{ "uniprot_canonical_ac": "P01275-1", "uniprot_ac": "P01275", "uniprot_id": "GLUC_HUMAN", "mass": { "chemical_mass": 20909.0, "monoisotopic_mass": 20909.0 }, "refseq": { "ac": "NP_002045", "name": "pro-glucagon preproprotein", "summary": "The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002045" }, "gene_names": [ { "name": "GCG", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P01275", "id": "P01275" }, { "name": "GCG", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002045", "id": "NP_002045" }, { "name": "GLP-1; GLP1; GLP2; GRPP", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002045", "id": "NP_002045" } ], "protein_names": [ { "name": "Pro-glucagon", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P01275" }, { "name": "Incretin hormone", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01275" }, { "name": "glicentin-related polypeptide; glucagon-like peptide 1; glucagon-like peptide 2; preproglucagon; pro-glucagon", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002045", "id": "NP_002045" }, { "name": "pro-glucagon preproprotein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002045", "id": "NP_002045" } ], "function": [ { "annotation": "Association of GLP-1 secretion with parameters of glycemic control in women after gestational diabetes mellitus. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_002045", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002045" }, { "database": "PubMed", "id": "38199777", "url": "https://glygen.org/publication/PubMed/38199777" } ] }, { "annotation": "Colonic L-cell impairment in aged subjects with type 2 diabetes leads to diminished GLP-1 production.", "evidence": [ { "database": "RefSeq", "id": "NP_002045", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002045" }, { "database": "PubMed", "id": "37980723", "url": "https://glygen.org/publication/PubMed/37980723" } ] }, { "annotation": "Crosstalk between glucagon-like peptide 1 and gut microbiota in metabolic diseases. Review article", "evidence": [ { "database": "RefSeq", "id": "NP_002045", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002045" }, { "database": "PubMed", "id": "38055342", "url": "https://glygen.org/publication/PubMed/38055342" } ] }, { "annotation": "May modulate gastric acid secretion and the gastro-pyloro-duodenal activity. May play an important role in intestinal mucosal growth in the early period of life.", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275#function" }, { "database": "PubMed", "id": "12554744", "url": "https://glygen.org/publication/PubMed/12554744" }, { "database": "PubMed", "id": "10605628", "url": "https://glygen.org/publication/PubMed/10605628" } ] }, { "annotation": "Plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes.", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275#function" }, { "database": "PubMed", "id": "10605628", "url": "https://glygen.org/publication/PubMed/10605628" }, { "database": "PubMed", "id": "12626323", "url": "https://glygen.org/publication/PubMed/12626323" } ] }, { "annotation": "Potent stimulator of glucose-dependent insulin release. Also stimulates insulin release in response to IL6 (PubMed:22037645). Plays important roles on gastric motility and the suppression of plasma glucagon levels. May be involved in the suppression of satiety and stimulation of glucose disposal in peripheral tissues, independent of the actions of insulin. Has growth-promoting activities on intestinal epithelium. May also regulate the hypothalamic pituitary axis (HPA) via effects on LH, TSH, CRH, oxytocin, and vasopressin secretion. Increases islet mass through stimulation of islet neogenesis and pancreatic beta cell proliferation. Inhibits beta cell apoptosis (Probable).", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275#function" }, { "database": "PubMed", "id": "14719035", "url": "https://glygen.org/publication/PubMed/14719035" }, { "database": "PubMed", "id": "12554744", "url": "https://glygen.org/publication/PubMed/12554744" }, { "database": "PubMed", "id": "10605628", "url": "https://glygen.org/publication/PubMed/10605628" }, { "database": "PubMed", "id": "22037645", "url": "https://glygen.org/publication/PubMed/22037645" } ] }, { "annotation": "Regulation of Human Sortilin Alternative Splicing by Glucagon-like Peptide-1 (GLP1) in Adipocytes. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_002045", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002045" }, { "database": "PubMed", "id": "37762628", "url": "https://glygen.org/publication/PubMed/37762628" } ] }, { "annotation": "Significantly reduces food intake. Inhibits gastric emptying in humans. Suppression of gastric emptying may lead to increased gastric distension, which may contribute to satiety by causing a sensation of fullness.", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275#function" }, { "database": "PubMed", "id": "12554744", "url": "https://glygen.org/publication/PubMed/12554744" }, { "database": "PubMed", "id": "10605628", "url": "https://glygen.org/publication/PubMed/10605628" } ] }, { "annotation": "Stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. The gastrointestinal tract, from the stomach to the colon is the principal target for GLP-2 action. Plays a key role in nutrient homeostasis, enhancing nutrient assimilation through enhanced gastrointestinal function, as well as increasing nutrient disposal. Stimulates intestinal glucose transport and decreases mucosal