "2013", "authors": "Moquin DM, McQuade T, Chan FK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "24098568", "url": "https://glygen.org/publication/PubMed/24098568" } ] }, { "title": "A20 in inflammation and autoimmunity.", "journal": "Trends in immunology", "date": "2014", "authors": "Catrysse L, Vereecke L, Beyaert R, van Loo G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "24246475", "url": "https://glygen.org/publication/PubMed/24246475" } ] }, { "title": "RACK1 modulates NF-kappaB activation by interfering with the interaction between TRAF2 and the IKK complex.", "journal": "Cell research", "date": "2014", "authors": "Yao F, Long LY, Deng YZ, Feng YY, Ying GY, Bao WD, Li G, Guan DX, Zhu YQ, Li JJ, Xie D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "24323043", "url": "https://glygen.org/publication/PubMed/24323043" } ] }, { "title": "Plasma tumor necrosis factor-alpha and C-reactive protein as biomarker for survival in head and neck squamous cell carcinoma.", "journal": "Journal of cancer research and clinical oncology", "date": "2014", "authors": "Andersson BA, Lewin F, Lundgren J, Nilsson M, Rutqvist LE, Lofgren S, Laytragoon-Lewin N", "evidence": [ { "database": "GlyGen", "id": "A0028", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "24481866", "url": "https://glygen.org/publication/PubMed/24481866" } ] }, { "title": "Molecular basis and regulation of OTULIN-LUBAC interaction.", "journal": "Molecular cell", "date": "2014", "authors": "Elliott PR, Nielsen SV, Marco-Casanova P, Fiil BK, Keusekotten K, Mailand N, Freund SM, Gyrd-Hansen M, Komander D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "24726323", "url": "https://glygen.org/publication/PubMed/24726323" } ] }, { "title": "Binding of OTULIN to the PUB domain of HOIP controls NF-kappaB signaling.", "journal": "Molecular cell", "date": "2014", "authors": "Schaeffer V, Akutsu M, Olma MH, Gomes LC, Kawasaki M, Dikic I", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "24726327", "url": "https://glygen.org/publication/PubMed/24726327" } ] }, { "title": "STAT3 Target Genes Relevant to Human Cancers.", "journal": "Cancers", "date": "2014", "authors": "Carpenter RL, Lo HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "24743777", "url": "https://glygen.org/publication/PubMed/24743777" } ] }, { "title": "TRAF-mediated modulation of NF-kB AND JNK activation by TNFR2.", "journal": "Cellular signalling", "date": "2014", "authors": "Cabal-Hierro L, Rodriguez M, Artime N, Iglesias J, Ugarte L, Prado MA, Lazo PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "25152365", "url": "https://glygen.org/publication/PubMed/25152365" } ] }, { "title": "Liver is the major source of elevated serum lipocalin-2 levels after bacterial infection or partial hepatectomy: a critical role for IL-6/STAT3.", "journal": "Hepatology (Baltimore, Md.)", "date": "2015", "authors": "Xu MJ, Feng D, Wu H, Wang H, Chan Y, Kolls J, Borregaard N, Porse B, Berger T, Mak TW, Cowland JB, Kong X, Gao B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "25234944", "url": "https://glygen.org/publication/PubMed/25234944" } ] }, { "title": "The structure of tumor necrosis factor-alpha at 2.6-A resolution. Implications for receptor binding.", "journal": "J. Biol. Chem.", "date": "1989", "authors": "Eck M J, Sprang S R", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "reference": [ { "type": "PubMed", "id": "2551905", "url": "https://glygen.org/publication/PubMed/2551905" } ] }, { "title": "The cylindromatosis gene product, CYLD, interacts with MIB2 to regulate notch signalling.", "journal": "Oncotarget", "date": "2014", "authors": "Rajan N, Elliott RJ, Smith A, Sinclair N, Swift S, Lord CJ, Ashworth A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "25565632", "url": "https://glygen.org/publication/PubMed/25565632" } ] }, { "title": "NF-kappaB-Independent Role of IKKalpha/IKKbeta in Preventing RIPK1 Kinase-Dependent Apoptotic and Necroptotic Cell Death during TNF Signaling.", "journal": "Molecular cell", "date": "2015", "authors": "Dondelinger Y, Jouan-Lanhouet S, Divert T, Theatre E, Bertin J, Gough PJ, Giansanti P, Heck AJ, Dejardin E, Vandenabeele P, Bertrand MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "26344099", "url": "https://glygen.org/publication/PubMed/26344099" } ] }, { "title": "CHIP controls necroptosis through ubiquitylation- and lysosome-dependent degradation of RIPK3.", "journal": "Nature cell biology", "date": "2016", "authors": "Seo J, Lee EW, Sung H, Seong D, Dondelinger Y, Shin J, Jeong M, Lee HK, Kim JH, Han SY, Lee C, Seong JK, Vandenabeele P, Song J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "26900751", "url": "https://glygen.org/publication/PubMed/26900751" } ] }, { "title": "CYLD Limits Lys63- and Met1-Linked Ubiquitin at Receptor Complexes to Regulate Innate Immune Signaling.", "journal": "Cell reports", "date": "2016", "authors": "Hrdinka M, Fiil BK, Zucca M, Leske D, Bagola K, Yabal M, Elliott PR, Damgaard RB, Komander D, Jost PJ, Gyrd-Hansen M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "26997266", "url": "https://glygen.org/publication/PubMed/26997266" } ] }, { "title": "SPATA2 links CYLD to the TNF-alpha receptor signaling complex and modulates the receptor signaling outcomes.", "journal": "The EMBO journal", "date": "2016", "authors": "Wagner SA, Satpathy S, Beli P, Choudhary C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "27307491", "url": "https://glygen.org/publication/PubMed/27307491" } ] }, { "title": "SPATA2 promotes CYLD activity and regulates TNF-induced NF-kappaB signaling and cell death.", "journal": "EMBO reports", "date": "2016", "authors": "Schlicher L, Wissler M, Preiss F, Brauns-Schubert P, Jakob C, Dumit V, Borner C, Dengjel J, Maurer U", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "27458237", "url": "https://glygen.org/publication/PubMed/27458237" } ] }, { "title": "SPATA2-Mediated Binding of CYLD to HOIP Enables CYLD Recruitment to Signaling Complexes.", "journal": "Cell reports", "date": "2016", "authors": "Kupka S, De Miguel D, Draber P, Martino L, Surinova S, Rittinger K, Walczak H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "27545878", "url": "https://glygen.org/publication/PubMed/27545878" } ] }, { "title": "Linear ubiquitination is involved in the pathogenesis of optineurin-associated amyotrophic lateral sclerosis.", "journal": "Nature communications", "date": "2016-08-24", "authors": "Nakazawa Seshiru, Oikawa Daisuke, Ishii Ryohei, Ayaki Takashi, Takahashi Hirotaka, Takeda Hiroyuki, Ishitani Ryuichiro, Kamei Kiyoko, Takeyoshi Izumi, Kawakami Hideshi, Iwai Kazuhiro, Hatada Izuho, Sawasaki Tatsuya, Ito Hidefumi, Nureki Osamu, Tokunaga Fuminori", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "27552911", "url": "https://glygen.org/publication/PubMed/27552911" } ] }, { "title": "SPATA2 Links CYLD to LUBAC, Activates CYLD, and Controls LUBAC Signaling.", "journal": "Molecular cell", "date": "2016", "authors": "Elliott PR, Leske D, Hrdinka M, Bagola K, Fiil BK, McLaughlin SH, Wagstaff J, Volkmar N, Christianson JC, Kessler BM, Freund SM, Komander D, Gyrd-Hansen M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "27591049", "url": "https://glygen.org/publication/PubMed/27591049" } ] }, { "title": "Human tumor necrosis factor-alpha receptor. Purification by immunoaffinity chromatography and initial characterization.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Stauber GB, Aiyer RA, Aggarwal BB", "evidence": [ { "database": "Reactome", "id": "R-HSA-75893", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75893" } ], "reference": [ { "type": "PubMed", "id": "2848815", "url": "https://glygen.org/publication/PubMed/2848815" } ] }, { "title": "MK2 Phosphorylates RIPK1 to Prevent TNF-Induced Cell Death.", "journal": "Molecular cell", "date": "2017", "authors": "Jaco I, Annibaldi A, Lalaoui N, Wilson R, Tenev T, Laurien L, Kim C, Jamal K, Wicky John S, Liccardi G, Chau D, Murphy JM, Brumatti G, Feltham R, Pasparakis M, Silke J, Meier P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "28506461", "url": "https://glygen.org/publication/PubMed/28506461" } ] }, { "title": "MK2 phosphorylation of RIPK1 regulates TNF-mediated cell death.", "journal": "Nature cell biology", "date": "2017", "authors": "Dondelinger Y, Delanghe T, Rojas-Rivera D, Priem D, Delvaeye T, Bruggeman I, Van Herreweghe F, Vandenabeele P, Bertrand MJM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "28920952", "url": "https://glygen.org/publication/PubMed/28920952" } ] }, { "title": "p38(MAPK)/MK2-dependent phosphorylation controls cytotoxic RIPK1 signalling in inflammation and infection.", "journal": "Nature cell biology", "date": "2017", "authors": "Menon MB, Gropengiesser J, Fischer J, Novikova L, Deuretzbacher A, Lafera J, Schimmeck H, Czymmeck N, Ronkina N, Kotlyarov A, Aepfelbacher M, Gaestel M, Ruckdeschel K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "28920954", "url": "https://glygen.org/publication/PubMed/28920954" } ] }, { "title": "Structure of tumour necrosis factor.", "journal": "Nature", "date": "1989", "authors": "Jones E Y, Stuart D I, Walker N P", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "reference": [ { "type": "PubMed", "id": "2922050", "url": "https://glygen.org/publication/PubMed/2922050" } ] }, { "title": "Mind Bomb Regulates Cell Death during TNF Signaling by Suppressing RIPK1's Cytotoxic Potential.", "journal": "Cell reports", "date": "2018", "authors": "Feltham R, Jamal K, Tenev T, Liccardi G, Jaco I, Domingues CM, Morris O, John SW, Annibaldi A, Widya M, Kearney CJ, Clancy D, Elliott PR, Glatter T, Qiao Q, Thompson AJ, Nesvizhskii A, Schmidt A, Komander D, Wu H, Martin S, Meier P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "29642005", "url": "https://glygen.org/publication/PubMed/29642005" } ] }, { "title": "Human lymphotoxin and tumor necrosis factor genes: structure, homology and chromosomal localization.", "journal": "Nucleic Acids Res.", "date": "1985", "authors": "Nedwin GE, Naylor SL, Sakaguchi AY, Smith D, Jarrett-Nedwin J, Pennica D, Goeddel DV, Gray PW", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "reference": [ { "type": "PubMed", "id": "2995927", "url": "https://glygen.org/publication/PubMed/2995927" } ] }, { "title": "TBK1 Suppresses RIPK1-Driven Apoptosis and Inflammation during Development and in Aging.", "journal": "Cell", "date": "2018", "authors": "Xu D, Jin T, Zhu H, Chen H, Ofengeim D, Zou C, Mifflin L, Pan L, Amin P, Li W, Shan B, Naito MG, Meng H, Li Y, Pan H, Aron L, Adiconis X, Levin JZ, Yankner BA, Yuan J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "30146158", "url": "https://glygen.org/publication/PubMed/30146158" } ] }, { "title": "Linear ubiquitination of cFLIP induced by LUBAC contributes to TNFalpha-induced apoptosis.", "journal": "The Journal of biological chemistry", "date": "2018", "authors": "Tang Y, Joo D, Liu G, Tu H, You J, Jin J, Zhao X, Hung MC, Lin X", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "30361438", "url": "https://glygen.org/publication/PubMed/30361438" } ] }, { "title": "TBK1 and IKKepsilon prevent TNF-induced cell death by RIPK1 phosphorylation.", "journal": "Nature cell biology", "date": "2018", "authors": "Lafont E, Draber P, Rieser E, Reichert M, Kupka S, de Miguel D, Draberova H, von Massenhausen A, Bhamra A, Henderson S, Wojdyla K, Chalk A, Surinova S, Linkermann A, Walczak H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "30420664", "url": "https://glygen.org/publication/PubMed/30420664" } ] }, { "title": "Serine 25 phosphorylation inhibits RIPK1 kinase-dependent cell death in models of infection and inflammation.", "journal": "Nature communications", "date": "2019", "authors": "Dondelinger Y, Delanghe T, Priem D, Wynosky-Dolfi MA, Sorobetea D, Rojas-Rivera D, Giansanti P, Roelandt R, Gropengiesser J, Ruckdeschel K, Savvides SN, Heck AJR, Vandenabeele P, Brodsky IE, Bertrand MJM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "30988283", "url": "https://glygen.org/publication/PubMed/30988283" } ] }, { "title": "The E3 ubiquitin ligase MIB2 enhances inflammation by