permeability.", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275#function" }, { "database": "PubMed", "id": "14719035", "url": "https://glygen.org/publication/PubMed/14719035" }, { "database": "PubMed", "id": "10322410", "url": "https://glygen.org/publication/PubMed/10322410" }, { "database": "PubMed", "id": "12554744", "url": "https://glygen.org/publication/PubMed/12554744" }, { "database": "PubMed", "id": "10605628", "url": "https://glygen.org/publication/PubMed/10605628" } ] }, { "annotation": "The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_002045", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002045" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "47.77", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000115263", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115263" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "41.27", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000115263", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115263" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "48.79", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000115263", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115263" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000115263", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115263" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "54.84", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000115263", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115263" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "98.4", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000115263", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115263" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "85.83", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000115263", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115263" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "37.82", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000115263", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115263" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "39.16", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000115263", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115263" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000115263", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115263" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "24.08", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000115263", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115263" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "54.7", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000115263", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115263" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "45.25", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000115263", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115263" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P01275", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01275" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P01275", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01275" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P01275", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01275" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P01275", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01275" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P01275", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01275" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P01275", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01275" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P01275", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01275" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P01275", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01275" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P01275", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01275" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P01275", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01275" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "common_name": "Human" } ], "gene": [ { "name": "GCG", "url": "https://www.uniprot.org/uniprot/P01275", "locus": { "chromosome": "2", "start_pos": 162142882, "end_pos": 162152404, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000115263", "url": "https://www.ensembl.org/id/ENSG00000115263" } ] } } ], "crossref": [ { "id": "ENSG00000115263", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115263", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "CHEMBL5736", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL5736", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "GCG", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=GCG", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "2641", "url": "https://www.ncbi.nlm.nih.gov/gene/2641", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "4191", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=4191", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P01275", "url": "https://www.ebi.ac.uk/intact/interactors/id:P01275*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000532", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000532", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015550", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015550", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "138030", "url": "http://www.omim.org/entry/138030", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P01275", "url": "https://www.nextprot.org/entry/NX_P01275", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "ENDKFPD", "url": "https://omabrowser.org/oma/group/ENDKFPD/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5318261at2759", "url": "http://www.orthodb.org/?query=5318261at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11418", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11418", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11418:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11418:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1BH0", "url": "https://www.rcsb.org/structure/1BH0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1D0R", "url": "https://www.rcsb.org/structure/1D0R", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1NAU", "url": "https://www.rcsb.org/structure/1NAU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2G49", "url": "https://www.rcsb.org/structure/2G49", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2L63", "url": "https://www.rcsb.org/structure/2L63", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2L64", "url": "https://www.rcsb.org/structure/2L64", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2M5P", "url": "https://www.rcsb.org/structure/2M5P", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2M5Q", "url": "https://www.rcsb.org/structure/2M5Q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3IOL", "url": "https://www.rcsb.org/structure/3IOL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4APD", "url": "https://www.rcsb.org/structure/4APD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4ZGM", "url": "https://www.rcsb.org/structure/4ZGM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5OTU", "url": "https://www.rcsb.org/structure/5OTU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5OTV", "url": "https://www.rcsb.org/structure/5OTV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5OTW", "url": "https://www.rcsb.org/structure/5OTW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5OTX", "url": "https://www.rcsb.org/structure/5OTX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VAI", "url": "https://www.rcsb.org/structure/5VAI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5YQZ", "url": "https://www.rcsb.org/structure/5YQZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6EDS", "url": "https://www.rcsb.org/structure/6EDS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6LMK", "url": "https://www.rcsb.org/structure/6LMK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6LML", "url": "https://www.rcsb.org/structure/6LML", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6NZN", "url": "https://www.rcsb.org/structure/6NZN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6PHI", "url": "https://www.rcsb.org/structure/6PHI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6PHJ", "url": "https://www.rcsb.org/structure/6PHJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6PHK", "url": "https://www.rcsb.org/structure/6PHK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6PHL", "url": "https://www.rcsb.org/structure/6PHL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6PHO", "url": "https://www.rcsb.org/structure/6PHO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6PHP", "url": "https://www.rcsb.org/structure/6PHP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6VCB", "url": "https://www.rcsb.org/structure/6VCB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6X18", "url": "https://www.rcsb.org/structure/6X18", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7D68", "url": "https://www.rcsb.org/structure/7D68", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7DUQ", "url": "https://www.rcsb.org/structure/7DUQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7KI0", "url": "https://www.rcsb.org/structure/7KI0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7KI1", "url": "https://www.rcsb.org/structure/7KI1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7XM8", "url": "https://www.rcsb.org/structure/7XM8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8JRV", "url": "https://www.rcsb.org/structure/8JRV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00123", "url": "http://pfam.xfam.org/family/PF00123", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P01275", "url": "https://pharos.nih.gov/targets/P01275", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P01275", "url": "http://purl.obolibrary.org/obo/PR_P01275", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-163359", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-163359", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-381771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381771", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_002045", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002045", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01275-1", "url": "https://www.uniprot.org/uniprot/P01275-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK", "length": 180, "header": "sp|P01275-1|GLUC_HUMAN Isoform 1 of Pro-glucagon OS=Homo sapiens OX=9606 GN=GCG PE=1 SV=3 CANONICAL=P01275-1" }, "isoforms": [ { "isoform_ac": "P01275-1", "url": "", "sequence": { "sequence": "MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK", "length": 180, "header": "sp|P01275-1|GLUC_HUMAN Isoform 1 of Pro-glucagon OS=Homo sapiens OX=9606 GN=GCG PE=1 SV=3 CANONICAL=P01275-1" }, "locus": { "chromosome": "2", "start_pos": 162149178, "end_pos": 162143367, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000418842.7", "url": "https://www.ensembl.org/id/ENST00000418842.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000387662.2", "url": "https://www.ensembl.org/id/ENSP00000387662.2" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 105, "end_pos": 105, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "site_lbl": "Ser105" }, { "start_pos": 108, "end_pos": 108, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "site_lbl": "Ser108" }, { "start_pos": 150, "end_pos": 150, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "site_lbl": "Ser150" }, { "start_pos": 152, "end_pos": 152, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "site_lbl": "Ser152" }, { "start_pos": 54, "end_pos": 54, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "site_lbl": "Ser54" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Genomic organization of the human galpha14 and Galphaq genes and mutation analysis in chorea-acanthocytosis (CHAC).", "journal": "Genomics", "date": "1999", "authors": "Rubio JP, Levy ER, Dobson-Stone C, Monaco AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "10191087", "url": "https://glygen.org/publication/PubMed/10191087" } ] }, { "title": "cAMP-dependent mobilization of intracellular Ca2+ stores by activation of ryanodine receptors in pancreatic beta-cells. A Ca2+ signaling system stimulated by the insulinotropic hormone glucagon-like peptide-1-(7-37).", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Holz GG, Leech CA, Heller RS, Castonguay M, Habener JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "10318832", "url": "https://glygen.org/publication/PubMed/10318832" } ] }, { "title": "Glucagon-like Peptide 2.", "journal": "Trends in endocrinology and metabolism: TEM", "date": "1999", "authors": "Drucker DJ", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" }, { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "10322410", "url": "https://glygen.org/publication/PubMed/10322410" } ] }, { "title": "Selective regulation of Galpha(q/11) by an RGS domain in the G protein-coupled receptor kinase, GRK2.