degrading the deubiquitinating enzyme CYLD.", "journal": "The Journal of biological chemistry", "date": "2019", "authors": "Uematsu A, Kido K, Takahashi H, Takahashi C, Yanagihara Y, Saeki N, Yoshida S, Maekawa M, Honda M, Kai T, Shimizu K, Higashiyama S, Imai Y, Tokunaga F, Sawasaki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "31366726", "url": "https://glygen.org/publication/PubMed/31366726" } ] }, { "title": "Cleavage of RIPK1 by caspase-8 is crucial for limiting apoptosis and necroptosis.", "journal": "Nature", "date": "2019", "authors": "Newton K, Wickliffe KE, Dugger DL, Maltzman A, Roose-Girma M, Dohse M, Komuves L, Webster JD, Dixit VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "31511692", "url": "https://glygen.org/publication/PubMed/31511692" } ] }, { "title": "Clinical features of patients infected with 2019 novel coronavirus in Wuhan, China.", "journal": "Lancet (London, England)", "date": "2020", "authors": "Huang C, Wang Y, Li X, Ren L, Zhao J, Hu Y, Zhang L, Fan G, Xu J, Gu X, Cheng Z, Yu T, Xia J, Wei Y, Wu W, Xie X, Yin W, Li H, Liu M, Xiao Y, Gao H, Guo L, Xie J, Wang G, Jiang R, Gao Z, Jin Q, Wang J, Cao B", "evidence": [ { "database": "GlyGen", "id": "A0028", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "31986264", "url": "https://glygen.org/publication/PubMed/31986264" } ] }, { "title": "The use of anti-inflammatory drugs in the treatment of people with severe coronavirus disease 2019 (COVID-19): The Perspectives of clinical immunologists from China.", "journal": "Clinical immunology (Orlando, Fla.)", "date": "2020", "authors": "Zhang W, Zhao Y, Zhang F, Wang Q, Li T, Liu Z, Wang J, Qin Y, Zhang X, Yan X, Zeng X, Zhang S", "evidence": [ { "database": "GlyGen", "id": "A0028", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "32222466", "url": "https://glygen.org/publication/PubMed/32222466" } ] }, { "title": "The Autophagy-Initiating Kinase ULK1 Controls RIPK1-Mediated Cell Death.", "journal": "Cell reports", "date": "2020", "authors": "Wu W, Wang X, Berleth N, Deitersen J, Wallot-Hieke N, Bohler P, Schlutermann D, Stuhldreier F, Cox J, Schmitz K, Seggewiss S, Peter C, Kasof G, Stefanski A, Stuhler K, Tschapek A, Godecke A, Stork B", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "32320653", "url": "https://glygen.org/publication/PubMed/32320653" } ] }, { "title": "Anti-TNF-alpha Agents in Inflammatory Bowel Disease and Course of COVID-19.", "journal": "Inflammatory bowel diseases", "date": "2020", "authors": "Tursi A, Vetrone LM, Papa A", "evidence": [ { "database": "GlyGen", "id": "A0028", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "32382744", "url": "https://glygen.org/publication/PubMed/32382744" } ] }, { "title": "Clinical characteristics and risk factors associated with COVID-19 disease severity in patients with cancer in Wuhan, China: a multicentre, retrospective, cohort study.", "journal": "The Lancet. Oncology", "date": "2020", "authors": "Tian J, Yuan X, Xiao J, Zhong Q, Yang C, Liu B, Cai Y, Lu Z, Wang J, Wang Y, Liu S, Cheng B, Wang J, Zhang M, Wang L, Niu S, Yao Z, Deng X, Zhou F, Wei W, Li Q, Chen X, Chen W, Yang Q, Wu S, Fan J, Shu B, Hu Z, Wang S, Yang XP, Liu W, Miao X, Wang Z", "evidence": [ { "database": "GlyGen", "id": "A0028", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "32479790", "url": "https://glygen.org/publication/PubMed/32479790" } ] }, { "title": "An inflammatory cytokine signature helps predict COVID-19 severity and death.", "journal": "medRxiv : the preprint server for health sciences", "date": "2020", "authors": "Del Valle DM, Kim-Schulze S, Hsin-Hui H, Beckmann ND, Nirenberg S, Wang B, Lavin Y, Swartz T, Madduri D, Stock A, Marron T, Xie H, Patel MK, van Oekelen O, Rahman A, Kovatch P, Aberg J, Schadt E, Jagannath S, Mazumdar M, Charney A, Firpo-Betancourt A, Mendu DR, Jhang J, Reich D, Sigel K, Cordon-Cardo C, Feldmann M, Parekh S, Merad M, Gnjatic S", "evidence": [ { "database": "GlyGen", "id": "A0028", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "32511562", "url": "https://glygen.org/publication/PubMed/32511562" } ] }, { "title": "MIND bomb 2 prevents RIPK1 kinase activity-dependent and -independent apoptosis through ubiquitylation of cFLIPL.", "journal": "Communications biology", "date": "2021", "authors": "Nakabayashi O, Takahashi H, Moriwaki K, Komazawa-Sakon S, Ohtake F, Murai S, Tsuchiya Y, Koyahara Y, Saeki Y, Yoshida Y, Yamazaki S, Tokunaga F, Sawasaki T, Nakano H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "33469115", "url": "https://glygen.org/publication/PubMed/33469115" } ] }, { "title": "Linear Ubiquitination of RIPK1 on Lys612 Regulates Systemic Inflammation via Preventing Cell Death.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2021", "authors": "Tu H, Tang Y, Zhang J, Cheng L, Joo D, Zhao X, Lin X", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "34162724", "url": "https://glygen.org/publication/PubMed/34162724" } ] }, { "title": "Human TBK1 deficiency leads to autoinflammation driven by TNF-induced cell death.", "journal": "Cell", "date": "2021", "authors": "Taft J, Markson M, Legarda D, Patel R, Chan M, Malle L, Richardson A, Gruber C, Martin-Fernandez M, Mancini GMS, van Laar JAM, van Pelt P, Buta S, Wokke BHA, Sabli IKD, Sancho-Shimizu V, Chavan PP, Schnappauf O, Khubchandani R, Cuceoglu MK, Ozen S, Kastner DL, Ting AT, Aksentijevich I, Hollink IHIM, Bogunovic D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "34363755", "url": "https://glygen.org/publication/PubMed/34363755" } ] }, { "title": "The deubiquitinase OTUD1 inhibits colonic inflammation by suppressing RIPK1-mediated NF-kappaB signaling.", "journal": "Cellular & molecular immunology", "date": "2022", "authors": "Wu B, Qiang L, Zhang Y, Fu Y, Zhao M, Lei Z, Lu Z, Wei YG, Dai H, Ge Y, Liu M, Zhou X, Peng Z, Li H, Cui CP, Wang J, Zheng H, Liu CH, Zhang L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "34876703", "url": "https://glygen.org/publication/PubMed/34876703" } ] }, { "title": "Tandem arrangement of genes coding for tumor necrosis factor (TNF-alpha) and lymphotoxin (TNF-beta) in the human genome.", "journal": "Cold Spring Harb. Symp. Quant. Biol.", "date": "1986", "authors": "Nedospasov S A, Shakhov A N, Turetskaya R L, Mett V A, Azizov M M, Georgiev G P, Korobko V G, Dobrynin V N, Filippov S A, Bystrov N S", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "reference": [ { "type": "PubMed", "id": "3555974", "url": "https://glygen.org/publication/PubMed/3555974" } ] }, { "title": "OTUD1 deubiquitinase regulates NF-kappaB- and KEAP1-mediated inflammatory responses and reactive oxygen species-associated cell death pathways.", "journal": "Cell death & disease", "date": "2022", "authors": "Oikawa D, Gi M, Kosako H, Shimizu K, Takahashi H, Shiota M, Hosomi S, Komakura K, Wanibuchi H, Tsuruta D, Sawasaki T, Tokunaga F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "35941131", "url": "https://glygen.org/publication/PubMed/35941131" } ] }, { "title": "Knockouts of TNFRSF1A and TNFRSF1B Genes in K562 Cell Line Lead to Diverse Long-Lasting Responses to TNF-\u03b1.", "journal": "International journal of molecular sciences", "date": "2023-12-06", "authors": "Perik-Zavodskaia Olga, Alrhmoun Saleh, Perik-Zavodskii Roman, Zhukova Julia, Lopatnikova Julia, Volynets Marina, Alshevskaya Alina, Sennikov Sergey", "evidence": [ { "database": "RefSeq", "id": "NP_000585", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000585" } ], "reference": [ { "type": "PubMed", "id": "38138998", "url": "https://glygen.org/publication/PubMed/38138998" } ] }, { "title": "Influence of polymorphisms in TNF-\u03b1 and IL1\u03b2 on susceptibility to alcohol induced liver diseases and therapeutic potential of miR-124-3p impeding TNF-\u03b1/IL1\u03b2 mediated multi-cellular signaling in liver microenvironment.", "journal": "Frontiers in immunology", "date": "2023", "authors": "Dasgupta Debanjali, Ghosh Suchandrima, Dey Indrashish, Majumdar Swagata, Chowdhury Saheli, Das Subhas, Banerjee Sanjana, Saha Mehelana, Ghosh Amit, Roy Neelanjana, Manna Alak, Ray Sukanta, Agarwal Shaleen, Bhaumik Pradeep, Datta Simanti, Chowdhury Abhijit, Banerjee Soma", "evidence": [ { "database": "RefSeq", "id": "NP_000585", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000585" } ], "reference": [ { "type": "PubMed", "id": "38146363", "url": "https://glygen.org/publication/PubMed/38146363" } ] }, { "title": "Tumor necrosis factor mediates the impact of PM2.5 on bone mineral density: Inflammatory proteome Mendelian randomization and colocalization analyses.", "journal": "Ecotoxicology and environmental safety", "date": "2024-01-15", "authors": "Li Mingzheng, Shi Peng, Yang Huajie, Tong Suyuan, Qiu Nianfeng, Yao Fan, Du Yuan, Xi Shuhua, Wang Fei", "evidence": [ { "database": "RefSeq", "id": "NP_000585", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000585" } ], "reference": [ { "type": "PubMed", "id": "38184974", "url": "https://glygen.org/publication/PubMed/38184974" } ] }, { "title": "Does TNF-\u03b1 308\u00a0G/A (rs1800629) gene polymorphism associate with liver and pancreas disorders in Iraqi adults with beta thalassemia major?", "journal": "Human antibodies", "date": "2023", "authors": "Luaibi Hawraa Allawi, Mohammed Bushra Jasim", "evidence": [ { "database": "RefSeq", "id": "NP_000585", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000585" } ], "reference": [ { "type": "PubMed", "id": "38217591", "url": "https://glygen.org/publication/PubMed/38217591" } ] }, { "title": "Evaluating the Concentration of MMP-9 and TNF- \u03b1 in Pulpal Blood at Various Stages of Pulpal Inflammation in Diabetics: A Cross Sectional Study.", "journal": "European endodontic journal", "date": "2023-08", "authors": "Agrawal Sanchi, Taneja Sonali, Shetty Devicharan, Gopikrishna Velayutham, Bhalla Vidhi Kiran", "evidence": [ { "database": "RefSeq", "id": "NP_000585", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000585" } ], "reference": [ { "type": "PubMed", "id": "38219033", "url": "https://glygen.org/publication/PubMed/38219033" } ] }, { "title": "Molecular cloning of the complementary DNA for human tumor necrosis factor.", "journal": "Science", "date": "1985", "authors": "Wang A M, Creasey A A, Ladner M B, Lin L S, Strickler J, Van Arsdell J N, Yamamoto R, Mark D F", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "reference": [ { "type": "PubMed", "id": "3856324", "url": "https://glygen.org/publication/PubMed/3856324" } ] }, { "title": "Cloning and expression in Escherichia coli of the gene for human tumour necrosis factor.", "journal": "Nature", "date": "1985", "authors": "Shirai T, Yamaguchi H, Ito H, Todd C W, Wallace R B", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "reference": [ { "type": "PubMed", "id": "3883195", "url": "https://glygen.org/publication/PubMed/3883195" } ] }, { "title": "Molecular cloning and expression of human tumor necrosis factor and comparison with mouse tumor necrosis factor.", "journal": "Eur. J. Biochem.", "date": "1985", "authors": "Marmenout A, Fransen L, Tavernier J, Van der Heyden J, Tizard R, Kawashima E, Shaw A, Johnson M J, Semon D, M\u00fcller R", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "reference": [ { "type": "PubMed", "id": "3932069", "url": "https://glygen.org/publication/PubMed/3932069" } ] }, { "title": "Human tumour necrosis factor: precursor structure, expression and homology to lymphotoxin.", "journal": "Nature", "date": "1984", "authors": "Pennica D, Nedwin G E, Hayflick J S, Seeburg P H, Derynck R, Palladino M A, Kohr W J, Aggarwal B B, Goeddel D V", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "reference": [ { "type": "PubMed", "id": "6392892", "url": "https://glygen.org/publication/PubMed/6392892" } ] }, { "title": "Interferon activation of the transcription factor Stat91 involves dimerization through SH2-phosphotyrosyl peptide interactions.", "journal": "Cell", "date": "1994", "authors": "Shuai K, Horvath CM, Huang LH, Qureshi SA, Cowburn D, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7510216", "url": "https://glygen.org/publication/PubMed/7510216" } ] }, { "title": "Interleukin-10 inhibits B7 and intercellular adhesion molecule-1 expression on human monocytes.", "journal": "European journal of immunology", "date": "1994", "authors": "Willems F, Marchant A, Delville JP, Gerard C, Delvaux A, Velu T, de Boer M, Goldman M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7512027", "url": "https://glygen.org/publication/PubMed/7512027" } ] }, { "title": "Molecular cloning of APRF, a novel IFN-stimulated gene factor 3 p91-related transcription factor involved in the gp130-mediated signaling pathway.", "journal": "Cell", "date": "1994", "authors": "Akira S, Nishio Y, Inoue M, Wang XJ, Wei S, Matsusaka T, Yoshida K, Sudo T, Naruto M, Kishimoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7512451", "url": "https://glygen.org/publication/PubMed/7512451" } ] }, { "title": "Interleukin 12 synergizes with B7/CD28 interaction in inducing efficient proliferation and cytokine production of human T cells.", "journal": "The Journal of experimental medicine", "date": "1994", "authors": "Kubin M, Kamoun M, Trinchieri G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7516408", "url": "https://glygen.org/publication/PubMed/7516408" } ] }, { "title": "IL-13 selectively induces vascular cell adhesion molecule-1 expression in human endothelial cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1995", "authors": "Bochner BS, Klunk DA, Sterbinsky SA, Coffman RL, Schleimer RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7529288", "url": "https://glygen.org/publication/PubMed/7529288" } ] }, { "title": "Fas- and tumor necrosis factor-induced apoptosis is inhibited by the poxvirus crmA gene product.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Tewari M, Dixit VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "7531702", "url": "https://glygen.org/publication/PubMed/7531702" } ] }, { "title": "IL-10 induces the tyrosine phosphorylation of tyk2 and Jak1 and the differential assembly of STAT1 alpha and STAT3 complexes in human T cells and monocytes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1995", "authors": "Finbloom DS, Winestock KD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7543512", "url": "https://glygen.org/publication/PubMed/7543512" } ] }, { "title": "TRAF2-mediated activation of NF-kappa B by TNF receptor 2 and CD40.", "journal": "Science (New York, N.Y.)", "date": "1995", "authors": "Rothe M, Sarma V, Dixit VM, Goeddel DV", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "7544915", "url": "https://glygen.org/publication/PubMed/7544915" } ] }, { "title": "IL-10 inhibits metalloproteinase and stimulates TIMP-1 production in human mononuclear phagocytes.", "journal": "The Journal of clinical investigation", "date": "1995", "authors": "Lacraz S, Nicod LP, Chicheportiche R, Welgus HG, Dayer JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7593617", "url": "https://glygen.org/publication/PubMed/7593617" } ] }, { "title": "Inhibition of macrophage inflammatory protein-1 alpha expression by IL-10. Differential sensitivities in human blood monocytes and alveolar macrophages.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1995", "authors": "Berkman N, John M, Roesems G, Jose PJ, Barnes PJ, Chung KF", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7594602", "url": "https://glygen.org/publication/PubMed/7594602" } ] }, { "title": "Association of a RING finger protein with the cytoplasmic domain of the human type-2 tumour necrosis factor receptor.", "journal": "The Biochemical journal", "date": "1995", "authors": "Song HY, Donner DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "7639698", "url": "https://glygen.org/publication/PubMed/7639698" } ] }, { "title": "Tumor necrosis factor-induced apoptosis is mediated by a CrmA-sensitive cell death pathway.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Miura M, Friedlander RM, Yuan J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "7667287", "url": "https://glygen.org/publication/PubMed/7667287" } ] }, { "title": "Direct effects of IL-10 on subsets of human CD4+ T cell clones and resting T cells. Specific inhibition of IL-2 production and proliferation.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1993", "authors": "de Waal Malefyt R, Yssel H, de Vries JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7684412", "url": "https://glygen.org/publication/PubMed/7684412" } ] }, { "title": "IL-10 inhibits macrophage costimulatory activity by selectively inhibiting the up-regulation of B7 expression.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1993", "authors": "Ding L, Linsley PS, Huang LY, Germain RN, Shevach EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7687627", "url": "https://glygen.org/publication/PubMed/7687627" } ] }, { "title": "The TNF receptor 1-associated protein TRADD signals cell death and NF-kappa B activation.", "journal": "Cell", "date": "1995", "authors": "Hsu H, Xiong J, Goeddel DV", "evidence": [ { "database": "Reactome", "id": "R-HSA-75893", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75893" } ], "reference": [ { "type": "PubMed", "id": "7758105", "url": "https://glygen.org/publication/PubMed/7758105" } ] }, { "title": "Direct evidence of a heterotrimeric complex of human interleukin-4 with its receptors.", "journal": "Protein science : a publication of the Protein Society", "date": "1995", "authors": "Hoffman RC, Castner BJ, Gerhart M, Gibson MG, Rasmussen BD, March CJ, Weatherbee J, Tsang M, Gustchina A, Schalk-Hihi C, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7795521", "url": "https://glygen.org/publication/PubMed/7795521" } ] }, { "title": "Components of a Stat recognition code: evidence for two layers of molecular selectivity.", "journal": "Immunity", "date": "1995", "authors": "Schindler U, Wu P, Rothe M, Brasseur M, McKnight SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7796300", "url": "https://glygen.org/publication/PubMed/7796300" } ] }, { "title": "Transcriptional regulation of the junB promoter: analysis of STAT-mediated signal transduction.", "journal": "Oncogene", "date": "1995", "authors": "Coffer P, Lutticken C, van Puijenbroek A, Klop-de Jonge M, Horn F, Kruijer W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7898939", "url": "https://glygen.org/publication/PubMed/7898939" } ] }, { "title": "Effects of IL-13 on phenotype, cytokine production, and cytotoxic function of human monocytes. Comparison with IL-4 and modulation by IFN-gamma or IL-10.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1993", "authors": "de Waal Malefyt R, Figdor CG, Huijbens R, Mohan-Peterson S, Bennett B, Culpepper J, Dang W, Zurawski G, de Vries JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7902377", "url": "https://glygen.org/publication/PubMed/7902377" } ] }, { "title": "Interleukin 13, an interleukin 4-like cytokine that acts on monocytes and B cells, but not on T cells.", "journal": "Immunology today", "date": "1994", "authors": "Zurawski G, de Vries JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7907877", "url": "https://glygen.org/publication/PubMed/7907877" } ] }, { "title": "Interleukin 10 suppression of monocyte prostaglandin H synthase-2. Mechanism of inhibition of prostaglandin-dependent matrix metalloproteinase production.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Mertz PM, DeWitt DL, Stetler-Stevenson WG, Wahl LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8063757", "url": "https://glygen.org/publication/PubMed/8063757" } ] }, { "title": "An interleukin-4-induced transcription factor: IL-4 Stat.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Hou J, Schindler U, Henzel WJ, Ho TC, Brasseur M, McKnight SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8085155", "url": "https://glygen.org/publication/PubMed/8085155" } ] }, { "title": "Interleukin 10 (IL-10) inhibits human lymphocyte interferon gamma-production by suppressing natural killer cell stimulatory factor/IL-12 synthesis in accessory cells.", "journal": "The Journal of experimental medicine", "date": "1993", "authors": "D'Andrea A, Aste-Amezaga M, Valiante NM, Ma X, Kubin M, Trinchieri G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8102388", "url": "https://glygen.org/publication/PubMed/8102388" } ] }, { "title": "Expression cloning and characterization of a human IL-10 receptor.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1994", "authors": "Liu Y, Wei SH, Ho AS, de Waal Malefyt R, Moore KW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8120391", "url": "https://glygen.org/publication/PubMed/8120391" } ] }, { "title": "Interleukin 10 (IL-10) upregulates IL-1 receptor antagonist production from lipopolysaccharide-stimulated human polymorphonuclear leukocytes by delaying mRNA degradation.", "journal": "The Journal of experimental medicine", "date": "1994", "authors": "Cassatella MA, Meda L, Gasperini S, Calzetti F, Bonora S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8163946", "url": "https://glygen.org/publication/PubMed/8163946" } ] }, { "title": "The effects of interleukin-10 on interleukin-1 receptor antagonist and interleukin-1 beta production in human monocytes and neutrophils.", "journal": "Lymphokine and cytokine research", "date": "1994", "authors": "Jenkins JK, Malyak M, Arend WP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8186324", "url": "https://glygen.org/publication/PubMed/8186324" } ] }, { "title": "Macrophage-colony-stimulating factor expression by anti-CD45 stimulated human monocytes is transcriptionally up-regulated by IL-1 beta and inhibited by IL-4 and IL-10.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1994", "authors": "Gruber MF, Williams CC, Gerrard TL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8301137", "url": "https://glygen.org/publication/PubMed/8301137" } ] }, { "title": "Insulin-responsive human adipocytes express two glucose transporter isoforms and target them to different vesicles.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1993", "authors": "Pilch PF, Wilkinson W, Garvey WT, Ciaraldi TP, Hueckstaedt TP, Olefsky JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "8325954", "url": "https://glygen.org/publication/PubMed/8325954" } ] }, { "title": "Dense Alu clustering and a potential new member of the NF kappa B family within a 90 kilobase HLA class III segment.", "journal": "Nat. Genet.", "date": "1993", "authors": "Iris FJ, Bougueleret L, Prieur S, Caterina D, Primas G, Perrot V, Jurka J, Rodriguez-Tome P, Claverie JM, Dausset J, et al.", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "reference": [ { "type": "PubMed", "id": "8499947", "url": "https://glygen.org/publication/PubMed/8499947" } ] }, { "title": "The transmembrane form of tumor necrosis factor is the prime activating ligand of the 80 kDa tumor necrosis factor receptor.", "journal": "Cell", "date": "1995", "authors": "Grell M, Douni E, Wajant H, Lohden M, Clauss M, Maxeiner B, Georgopoulos S, Lesslauer W, Kollias G, Pfizenmaier K, Scheurich P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "8521496", "url": "https://glygen.org/publication/PubMed/8521496" } ] }, { "title": "Elevated plasma levels of tumor necrosis factor (TNF)-alpha, soluble TNF receptors, interleukin (IL)-6, and IL-10 in patients with hemorrhagic fever with renal syndrome.", "journal": "The Journal of infectious diseases", "date": "1996", "authors": "Linderholm M, Ahlm C, Settergren B, Waage A, Tarnvik A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8537680", "url": "https://glygen.org/publication/PubMed/8537680" } ] }, { "title": "Phosphorylation of the 26 kDa TNF precursor in monocytic cells and in transfected HeLa cells.", "journal": "Journal of inflammation", "date": "1995", "authors": "Pocsik E, Duda E, Wallach D", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" }, { "database": "iPTMnet", "id": "P01375", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01375" } ], "reference": [ { "type": "PubMed", "id": "8597870", "url": "https://glygen.org/publication/PubMed/8597870" } ] }, { "title": "Essential role of Stat6 in IL-4 signalling.", "journal": "Nature", "date": "1996", "authors": "Takeda K, Tanaka T, Shi W, Matsumoto M, Minami M, Kashiwamura S, Nakanishi K, Yoshida N, Kishimoto T, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8602263", "url": "https://glygen.org/publication/PubMed/8602263" } ] }, { "title": "STAT3 participates in transcriptional activation of the C-reactive protein gene by interleukin-6.