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Carman CV, Parent JL, Day PW, Pronin AN, Sternweis PM, Wedegaertner PB, Gilman AG, Benovic JL, Kozasa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "10567430", "url": "https://glygen.org/publication/PubMed/10567430" } ] }, { "title": "Ghrelin is a growth-hormone-releasing acylated peptide from stomach.", "journal": "Nature", "date": "1999", "authors": "Kojima M, Hosoda H, Date Y, Nakazato M, Matsuo H, Kangawa K", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "10604470", "url": "https://glygen.org/publication/PubMed/10604470" } ] }, { "title": "The glucagon-like peptides.", "journal": "Endocrine reviews", "date": "1999-12", "authors": "Kieffer T J, Habener J F", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "reference": [ { "type": "PubMed", "id": "10605628", "url": "https://glygen.org/publication/PubMed/10605628" } ] }, { "title": "Osteoblast-derived cells express functional glucose-dependent insulinotropic peptide receptors.", "journal": "Endocrinology", "date": "2000", "authors": "Bollag RJ, Zhong Q, Phillips P, Min L, Zhong L, Cameron R, Mulloy AL, Rasmussen H, Qin F, Ding KH, Isales CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "10698200", "url": "https://glygen.org/publication/PubMed/10698200" } ] }, { "title": "Selective regulation of Gq signaling by G protein-coupled receptor kinase 2: direct interaction of kinase N terminus with activated galphaq.", "journal": "Molecular pharmacology", "date": "2000", "authors": "Sallese M, Mariggio S, D'Urbano E, Iacovelli L, De Blasi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "10727532", "url": "https://glygen.org/publication/PubMed/10727532" } ] }, { "title": "G protein-coupled receptor kinase-5 regulates thrombin-activated signaling in endothelial cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Tiruppathi C, Yan W, Sandoval R, Naqvi T, Pronin AN, Benovic JL, Malik AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "10861009", "url": "https://glygen.org/publication/PubMed/10861009" } ] }, { "title": "Src tyrosine kinase is a novel direct effector of G proteins.", "journal": "Cell", "date": "2000", "authors": "Ma YC, Huang J, Ali S, Lowry W, Huang XY", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "11007482", "url": "https://glygen.org/publication/PubMed/11007482" } ] }, { "title": "Structure, function, and control of phosphoinositide-specific phospholipase C.", "journal": "Physiological reviews", "date": "2000", "authors": "Rebecchi MJ, Pentyala SN", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "11015615", "url": "https://glygen.org/publication/PubMed/11015615" } ] }, { "title": "Human secretin (SCT): gene structure, chromosome location, and distribution of mRNA.", "journal": "Cytogenetics and cell genetics", "date": "2000", "authors": "Whitmore TE, Holloway JL, Lofton-Day CE, Maurer MF, Chen L, Quinton TJ, Vincent JB, Scherer SW, Lok S", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "11060443", "url": "https://glygen.org/publication/PubMed/11060443" } ] }, { "title": "Expression of cAMP-regulated guanine nucleotide exchange factors in pancreatic beta-cells.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Leech CA, Holz GG, Chepurny O, Habener JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "11071853", "url": "https://glygen.org/publication/PubMed/11071853" } ] }, { "title": "Ghrelin, a novel growth hormone-releasing acylated peptide, is synthesized in a distinct endocrine cell type in the gastrointestinal tracts of rats and humans.", "journal": "Endocrinology", "date": "2000", "authors": "Date Y, Kojima M, Hosoda H, Sawaguchi A, Mondal MS, Suganuma T, Matsukura S, Kangawa K, Nakazato M", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "11089560", "url": "https://glygen.org/publication/PubMed/11089560" } ] }, { "title": "A human cellular model for studying the regulation of glucagon-like peptide-1 secretion.", "journal": "Endocrinology", "date": "2001", "authors": "Reimer RA, Darimont C, Gremlich S, Nicolas-Metral V, Ruegg UT, Mace K", "evidence": [ { "database": "Reactome", "id": "R-HSA-381771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381771" } ], "reference": [ { "type": "PubMed", "id": "11564718", "url": "https://glygen.org/publication/PubMed/11564718" } ] }, { "title": "Stomach is a major source of circulating ghrelin, and feeding state determines plasma ghrelin-like immunoreactivity levels in humans.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2001", "authors": "Ariyasu H, Takaya K, Tagami T, Ogawa Y, Hosoda K, Akamizu T, Suda M, Koh T, Natsui K, Toyooka S, Shirakami G, Usui T, Shimatsu A, Doi K, Hosoda H, Kojima M, Kangawa K, Nakao K", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "11600536", "url": "https://glygen.org/publication/PubMed/11600536" } ] }, { "title": "Competing modes of self-association in the regulatory domains of Bruton's tyrosine kinase: intramolecular contact versus asymmetric homodimerization.", "journal": "Protein science : a publication of the Protein Society", "date": "2002", "authors": "Laederach A, Cradic KW, Brazin KN, Zamoon J, Fulton DB, Huang XY, Andreotti AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "11742120", "url": "https://glygen.org/publication/PubMed/11742120" } ] }, { "title": "A unique fold of phospholipase C-beta mediates dimerization and interaction with G alpha q.", "journal": "Nature structural biology", "date": "2002", "authors": "Singer AU, Waldo GL, Harden TK, Sondek J", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "11753430", "url": "https://glygen.org/publication/PubMed/11753430" } ] }, { "title": "Ghrelin is present in pancreatic alpha-cells of humans and rats and stimulates