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Zhang D, Sun M, Samols D, Kushner I", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8621622", "url": "https://glygen.org/publication/PubMed/8621622" } ] }, { "title": "O-glycosylated species of natural human tumor-necrosis factor-alpha.", "journal": "European journal of biochemistry", "date": "1996", "authors": "Takakura-Yamamoto R, Yamamoto S, Fukuda S, Kurimoto M", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375#ptm_processing" }, { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" }, { "database": "UniCarbKB", "id": "P01375", "url": "" }, { "database": "GlyConnect", "id": "609", "url": "https://glyconnect.expasy.org/browser/proteins/609" } ], "reference": [ { "type": "PubMed", "id": "8631363", "url": "https://glygen.org/publication/PubMed/8631363" } ] }, { "title": "The adipocyte specific transcription factor C/EBPalpha modulates human ob gene expression.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Miller SG, De Vos P, Guerre-Millo M, Wong K, Hermann T, Staels B, Briggs MR, Auwerx J", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "8643605", "url": "https://glygen.org/publication/PubMed/8643605" } ] }, { "title": "Receptors for interleukin (IL)-10 and IL-6-type cytokines use similar signaling mechanisms for inducing transcription through IL-6 response elements.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Lai CF, Ripperger J, Morella KK, Jurlander J, Hawley TS, Carson WE, Kordula T, Caligiuri MA, Hawley RG, Fey GH, Baumann H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8662928", "url": "https://glygen.org/publication/PubMed/8662928" } ] }, { "title": "A novel cytoplasmic domain of the p55 tumor necrosis factor receptor initiates the neutral sphingomyelinase pathway.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Adam D, Wiegmann K, Adam-Klages S, Ruff A, Kronke M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5626978", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5626978" } ], "reference": [ { "type": "PubMed", "id": "8663014", "url": "https://glygen.org/publication/PubMed/8663014" } ] }, { "title": "Cloning and characterization of a specific interleukin (IL)-13 binding protein structurally related to the IL-5 receptor alpha chain.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Caput D, Laurent P, Kaghad M, Lelias JM, Lefort S, Vita N, Ferrara P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8663118", "url": "https://glygen.org/publication/PubMed/8663118" } ] }, { "title": "The lipopolysaccharide-binding protein is a secretory class 1 acute-phase protein whose gene is transcriptionally activated by APRF/STAT/3 and other cytokine-inducible nuclear proteins.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Schumann RR, Kirschning CJ, Unbehaun A, Aberle HP, Knope HP, Lamping N, Ulevitch RJ, Herrmann F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8668165", "url": "https://glygen.org/publication/PubMed/8668165" } ] }, { "title": "Human pro-tumor necrosis factor is a homotrimer.", "journal": "Biochemistry", "date": "1996", "authors": "Tang P, Hung M-C, Klostergaard J", "evidence": [ { "database": "Reactome", "id": "R-HSA-75893", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75893" } ], "reference": [ { "type": "PubMed", "id": "8679576", "url": "https://glygen.org/publication/PubMed/8679576" } ] }, { "title": "Anatomy of TRAF2. Distinct domains for nuclear factor-kappaB activation and association with tumor necrosis factor signaling proteins.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Takeuchi M, Rothe M, Goeddel DV", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "8702708", "url": "https://glygen.org/publication/PubMed/8702708" } ] }, { "title": "A human peroxisome-proliferator-activated receptor-gamma is activated by inducers of adipogenesis, including thiazolidinedione drugs.", "journal": "European journal of biochemistry", "date": "1996", "authors": "Lambe KG, Tugwood JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "8706692", "url": "https://glygen.org/publication/PubMed/8706692" } ] }, { "title": "Interleukin-10 drives human monocytes to CD16 positive macrophages.", "journal": "Journal of inflammation", "date": "1996", "authors": "Calzada-Wack JC, Frankenberger M, Ziegler-Heitbrock HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8734788", "url": "https://glygen.org/publication/PubMed/8734788" } ] }, { "title": "IL-4, IL-10 and IFN-gamma have distinct, but interacting, effects on differentiation-induced changes in TNF-alpha and TNF receptor release by cultured human monocytes.", "journal": "Cytokine", "date": "1996", "authors": "Joyce DA, Steer JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8742066", "url": "https://glygen.org/publication/PubMed/8742066" } ] }, { "title": "Thiazolidinediones repress ob gene expression in rodents via activation of peroxisome proliferator-activated receptor gamma.", "journal": "The Journal of clinical investigation", "date": "1996", "authors": "De Vos P, Lefebvre AM, Miller SG, Guerre-Millo M, Wong K, Saladin R, Hamann LG, Staels B, Briggs MR, Auwerx J", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "8770873", "url": "https://glygen.org/publication/PubMed/8770873" } ] }, { "title": "Global and local determinants for the kinetics of interleukin-4/interleukin-4 receptor alpha chain interaction. A biosensor study employing recombinant interleukin-4-binding protein.", "journal": "European journal of biochemistry", "date": "1996", "authors": "Shen BJ, Hage T, Sebald W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8797861", "url": "https://glygen.org/publication/PubMed/8797861" } ] }, { "title": "FAN, a novel WD-repeat protein, couples the p55 TNF-receptor to neutral sphingomyelinase.", "journal": "Cell", "date": "1996", "authors": "Adam-Klages S, Adam D, Wiegmann K, Struve S, Kolanus W, Schneider-Mergener J, Kronke M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5626978", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5626978" } ], "reference": [ { "type": "PubMed", "id": "8808629", "url": "https://glygen.org/publication/PubMed/8808629" } ] }, { "title": "Requirements for interleukin-4-induced gene expression and functional characterization of Stat6.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Mikita T, Campbell D, Wu P, Williamson K, Schindler U", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8816495", "url": "https://glygen.org/publication/PubMed/8816495" } ] }, { "title": "Regulation of surface and soluble TNF receptor expression on human monocytes and synovial fluid macrophages by IL-4 and IL-10.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1996", "authors": "Hart PH, Hunt EK, Bonder CS, Watson CJ, Finlay-Jones JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8871669", "url": "https://glygen.org/publication/PubMed/8871669" } ] }, { "title": "Crystal structure of human interleukin-10 at 1.6 A resolution and a model of a complex with its soluble receptor.", "journal": "Protein science : a publication of the Protein Society", "date": "1996", "authors": "Zdanov A, Schalk-Hihi C, Wlodawer A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8897595", "url": "https://glygen.org/publication/PubMed/8897595" } ] }, { "title": "Stat3 recruitment by two distinct ligand-induced, tyrosine-phosphorylated docking sites in the interleukin-10 receptor intracellular domain.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Weber-Nordt RM, Riley JK, Greenlund AC, Moore KW, Darnell JE, Schreiber RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8910398", "url": "https://glygen.org/publication/PubMed/8910398" } ] }, { "title": "Contrasting effects of IL-4, IL-10 and corticosteroids on RANTES production by human monocytes.", "journal": "International immunology", "date": "1996", "authors": "Marfaing-Koka A, Maravic M, Humbert M, Galanaud P, Emilie D", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8921438", "url": "https://glygen.org/publication/PubMed/8921438" } ] }, { "title": "IL-10 suppresses cell surface CD23/Fc epsilon RII expression, not by enhancing soluble CD23 release, but by reducing CD23 mRNA expression in human monocytes.", "journal": "Journal of clinical immunology", "date": "1996", "authors": "Morinobu A, Kumagai S, Yanagida H, Ota H, Ishida H, Matsui M, Yodoi J, Nakao K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8946277", "url": "https://glygen.org/publication/PubMed/8946277" } ] }, { "title": "Peroxisome proliferator-activated receptors: a nuclear receptor signaling pathway in lipid physiology.", "journal": "Annual review of cell and developmental biology", "date": "1996", "authors": "Lemberger T, Desvergne B, Wahli W", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "8970730", "url": "https://glygen.org/publication/PubMed/8970730" } ] }, { "title": "Cloning of the human IL-13R alpha1 chain and reconstitution with the IL4R alpha of a functional IL-4/IL-13 receptor complex.", "journal": "FEBS letters", "date": "1997", "authors": "Miloux B, Laurent P, Bonnin O, Lupker J, Caput D, Vita N, Ferrara P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9013879", "url": "https://glygen.org/publication/PubMed/9013879" } ] }, { "title": "Identification through bioinformatics of two new macrophage proinflammatory human chemokines: MIP-3alpha and MIP-3beta.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1997", "authors": "Rossi DL, Vicari AP, Franz-Bacon K, McClanahan TK, Zlotnik A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "9013939", "url": "https://glygen.org/publication/PubMed/9013939" } ] }, { "title": "Cloning of a disintegrin metalloproteinase that processes precursor tumour-necrosis factor-alpha.", "journal": "Nature", "date": "1997", "authors": "Moss ML, Jin SL, Milla ME, Bickett DM, Burkhart W, Carter HL, Chen WJ, Clay WC, Didsbury JR, Hassler D, Hoffman CR, Kost TA, Lambert MH, Leesnitzer MA, McCauley P, McGeehan G, Mitchell J, Moyer M, Pahel G, Rocque W, Overton LK, Schoenen F, Seaton T, Su JL, Becherer JD, et al.", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "reference": [ { "type": "PubMed", "id": "9034191", "url": "https://glygen.org/publication/PubMed/9034191" } ] }, { "title": "Vaccinia virus serpin B13R (SPI-2) inhibits interleukin-1beta-converting enzyme and protects virus-infected cells from TNF- and Fas-mediated apoptosis, but does not prevent IL-1beta-induced fever.", "journal": "The Journal of general virology", "date": "1997", "authors": "Kettle S, Alcami A, Khanna A, Ehret R, Jassoy C, Smith GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "9049422", "url": "https://glygen.org/publication/PubMed/9049422" } ] }, { "title": "Target protease specificity of the viral serpin CrmA. Analysis of five caspases.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Zhou Q, Snipas S, Orth K, Muzio M, Dixit VM, Salvesen GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905" } ], "reference": [ { "type": "PubMed", "id": "9065443", "url": "https://glygen.org/publication/PubMed/9065443" } ] }, { "title": "Identification, characterization, and tissue distribution of human peroxisome proliferator-activated receptor (PPAR) isoforms PPARgamma2 versus PPARgamma1 and activation with retinoid X receptor agonists and antagonists.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Mukherjee R, Jow L, Croston GE, Paterniti JR Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "9065481", "url": "https://glygen.org/publication/PubMed/9065481" } ] }, { "title": "Crucial role of tumor necrosis factor (TNF) receptor 2 and membrane-bound TNF in experimental cerebral malaria.", "journal": "European journal of immunology", "date": "1997", "authors": "Lucas R, Juillard P, Decoster E, Redard M, Burger D, Donati Y, Giroud C, Monso-Hinard C, De Kesel T, Buurman WA, Moore MW, Dayer JM, Fiers W, Bluethmann H, Grau GE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "9247583", "url": "https://glygen.org/publication/PubMed/9247583" } ] }, { "title": "Identification and functional characterization of a second chain of the interleukin-10 receptor complex.", "journal": "The EMBO journal", "date": "1997", "authors": "Kotenko SV, Krause CD, Izotova LS, Pollack BP, Wu W, Pestka S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "9312047", "url": "https://glygen.org/publication/PubMed/9312047" } ] }, { "title": "Interleukin-10 upregulates tumor necrosis factor receptor type-II (p75) gene expression in endotoxin-stimulated human monocytes.", "journal": "Blood", "date": "1997", "authors": "Dickensheets HL, Freeman SL, Smith MF, Donnelly RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "9354687", "url": "https://glygen.org/publication/PubMed/9354687" } ] }, { "title": "High resolution crystal structure of a human tumor necrosis factor-alpha mutant with low systemic toxicity.", "journal": "J. Biol. Chem.", "date": "1998", "authors": "Cha S S, Kim J S, Cho H S, Shin N K, Jeong W, Shin H C, Kim Y J, Hahn J H, Oh B H", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "reference": [ { "type": "PubMed", "id": "9442056", "url": "https://glygen.org/publication/PubMed/9442056" } ] }, { "title": "Interleukin 10 increases CCR5 expression and HIV infection in human monocytes.", "journal": "The Journal of experimental medicine", "date": "1998", "authors": "Sozzani S, Ghezzi S, Iannolo G, Luini W, Borsatti A, Polentarutti N, Sica A, Locati M, Mackay C, Wells TN, Biswas P, Vicenzi E, Poli G, Mantovani A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "9449724", "url": "https://glygen.org/publication/PubMed/9449724" } ] }, { "title": "Identification of high-affinity binding sites for the insulin sensitizer rosiglitazone (BRL-49653) in rodent and human adipocytes using a radioiodinated ligand for peroxisomal proliferator-activated receptor gamma.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "1998", "authors": "Young PW, Buckle DR, Cantello BC, Chapman H, Clapham JC, Coyle PJ, Haigh D, Hindley RM, Holder JC, Kallender H, Latter AJ, Lawrie KW, Mossakowska D, Murphy GJ, Roxbee Cox L, Smith SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "9454824", "url": "https://glygen.org/publication/PubMed/9454824" } ] }, { "title": "Crystal structure of TNF-alpha mutant R31D with greater affinity for receptor R1 compared with R2.", "journal": "Protein Eng.", "date": "1997", "authors": "Reed C, Fu Z Q, Wu J, Xue Y N, Harrison R W, Chen M J, Weber I T", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "reference": [ { "type": "PubMed", "id": "9488135", "url": "https://glygen.org/publication/PubMed/9488135" } ] }, { "title": "IFN-gamma and IL-10 inhibit induction of IL-1 receptor type I and type II gene expression by IL-4 and IL-13 in human monocytes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1997", "authors": "Dickensheets HL, Donnelly RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "9550426", "url": "https://glygen.org/publication/PubMed/9550426" } ] }, { "title": "Mutational analysis of the STAT6 SH2 domain.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Mikita T, Daniel C, Wu P, Schindler U", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9651359", "url": "https://glygen.org/publication/PubMed/9651359" } ] }, { "title": "The role of IL-13 and its receptor in allergy and inflammatory responses.", "journal": "The Journal of allergy and clinical immunology", "date": "1998", "authors": "de Vries JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9723655", "url": "https://glygen.org/publication/PubMed/9723655" } ] }, { "title": "Interferon-gamma-induced factor binding to the interleukin-4-responsive element of CD23b promoter in human tonsillar mononuclear cells: role in transient up-regulation of the interleukin-4-induced CD23b mRNA.", "journal": "Molecular immunology", "date": "1998", "authors": "Park HJ, So EY, Lee CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9736340", "url": "https://glygen.org/publication/PubMed/9736340" } ] }, { "title": "STCP-1 (MDC) CC chemokine acts specifically on chronically activated Th2 lymphocytes and is produced by monocytes on stimulation with Th2 cytokines IL-4 and IL-13.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1998", "authors": "Andrew DP, Chang MS, McNinch J, Wathen ST, Rihanek M, Tseng J, Spellberg JP, Elias CG 3rd", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "9794440", "url": "https://glygen.org/publication/PubMed/9794440" } ] }, { "title": "Induction of 15-lipoxygenase expression by IL-13 requires tyrosine phosphorylation of Jak2 and Tyk2 in human monocytes.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Roy B, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9822675", "url": "https://glygen.org/publication/PubMed/9822675" } ] }, { "title": "Structural and biological stability of the human interleukin 10 homodimer.", "journal": "Biochemistry", "date": "1998", "authors": "Syto R, Murgolo NJ, Braswell EH, Mui P, Huang E, Windsor WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "9836587", "url": "https://glygen.org/publication/PubMed/9836587" } ] }, { "title": "N-(2-Benzoylphenyl)-L-tyrosine PPARgamma agonists. 1. Discovery of a novel series of potent antihyperglycemic and antihyperlipidemic agents.", "journal": "Journal of medicinal chemistry", "date": "1998", "authors": "Henke BR, Blanchard SG, Brackeen MF, Brown KK, Cobb JE, Collins JL, Harrington WW Jr, Hashim MA, Hull-Ryde EA, Kaldor I, Kliewer SA, Lake DH, Leesnitzer LM, Lehmann JM, Lenhard JM, Orband-Miller LA, Miller JF, Mook RA Jr, Noble SA, Oliver W Jr, Parks DJ, Plunket KD, Szewczyk JR, Willson TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "9836620", "url": "https://glygen.org/publication/PubMed/9836620" } ] }, { "title": "STAT3 is required for the gp130-mediated full activation of the c-myc gene.", "journal": "The Journal of experimental medicine", "date": "1999", "authors": "Kiuchi N, Nakajima K, Ichiba M, Fukada T, Narimatsu M, Mizuno K, Hibi M, Hirano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9874564", "url": "https://glygen.org/publication/PubMed/9874564" } ] }, { "title": "Interleukin 10 (IL-10) inhibition of primary human prostate cell-induced angiogenesis: IL-10 stimulation of tissue inhibitor of metalloproteinase-1 and inhibition of matrix metalloproteinase (MMP)-2/MMP-9 secretion.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "1999", "authors": "Stearns ME, Rhim J, Wang M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "9918218", "url": "https://glygen.org/publication/PubMed/9918218" } ] } ], "pathway": [ { "id": "hsa:7124", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7124", "resource": "KEGG Pathway" }, { "id": "R-HSA-381340", "name": "Transcriptional regulation of white adipocyte differentiation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340", "resource": "Reactome", "description": "Transcriptional regulation of white adipocyte differentiation" }, { "id": "R-HSA-5357786", "name": "TNFR1-induced proapoptotic signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357786", "resource": "Reactome", "description": "TNFR1-induced proapoptotic signaling" }, { "id": "R-HSA-5357905", "name": "Regulation of TNFR1 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357905", "resource": "Reactome", "description": "Regulation of TNFR1 signaling" }, { "id": "R-HSA-5357956", "name": "TNFR1-induced NF-kappa-B signaling pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5357956", "resource": "Reactome", "description": "TNFR1-induced NF-kappa-B signaling pathway" }, { "id": "R-HSA-5626978", "name": "TNFR1-mediated ceramide production", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5626978", "resource": "Reactome", "description": "TNFR1-mediated ceramide production" }, { "id": "R-HSA-5668541", "name": "TNFR2 non-canonical NF-kB pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541", "resource": "Reactome", "description": "TNFR2 non-canonical NF-kB pathway" }, { "id": "R-HSA-6783783", "name": "Interleukin-10 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783", "resource": "Reactome", "description": "Interleukin-10 signaling" }, { "id": "R-HSA-6785807", "name": "Interleukin-4 and Interleukin-13 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807", "resource": "Reactome", "description": "Interleukin-4 and Interleukin-13 signaling" }, { "id": "R-HSA-75893", "name": "TNF signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75893", "resource": "Reactome", "description": "TNF signaling" } ], "orthologs": [ { "uniprot_canonical_ac": "P06804-1", "protein_name": "Tumor necrosis factor", "gene_name": "Tnf", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSTESMIRDVELAEEALPQKMGGFQNSRRCLCLSLFSFLLVAGATTLFCLLNFGVIGPQRDEKFPNGLPLISSMAQTLTLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL", "length": 235 }, "evidence": [ { "id": "45919448", "url": "http://www.informatics.jax.org/homology/45919448", "database": "MGI" }, { "id": "P01375", "url": "https://omabrowser.org/oma/group/P01375/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P16599-1", "protein_name": "Tumor necrosis factor", "gene_name": "Tnf", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSTESMIRDVELAEEALPKKMGGLQNSRRCLCLSLFSFLLVAGATTLFCLLNFGVIGPNKEEKFPNGLPLISSMAQTLTLRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVFQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL", "length": 235 }, "evidence": [ { "id": "45919448", "url": "http://www.informatics.jax.org/homology/45919448", "database": "MGI" }, { "id": "P01375", "url": "https://omabrowser.org/oma/group/P01375/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P23563-1", "protein_name": "Tumor necrosis factor", "gene_name": "TNF", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MSTESMIRDVELAEEALAKKAGGPQGSRRCLCLSLFSFLLVAGATTLFCLLHFEVIGPQKEEFPAGPLSINPLAQGLRSSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL", "length": 232 }, "evidence": [ { "id": "P01375", "url": "https://omabrowser.org/oma/group/P01375/", "database": "OMA" } ], "common_name": "Pig" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 9, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "phagocytic cup", "id": "GO:0001891", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001891", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "neuronal cell body", "id": "GO:0043025", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043025", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "membrane raft", "id": "GO:0045121", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045121", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "recycling endosome", "id": "GO:0055037", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055037", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "external side of plasma membrane", "id": "GO:0009897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 182, "go_terms": [ { "name": "immune response", "id": "GO:0006955", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006955", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "vascular endothelial growth factor production", "id": "GO:0010573", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010573", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "necroptotic signaling pathway", "id": "GO:0097527", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097527", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "regulation of developmental process", "id": "GO:0050793", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050793", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "regulation of secretion", "id": "GO:0051046", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051046", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "regulation of multicellular organismal process", "id": "GO:0051239", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051239", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "regulation of biological