insulin secretion.", "journal": "Diabetes", "date": "2002", "authors": "Date Y, Nakazato M, Hashiguchi S, Dezaki K, Mondal MS, Hosoda H, Kojima M, Kangawa K, Arima T, Matsuo H, Yada T, Matsukura S", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "11756331", "url": "https://glygen.org/publication/PubMed/11756331" } ] }, { "title": "NMR studies of the aggregation of glucagon-like peptide-1: formation of a symmetric helical dimer.", "journal": "FEBS Lett.", "date": "2002", "authors": "Chang Xiaoqing, Keller Danielle, O'Donoghue Se\u00e1n I, Led Jens J", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "reference": [ { "type": "PubMed", "id": "11943215", "url": "https://glygen.org/publication/PubMed/11943215" } ] }, { "title": "The amino acid sequence of human glucagon.", "journal": "FEBS Lett.", "date": "1972", "authors": "Thomsen J, Kristiansen K, Brunfeldt K, Sundby F", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" }, { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "11946536", "url": "https://glygen.org/publication/PubMed/11946536" } ] }, { "title": "Inhibition of dipeptidyl peptidase IV improves metabolic control over a 4-week study period in type 2 diabetes.", "journal": "Diabetes care", "date": "2002", "authors": "Ahren B, Simonsson E, Larsson H, Landin-Olsson M, Torgeirsson H, Jansson PA, Sandqvist M, Bavenholm P, Efendic S, Eriksson JW, Dickinson S, Holmes D", "evidence": [ { "database": "Reactome", "id": "R-HSA-381771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381771" } ], "reference": [ { "type": "PubMed", "id": "11978683", "url": "https://glygen.org/publication/PubMed/11978683" } ] }, { "title": "In vitro folding, functional characterization, and disulfide pattern of the extracellular domain of human GLP-1 receptor.", "journal": "Biophysical chemistry", "date": "2002", "authors": "Bazarsuren A, Grauschopf U, Wozny M, Reusch D, Hoffmann E, Schaefer W, Panzner S, Rudolph R", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "12034449", "url": "https://glygen.org/publication/PubMed/12034449" } ] }, { "title": "Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Feldman DS, Zamah AM, Pierce KL, Miller WE, Kelly F, Rapacciuolo A, Rockman HA, Koch WJ, Luttrell LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "12036966", "url": "https://glygen.org/publication/PubMed/12036966" } ] }, { "title": "The tissue distribution of the mRNA of ghrelin and subtypes of its receptor, GHS-R, in humans.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2002", "authors": "Gnanapavan S, Kola B, Bustin SA, Morris DG, McGee P, Fairclough P, Bhattacharya S, Carpenter R, Grossman AB, Korbonits M", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "12050285", "url": "https://glygen.org/publication/PubMed/12050285" } ] }, { "title": "Mechanism of Galpha i-mediated inhibition of type V adenylyl cyclase.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Dessauer CW, Chen-Goodspeed M, Chen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "12058044", "url": "https://glygen.org/publication/PubMed/12058044" } ] }, { "title": "Similarities and differences in the coupling of human beta1- and beta2-adrenoceptors to Gs(alpha) splice variants.", "journal": "Biochemical pharmacology", "date": "2002", "authors": "Wenzel-Seifert K, Liu HY, Seifert R", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "12106601", "url": "https://glygen.org/publication/PubMed/12106601" } ] }, { "title": "Regulators of G-protein signalling as new central nervous system drug targets.", "journal": "Nature reviews. Drug discovery", "date": "2002", "authors": "Neubig RR, Siderovski DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "12120503", "url": "https://glygen.org/publication/PubMed/12120503" } ] }, { "title": "The pharmacology of cilostazol.", "journal": "Diabetes, obesity & metabolism", "date": "2002", "authors": "Schror K", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "12180353", "url": "https://glygen.org/publication/PubMed/12180353" } ] }, { "title": "Protein kinase A translocation and insulin secretion in pancreatic beta-cells: studies with adenylate cyclase toxin from Bordetella pertussis.", "journal": "The Biochemical journal", "date": "2002", "authors": "Gao Z, Young RA, Trucco MM, Greene SR, Hewlett EL, Matschinsky FM, Wolf BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "12180908", "url": "https://glygen.org/publication/PubMed/12180908" } ] }, { "title": "Ghrelin immunoreactivity in human plasma is suppressed by somatostatin.", "journal": "Clinical endocrinology", "date": "2002", "authors": "Norrelund H, Hansen TK, Orskov H, Hosoda H, Kojima M, Kangawa K, Weeke J, Moller N, Christiansen JS, Jorgensen JO", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "12354137", "url": "https://glygen.org/publication/PubMed/12354137" } ] }, { "title": "Piccolo, a Ca2+ sensor in pancreatic beta-cells. Involvement of cAMP-GEFII.Rim2. Piccolo complex in cAMP-dependent exocytosis.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Fujimoto K, Shibasaki T, Yokoi N, Kashima Y, Matsumoto M, Sasaki T, Tajima N, Iwanaga T, Seino S", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "12401793", "url": "https://glygen.org/publication/PubMed/12401793" } ] }, { "title": "Glucagon-like peptide-1 mobilizes intracellular Ca2+ and stimulates mitochondrial ATP synthesis in pancreatic MIN6 beta-cells.", "journal": "The Biochemical journal", "date": "2003", "authors": "Tsuboi T, da Silva Xavier G, Holz GG, Jouaville LS, Thomas AP, Rutter GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "12410638", "url": "https://glygen.org/publication/PubMed/12410638" } ] }, { "title": "Structural divergence of human ghrelin. Identification of multiple ghrelin-derived molecules produced by post-translational processing.