quality", "id": "GO:0065008", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0065008", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of hepatocyte proliferation", "id": "GO:2000347", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000347", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "osteoclast differentiation", "id": "GO:0030316", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030316", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of vitamin D biosynthetic process", "id": "GO:0060557", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060557", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of calcidiol 1-monooxygenase activity", "id": "GO:0060559", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060559", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "negative regulation of signaling receptor activity", "id": "GO:2000272", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000272", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of interleukin-18 production", "id": "GO:0032741", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032741", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "regulation of immunoglobulin production", "id": "GO:0002637", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002637", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "negative regulation of lipid storage", "id": "GO:0010888", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010888", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of glial cell proliferation", "id": "GO:0060252", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060252", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of leukocyte adhesion to vascular endothelial cell", "id": "GO:1904996", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904996", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of humoral immune response mediated by circulating immunoglobulin", "id": "GO:0002925", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002925", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "negative regulation of myosin-light-chain-phosphatase activity", "id": "GO:0035509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035509", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of mononuclear cell migration", "id": "GO:0071677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071677", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "regulation of establishment of endothelial barrier", "id": "GO:1903140", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903140", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "negative regulation of bicellular tight junction assembly", "id": "GO:1903347", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903347", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "negative regulation of vascular wound healing", "id": "GO:0061044", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061044", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "negative regulation of L-glutamate import across plasma membrane", "id": "GO:0002037", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002037", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "microglial cell activation", "id": "GO:0001774", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001774", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of protein phosphorylation", "id": "GO:0001934", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001934", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "skeletal muscle contraction", "id": "GO:0003009", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003009", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "inflammatory response", "id": "GO:0006954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of gene expression", "id": "GO:0010628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "negative regulation of gene expression", "id": "GO:0010629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010629", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "calcium-mediated signaling", "id": "GO:0019722", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019722", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "extracellular matrix organization", "id": "GO:0030198", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030198", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of peptidyl-serine phosphorylation", "id": "GO:0033138", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033138", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "response to isolation stress", "id": "GO:0035900", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035900", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of apoptotic process", "id": "GO:0043065", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043065", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of cysteine-type endopeptidase activity involved in apoptotic process", "id": "GO:0043280", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043280", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of MAPK cascade", "id": "GO:0043410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043410", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of nitric oxide biosynthetic process", "id": "GO:0045429", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045429", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "response to ethanol", "id": "GO:0045471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045471", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of cell adhesion", "id": "GO:0045785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045785", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of JNK cascade", "id": "GO:0046330", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046330", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "astrocyte activation", "id": "GO:0048143", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048143", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "defense response to Gram-positive bacterium", "id": "GO:0050830", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050830", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "cognition", "id": "GO:0050890", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050890", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of membrane protein ectodomain proteolysis", "id": "GO:0051044", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051044", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of DNA-binding transcription factor activity", "id": "GO:0051091", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051091", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of NF-kappaB transcription factor activity", "id": "GO:0051092", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051092", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction", "id": "GO:0051897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051897", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of ERK1 and ERK2 cascade", "id": "GO:0070374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070374", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "cellular response to retinoic acid", "id": "GO:0071300", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071300", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "protein localization to plasma membrane", "id": "GO:0072659", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072659", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of non-canonical NF-kappaB signal transduction", "id": "GO:1901224", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901224", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of amyloid-beta formation", "id": "GO:1902004", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902004", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "cellular response to amyloid-beta", "id": "GO:1904646", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904646", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of protein localization to cell surface", "id": "GO:2000010", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000010", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "response to hypoxia", "id": "GO:0001666", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001666", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "JNK cascade", "id": "GO:0007254", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007254", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "response to nutrient levels", "id": "GO:0031667", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031667", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "negative regulation of interleukin-6 production", "id": "GO:0032715", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032715", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of chemokine production", "id": "GO:0032722", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032722", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of interleukin-6 production", "id": "GO:0032755", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032755", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "vasodilation", "id": "GO:0042311", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042311", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "negative regulation of cysteine-type endopeptidase activity involved in apoptotic process", "id": "GO:0043154", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043154", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "negative regulation of viral genome replication", "id": "GO:0045071", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045071", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "negative regulation of DNA-templated transcription", "id": "GO:0045892", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045892", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "negative regulation of lipid catabolic process", "id": "GO:0050995", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050995", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "leukocyte migration involved in inflammatory response", "id": "GO:0002523", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002523", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "response to glucocorticoid", "id": "GO:0051384", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051384", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "cellular response to lipopolysaccharide", "id": "GO:0071222", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071222", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of cytokine production", "id": "GO:0001819", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001819", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "activation of cysteine-type endopeptidase activity involved in apoptotic process", "id": "GO:0006919", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006919", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "response to virus", "id": "GO:0009615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009615", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of protein-containing complex assembly", "id": "GO:0031334", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031334", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of canonical NF-kappaB signal transduction", "id": "GO:0043123", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043123", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of MAP kinase activity", "id": "GO:0043406", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043406", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "embryonic digestive tract development", "id": "GO:0048566", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048566", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of smooth muscle cell proliferation", "id": "GO:0048661", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048661", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "regulation of insulin secretion", "id": "GO:0050796", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050796", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "negative regulation of endothelial cell