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Hosoda H, Kojima M, Mizushima T, Shimizu S, Kangawa K", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "12414809", "url": "https://glygen.org/publication/PubMed/12414809" } ] }, { "title": "The multiple actions of GLP-1 on the process of glucose-stimulated insulin secretion.", "journal": "Diabetes", "date": "2002", "authors": "MacDonald PE, El-Kholy W, Riedel MJ, Salapatek AM, Light PE, Wheeler MB", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "12475787", "url": "https://glygen.org/publication/PubMed/12475787" } ] }, { "title": "Epac-selective cAMP analog 8-pCPT-2'-O-Me-cAMP as a stimulus for Ca2+-induced Ca2+ release and exocytosis in pancreatic beta-cells.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Kang G, Joseph JW, Chepurny OG, Monaco M, Wheeler MB, Bos JL, Schwede F, Genieser HG, Holz GG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "12496249", "url": "https://glygen.org/publication/PubMed/12496249" } ] }, { "title": "Role of leptin in the regulation of glucagon-like peptide-1 secretion.", "journal": "Diabetes", "date": "2003", "authors": "Anini Y, Brubaker PL", "evidence": [ { "database": "Reactome", "id": "R-HSA-381771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381771" } ], "reference": [ { "type": "PubMed", "id": "12540594", "url": "https://glygen.org/publication/PubMed/12540594" } ] }, { "title": "Euglycemic hyperinsulinemia, but not lipid infusion, decreases circulating ghrelin levels in humans.", "journal": "Journal of endocrinological investigation", "date": "2002", "authors": "Mohlig M, Spranger J, Otto B, Ristow M, Tschop M, Pfeiffer AF", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "12553549", "url": "https://glygen.org/publication/PubMed/12553549" } ] }, { "title": "Glucagon-like peptides: regulators of cell proliferation, differentiation, and apoptosis.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2003-02", "authors": "Drucker Daniel J", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "reference": [ { "type": "PubMed", "id": "12554744", "url": "https://glygen.org/publication/PubMed/12554744" } ] }, { "title": "Glucagon and regulation of glucose metabolism.", "journal": "American journal of physiology. Endocrinology and metabolism", "date": "2003", "authors": "Jiang G, Zhang BB", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "reference": [ { "type": "PubMed", "id": "12626323", "url": "https://glygen.org/publication/PubMed/12626323" } ] }, { "title": "NMR solution structure of the glucagon antagonist [desHis1, desPhe6, Glu9]glucagon amide in the presence of perdeuterated dodecylphosphocholine micelles.", "journal": "Biochemistry", "date": "2003", "authors": "Ying Jinfa, Ahn Jung-Mo, Jacobsen Neil E, Brown Michael F, Hruby Victor J", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "reference": [ { "type": "PubMed", "id": "12627948", "url": "https://glygen.org/publication/PubMed/12627948" } ] }, { "title": "Expression, purification, and PC1-mediated processing of human proglucagon, glicentin, and major proglucagon fragment.", "journal": "Protein expression and purification", "date": "2003", "authors": "Bonic A, Mackin RB", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" }, { "database": "Reactome", "id": "R-HSA-381771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381771" } ], "reference": [ { "type": "PubMed", "id": "12651102", "url": "https://glygen.org/publication/PubMed/12651102" } ] }, { "title": "Muscarinic receptors control glucagon-like peptide 1 secretion by human endocrine L cells.", "journal": "Endocrinology", "date": "2003", "authors": "Anini Y, Brubaker PL", "evidence": [ { "database": "Reactome", "id": "R-HSA-381771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381771" } ], "reference": [ { "type": "PubMed", "id": "12810581", "url": "https://glygen.org/publication/PubMed/12810581" } ] }, { "title": "Characterization of the 5-HT6 receptor coupled to Ca2+ signaling using an enabling chimeric G-protein.", "journal": "European journal of pharmacology", "date": "2003", "authors": "Zhang JY, Nawoschik S, Kowal D, Smith D, Spangler T, Ochalski R, Schechter L, Dunlop J", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "12860470", "url": "https://glygen.org/publication/PubMed/12860470" } ] }, { "title": "Identification of an IQGAP1/AKAP79 complex in beta-cells.", "journal": "Journal of cellular biochemistry", "date": "2003", "authors": "Nauert JB, Rigas JD, Lester LB", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "12938160", "url": "https://glygen.org/publication/PubMed/12938160" } ] }, { "title": "Molecular cloning and expression of a pituitary-specific receptor for growth hormone-releasing hormone.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1992", "authors": "Mayo KE", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "1333056", "url": "https://glygen.org/publication/PubMed/1333056" } ] }, { "title": "Fractionation and characterization of a cyclic adenine ribonucleotide formed by tissue particles.", "journal": "The Journal of biological chemistry", "date": "1958", "authors": "SUTHERLAND EW, RALL TW", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "13549488", "url": "https://glygen.org/publication/PubMed/13549488" } ] }, { "title": "Type VIII adenylyl cyclase in rat beta cells: coincidence signal detector/generator for glucose and GLP-1.", "journal": "Diabetologia", "date": "2003", "authors": "Delmeire D, Flamez D, Hinke SA, Cali JJ, Pipeleers D, Schuit F", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "13680124", "url": "https://glygen.org/publication/PubMed/13680124" } ] }, { "title": "Oxyntomodulin suppresses appetite and reduces food intake in humans.", "journal": "J. Clin. Endocrinol. Metab.", "date": "2003", "authors": "Cohen Mark A, Ellis Sandra M, Le Roux Carel W, Batterham Rachel L, Park Adrian, Patterson Michael, Frost Gary S, Ghatei Mohammad A, Bloom Stephen R", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "reference": [ { "type": "PubMed", "id": "14557443", "url": "https://glygen.org/publication/PubMed/14557443" } ] }, { "title": "Differential effect of protein and fat on plasma ghrelin levels in man.", "journal": "Regulatory peptides", "date": "2003", "authors": "Erdmann J, Lippl F, Schusdziarra V", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "14599721", "url": "https://glygen.org/publication/PubMed/14599721" } ] }, { "title": "Postnatal and postprandial changes in plasma concentrations of glicentin in term and preterm infants.", "journal": "Acta Paediatr.", "date": "2003", "authors": "Tadokoro R, Shimizu T, Hosaka A, Kaneko N, Satoh Y, Yamashiro Y", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "reference": [ { "type": "PubMed", "id": "14632334", "url": "https://glygen.org/publication/PubMed/14632334" } ] }, { "title": "Insights into G protein structure, function, and regulation.", "journal": "Endocrine reviews", "date": "2003", "authors": "Cabrera-Vera TM, Vanhauwe J, Thomas TO, Medkova M, Preininger A, Mazzoni MR, Hamm HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "14671004", "url": "https://glygen.org/publication/PubMed/14671004" } ] }, { "title": "Direct and indirect mechanisms regulating secretion of glucagon-like peptide-1 and glucagon-like peptide-2.", "journal": "Canadian journal of physiology and pharmacology", "date": "2003", "authors": "Brubaker PL, Anini Y", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" }, { "database": "Reactome", "id": "R-HSA-381771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381771" } ], "reference": [ { "type": "PubMed", "id": "14719035", "url": "https://glygen.org/publication/PubMed/14719035" } ] }, { "title": "Characterisation of human dipeptidyl peptidase IV expressed in Pichia pastoris. A structural and mechanistic comparison between the recombinant human and the purified porcine enzyme.", "journal": "Biological chemistry", "date": "2003", "authors": "Bar J, Weber A, Hoffmann T, Stork J, Wermann M, Wagner L, Aust S, Gerhartz B, Demuth HU", "evidence": [ { "database": "Reactome", "id": "R-HSA-381771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381771" } ], "reference": [ { "type": "PubMed", "id": "14719797", "url": "https://glygen.org/publication/PubMed/14719797" } ] }, { "title": "Expression of voltage-gated potassium channels in human and rhesus pancreatic islets.", "journal": "Diabetes", "date": "2004", "authors": "Yan L, Figueroa DJ, Austin CP, Liu Y, Bugianesi RM, Slaughter RS, Kaczorowski GJ, Kohler MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "14988243", "url": "https://glygen.org/publication/PubMed/14988243" } ] }, { "title": "Glucagon-like peptide-1 cells in the gastrointestinal tract and pancreas of rat, pig and man.", "journal": "European journal of clinical investigation", "date": "1992", "authors": "Eissele R, Goke R, Willemer S, Harthus HP, Vermeer H, Arnold R, Goke B", "evidence": [ { "database": "Reactome", "id": "R-HSA-381771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381771" } ], "reference": [ { "type": "PubMed", "id": "1499644", "url": "https://glygen.org/publication/PubMed/1499644" } ] }, { "title": "Inhibition of dipeptidyl peptidase-4 reduces glycemia, sustains insulin levels, and reduces glucagon levels in type 2 diabetes.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2004", "authors": "Ahren B, Landin-Olsson M, Jansson PA, Svensson M, Holmes D, Schweizer A", "evidence": [ { "database": "Reactome", "id": "R-HSA-381771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381771" } ], "reference": [ { "type": "PubMed", "id": "15126524", "url": "https://glygen.org/publication/PubMed/15126524" } ] }, { "title": "Acetylcholine regulates ghrelin secretion in humans.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2004", "authors": "Broglio F, Gottero C, Van Koetsveld P, Prodam F, Destefanis S, Benso A, Gauna C, Hofland L, Arvat E, van der Lely AJ, Ghigo E", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "15126574", "url": "https://glygen.org/publication/PubMed/15126574" } ] }, { "title": "Genomic structure and characterization of the 5'-flanking region of the human ghrelin gene.", "journal": "Endocrinology", "date": "2004", "authors": "Kanamoto N, Akamizu T, Tagami T, Hataya Y, Moriyama K, Takaya K, Hosoda H, Kojima M, Kangawa K, Nakao K", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "15142980", "url": "https://glygen.org/publication/PubMed/15142980" } ] }, { "title": "Beta-arrestin2, a novel member of the arrestin/beta-arrestin gene family.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Attramadal H, Arriza JL, Aoki C, Dawson TM, Codina J, Kwatra MM, Snyder SH, Caron MG, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "1517224", "url": "https://glygen.org/publication/PubMed/1517224" } ] }, { "title": "Ghrelin degradation by serum and tissue homogenates: identification of the cleavage sites.", "journal": "Endocrinology", "date": "2004", "authors": "De Vriese C, Gregoire F, Lema-Kisoka R, Waelbroeck M, Robberecht P, Delporte C", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "15256494", "url": "https://glygen.org/publication/PubMed/15256494" } ] }, { "title": "Hepatic glucagon receptor binding and glucose-lowering in vivo by peptidyl and non-peptidyl glucagon receptor antagonists.", "journal": "European journal of pharmacology", "date": "2004", "authors": "Dallas-Yang Q, Shen X, Strowski M, Brady E, Saperstein R, Gibson RE, Szalkowski D, Qureshi SA, Candelore MR, Fenyk-Melody JE, Parmee ER, Zhang BB, Jiang G", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "15464082", "url": "https://glygen.org/publication/PubMed/15464082" } ] }, { "title": "The HeLa cell glucagon-like peptide-2 receptor is coupled to regulation of apoptosis and ERK1/2 activation through divergent signaling pathways.