proliferation", "id": "GO:0001937", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001937", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "glucose metabolic process", "id": "GO:0006006", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006006", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "circadian rhythm", "id": "GO:0007623", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007623", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "intrinsic apoptotic signaling pathway in response to DNA damage", "id": "GO:0008630", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008630", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "negative regulation of heart rate", "id": "GO:0010459", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010459", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "negative regulation of blood vessel endothelial cell migration", "id": "GO:0043537", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043537", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "negative regulation of mitotic cell cycle", "id": "GO:0045930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045930", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of inflammatory response", "id": "GO:0050729", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050729", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "cellular response to toxic substance", "id": "GO:0097237", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097237", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of protein localization to plasma membrane", "id": "GO:1903078", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903078", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of vascular associated smooth muscle cell proliferation", "id": "GO:1904707", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904707", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of extrinsic apoptotic signaling pathway", "id": "GO:2001238", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001238", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "response to activity", "id": "GO:0014823", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014823", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "detection of mechanical stimulus involved in sensory perception of pain", "id": "GO:0050966", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050966", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "cortical actin cytoskeleton organization", "id": "GO:0030866", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030866", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of type II interferon production", "id": "GO:0032729", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032729", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "negative regulation of oxidative phosphorylation", "id": "GO:0090324", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090324", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "extrinsic apoptotic signaling pathway", "id": "GO:0097191", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097191", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "negative regulation of systemic arterial blood pressure", "id": "GO:0003085", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003085", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "response to salt stress", "id": "GO:0009651", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009651", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of neuron apoptotic process", "id": "GO:0043525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043525", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of protein catabolic process", "id": "GO:0045732", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045732", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of interleukin-8 production", "id": "GO:0032757", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032757", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of receptor signaling pathway via JAK-STAT", "id": "GO:0046427", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046427", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "leukocyte tethering or rolling", "id": "GO:0050901", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050901", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "regulation of reactive oxygen species metabolic process", "id": "GO:2000377", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000377", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of calcineurin-NFAT signaling cascade", "id": "GO:0070886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070886", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "negative regulation of fat cell differentiation", "id": "GO:0045599", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045599", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "cellular response to type II interferon", "id": "GO:0071346", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071346", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "humoral immune response", "id": "GO:0006959", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006959", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "canonical NF-kappaB signal transduction", "id": "GO:0007249", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007249", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "response to xenobiotic stimulus", "id": "GO:0009410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009410", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "tumor necrosis factor-mediated signaling pathway", "id": "GO:0033209", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033209", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "phosphatidylinositol 3-kinase/protein kinase B signal transduction", "id": "GO:0043491", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043491", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of action potential", "id": "GO:0045760", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045760", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "response to L-glutamate", "id": "GO:1902065", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902065", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of I-kappaB phosphorylation", "id": "GO:1903721", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903721", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "negative regulation of extrinsic apoptotic signaling pathway in absence of ligand", "id": "GO:2001240", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001240", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of interleukin-1 beta production", "id": "GO:0032731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032731", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "negative regulation of osteoblast differentiation", "id": "GO:0045668", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045668", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "liver regeneration", "id": "GO:0097421", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097421", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of DNA biosynthetic process", "id": "GO:2000573", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000573", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "regulation of canonical NF-kappaB signal transduction", "id": "GO:0043122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043122", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "negative regulation of neurogenesis", "id": "GO:0050768", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050768", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "negative regulation of amyloid-beta clearance", "id": "GO:1900222", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900222", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "negative regulation of myoblast differentiation", "id": "GO:0045662", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045662", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "cellular response to amino acid stimulus", "id": "GO:0071230", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071230", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of podosome assembly", "id": "GO:0071803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071803", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of tyrosine phosphorylation of STAT protein", "id": "GO:0042531", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042531", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of JUN kinase activity", "id": "GO:0043507", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043507", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "extrinsic apoptotic signaling pathway via death domain receptors", "id": "GO:0008625", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008625", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "negative regulation of apoptotic signaling pathway", "id": "GO:2001234", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001234", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "regulation of synaptic transmission, glutamatergic", "id": "GO:0051966", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051966", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of blood microparticle formation", "id": "GO:2000334", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000334", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of protein transport", "id": "GO:0051222", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051222", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of hair follicle development", "id": "GO:0051798", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051798", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "response to fructose", "id": "GO:0009750", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009750", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "response to gold nanoparticle", "id": "GO:1990268", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990268", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "chronic inflammatory response to antigenic stimulus", "id": "GO:0002439", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002439", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "regulation of branching involved in salivary gland morphogenesis", "id": "GO:0060693", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060693", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of mitotic nuclear division", "id": "GO:0045840", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045840", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "regulation of endothelial cell apoptotic process", "id": "GO:2000351", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000351", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "regulation of fat cell differentiation", "id": "GO:0045598", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045598", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "cellular response to nicotine", "id": "GO:0071316", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071316", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of osteoclast differentiation", "id": "GO:0045672", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045672", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of heterotypic cell-cell adhesion", "id": "GO:0034116", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034116", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of programmed cell death", "id": "GO:0043068", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043068", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of protein-containing complex disassembly", "id": "GO:0043243", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043243", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "regulation of synapse organization", "id": "GO:0050807", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050807", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of miRNA transcription", "id": "GO:1902895", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902895", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "negative