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2005", "authors": "Koehler JA, Yusta B, Drucker DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "15471943", "url": "https://glygen.org/publication/PubMed/15471943" } ] }, { "title": "Glucagon-like peptide-1: regulation of insulin secretion and therapeutic potential.", "journal": "Basic & clinical pharmacology & toxicology", "date": "2004", "authors": "Gromada J, Brock B, Schmitz O, Rorsman P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "15569269", "url": "https://glygen.org/publication/PubMed/15569269" } ] }, { "title": "Dipeptidyl peptidase IV and related enzymes in cell biology and liver disorders.", "journal": "Clinical science (London, England : 1979)", "date": "2005", "authors": "Gorrell MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-381771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381771" } ], "reference": [ { "type": "PubMed", "id": "15584901", "url": "https://glygen.org/publication/PubMed/15584901" } ] }, { "title": "Characterization and regulation of the rat and human ghrelin promoters.", "journal": "Endocrinology", "date": "2005", "authors": "Wei W, Wang G, Qi X, Englander EW, Greeley GH Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "15604212", "url": "https://glygen.org/publication/PubMed/15604212" } ] }, { "title": "Free fatty acids regulate gut incretin glucagon-like peptide-1 secretion through GPR120.", "journal": "Nature medicine", "date": "2005", "authors": "Hirasawa A, Tsumaya K, Awaji T, Katsuma S, Adachi T, Yamada M, Sugimoto Y, Miyazaki S, Tsujimoto G", "evidence": [ { "database": "Reactome", "id": "R-HSA-381771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381771" } ], "reference": [ { "type": "PubMed", "id": "15619630", "url": "https://glygen.org/publication/PubMed/15619630" } ] }, { "title": "Effects of piclamilast, a selective phosphodiesterase-4 inhibitor, on oxidative burst of sputum cells from mild asthmatics and stable COPD patients.", "journal": "Lung", "date": "2004", "authors": "Beeh KM, Beier J, Lerch C, Schulz AK, Buhl R", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "15765929", "url": "https://glygen.org/publication/PubMed/15765929" } ] }, { "title": "Cyclic nucleotide phosphodiesterase-mediated integration of cGMP and cAMP signaling in cells of the cardiovascular system.", "journal": "Frontiers in bioscience : a journal and virtual library", "date": "2005", "authors": "Maurice DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "15769620", "url": "https://glygen.org/publication/PubMed/15769620" } ] }, { "title": "The GAPs, GEFs, and GDIs of heterotrimeric G-protein alpha subunits.", "journal": "International journal of biological sciences", "date": "2005", "authors": "Siderovski DP, Willard FS", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "15951850", "url": "https://glygen.org/publication/PubMed/15951850" } ] }, { "title": "A novel mechanism for the suppression of a voltage-gated potassium channel by glucose-dependent insulinotropic polypeptide: protein kinase A-dependent endocytosis.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Kim SJ, Choi WS, Han JS, Warnock G, Fedida D, McIntosh CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "15955806", "url": "https://glygen.org/publication/PubMed/15955806" } ] }, { "title": "The Rap-B-Raf signalling pathway is activated by glucose and glucagon-like peptide-1 in human islet cells.", "journal": "Diabetologia", "date": "2005", "authors": "Trumper J, Ross D, Jahr H, Brendel MD, Goke R, Horsch D", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "15995848", "url": "https://glygen.org/publication/PubMed/15995848" } ] }, { "title": "Cell signalling diversity of the Gqalpha family of heterotrimeric G proteins.", "journal": "Cellular signalling", "date": "2006", "authors": "Hubbard KB, Hepler JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "16182515", "url": "https://glygen.org/publication/PubMed/16182515" } ] }, { "title": "Human duodenal enteroendocrine cells: source of both incretin peptides, GLP-1 and GIP.", "journal": "American journal of physiology. Endocrinology and metabolism", "date": "2006", "authors": "Theodorakis MJ, Carlson O, Michopoulos S, Doyle ME, Juhaszova M, Petraki K, Egan JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381771" } ], "reference": [ { "type": "PubMed", "id": "16219666", "url": "https://glygen.org/publication/PubMed/16219666" } ] }, { "title": "Galphaq binds to p110alpha/p85alpha phosphoinositide 3-kinase and displaces Ras.", "journal": "The Biochemical journal", "date": "2006", "authors": "Ballou LM, Chattopadhyay M, Li Y, Scarlata S, Lin RZ", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "16268778", "url": "https://glygen.org/publication/PubMed/16268778" } ] }, { "title": "Preferential inhibition of human phosphodiesterase 4 by ibudilast.", "journal": "Life sciences", "date": "2006", "authors": "Huang Z, Liu S, Zhang L, Salem M, Greig GM, Chan CC, Natsumeda Y, Noguchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "16313925", "url": "https://glygen.org/publication/PubMed/16313925" } ] }, { "title": "Snapshot of activated G proteins at the membrane: the Galphaq-GRK2-Gbetagamma complex.", "journal": "Science (New York, N.Y.)", "date": "2005", "authors": "Tesmer VM, Kawano T, Shankaranarayanan A, Kozasa T, Tesmer JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "16339447", "url": "https://glygen.org/publication/PubMed/16339447" } ] }, { "title": "cAMP sensor Epac as a determinant of ATP-sensitive potassium channel activity in human pancreatic beta cells and rat INS-1 cells.", "journal": "The Journal of physiology", "date": "2006", "authors": "Kang G, Chepurny OG, Malester B, Rindler MJ, Rehmann H, Bos JL, Schwede F, Coetzee WA, Holz GG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "16613879", "url": "https://glygen.org/publication/PubMed/16613879" } ] }, { "title": "G-protein-coupled receptor kinase specificity for beta-arrestin recruitment to the beta2-adrenergic receptor revealed by fluorescence resonance energy transfer.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Violin JD, Ren XR, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "16687412", "url": "https://glygen.org/publication/PubMed/16687412" } ] }, { "title": "Colocalization of the alpha-subunit of gustducin with PYY and GLP-1 in L cells of human colon.", "journal": "American journal of physiology. Gastrointestinal and liver physiology", "date": "2006", "authors": "Rozengurt N, Wu SV, Chen MC, Huang C, Sternini C, Rozengurt E", "evidence": [ { "database": "Reactome", "id": "R-HSA-381771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381771" } ], "reference": [ { "type": "PubMed