regulation of myelination", "id": "GO:0031642", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031642", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of translational initiation by iron", "id": "GO:0045994", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045994", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "endothelial cell apoptotic process", "id": "GO:0072577", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072577", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "toll-like receptor 3 signaling pathway", "id": "GO:0034138", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034138", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of cytokine production involved in inflammatory response", "id": "GO:1900017", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900017", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of synaptic transmission", "id": "GO:0050806", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050806", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of fever generation", "id": "GO:0031622", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031622", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "epithelial cell proliferation involved in salivary gland morphogenesis", "id": "GO:0060664", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060664", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of superoxide dismutase activity", "id": "GO:1901671", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901671", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "response to 3,3',5-triiodo-L-thyronine", "id": "GO:1905242", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905242", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "negative regulation of protein-containing complex disassembly", "id": "GO:0043242", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043242", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of chemokine (C-X-C motif) ligand 2 production", "id": "GO:2000343", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000343", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "sequestering of triglyceride", "id": "GO:0030730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030730", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "negative regulation of glucose import", "id": "GO:0046325", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046325", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "macrophage activation involved in immune response", "id": "GO:0002281", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002281", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "negative regulation of miRNA transcription", "id": "GO:1902894", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902894", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of chronic inflammatory response to antigenic stimulus", "id": "GO:0002876", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002876", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "negative regulation of branching involved in lung morphogenesis", "id": "GO:0061048", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061048", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of leukocyte adhesion to arterial endothelial cell", "id": "GO:1904999", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904999", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of neuroinflammatory response", "id": "GO:0150078", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0150078", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of fractalkine production", "id": "GO:0032724", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032724", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "inflammatory response to wounding", "id": "GO:0090594", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090594", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of nitrogen compound metabolic process", "id": "GO:0051173", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051173", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "antiviral innate immune response", "id": "GO:0140374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140374", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "negative regulation of cytokine production involved in immune response", "id": "GO:0002719", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002719", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of neutrophil activation", "id": "GO:1902565", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902565", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "response to Gram-negative bacterium", "id": "GO:0140460", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140460", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "negative regulation of bile acid secretion", "id": "GO:0120190", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0120190", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of interleukin-33 production", "id": "GO:0150129", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0150129", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "positive regulation of synoviocyte proliferation", "id": "GO:1901647", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901647", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "response to macrophage colony-stimulating factor", "id": "GO:0036005", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036005", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "cytokine activity", "id": "GO:0005125", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005125", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "tumor necrosis factor receptor binding", "id": "GO:0005164", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005164", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "protease binding", "id": "GO:0002020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002020", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "transcription cis-regulatory region binding", "id": "GO:0000976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000976", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" }, { "name": "death receptor agonist activity", "id": "GO:0038177", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038177", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "tumor necrosis factor O-glycosylated 1 (human)", "definition": "A tumor necrosis factor (human) that has been O-glycosylated at the residue equivalent to Ser-80 of the amino acid sequence represented by UniProtKB:P01375-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P01375-1, Ser-80, MOD:00002~GNO:G00031MO. [PRO:DNx, PMID:8631363]", "evidence": [ { "id": "PR:000051774", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051774" } ] }, { "name": "tumor necrosis factor O-glycosylated 2 (human)", "definition": "A tumor necrosis factor (human) that has been O-glycosylated at the residue equivalent to Ser-80 of the amino acid sequence represented by UniProtKB:P01375-1, in which the glycan structure is represented by GlyTouCan:G56682BC. Example: UniProtKB:P01375-1, Ser-80, MOD:00002~GNO:G56682BC. [PRO:DNx, PMID:8631363]", "evidence": [ { "id": "PR:000051775", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051775" } ] } ], "site_annotation": [], "ptm_annotation": [ { "annotation": "O-glycosylated; glycans contain galactose, N-acetylgalactosamine and N-acetylneuraminic acid.", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" }, { "database": "PubMed", "id": "8631363", "url": "https://glygen.org/publication/PubMed/8631363" } ] }, { "annotation": "The membrane form, but not the soluble form, is phosphorylated on serine residues. Dephosphorylation of the membrane form occurs by binding to soluble TNFRSF1A/TNFR1.", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" }, { "database": "PubMed", "id": "10205166", "url": "https://glygen.org/publication/PubMed/10205166" }, { "database": "PubMed", "id": "8597870", "url": "https://glygen.org/publication/PubMed/8597870" } ] }, { "annotation": "The soluble form derives from the membrane form by proteolytic processing. The membrane-bound form is further proteolytically processed by SPPL2A or SPPL2B through regulated intramembrane proteolysis producing TNF intracellular domains (ICD1 and ICD2) released in the cytosol and TNF C-domain 1 and C-domain 2 secreted into the extracellular space.", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" }, { "database": "PubMed", "id": "16829952", "url": "https://glygen.org/publication/PubMed/16829952" }, { "database": "PubMed", "id": "9034191", "url": "https://glygen.org/publication/PubMed/9034191" }, { "database": "PubMed", "id": "16829951", "url": "https://glygen.org/publication/PubMed/16829951" } ] }, { "annotation": "The soluble form is demyristoylated at Lys-19 and Lys-20 by SIRT6, promoting its secretion.", "evidence": [ { "database": "UniProtKB", "id": "P01375", "url": "https://www.uniprot.org/uniprot/P01375" }, { "database": "PubMed", "id": "23552949", "url": "https://glygen.org/publication/PubMed/23552949" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [ { "assessed_biomarker_entity": "Tumor necrosis factor alpha (TNF)", "biomarker_id": "A0028", "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "32479790", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32479790" }, { "id": "24481866", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24481866" }, { "id": "32382744", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32382744" }, { "id": "32511562", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32511562" }, { "id": "31986264", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31986264" }, { "id": "32222466", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32222466" } ], "instances": [ { "best_biomarker_type": "prognostic", "status": "increased TNF level", "disease": { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] }, "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "32479790", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32479790" }, { "id": "24481866", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24481866" } ] }, { "best_biomarker_type": "prognostic", "status": "increased TNF level", "disease": { "disease_id": "DOID:0080600", "recommended_name": { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "COVID-19", "description": "A Coronavirus infection that is characterized by fever, cough and shortness of breath and that has_material_basis_in SARS-CoV-2." }, "synonyms": [ { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "2019 Novel Coronavirus (2019-nCoV)", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "2019-nCoV infection", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "Wuhan coronavirus infection", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "Wuhan seafood market pneumonia virus infection", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "COVID19", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "SARS-CoV-2 infection", "description": "" } ] }, "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "32382744", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32382744" }, { "id": "32511562", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32511562" }, { "id": "31986264", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31986264" }, { "id": "32222466", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32222466" } ] }, { "best_biomarker_type": "prognostic", "status": "increased TNF level", "disease": { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] }, "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "32479790", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32479790" }, { "id": "24481866", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24481866" } ] } ] } ], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 80 ], "snv_sites": [ 66, 80 ], "glycation_sites": [], "phosphorylation_sites": [ 2 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 5 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 5 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 295 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }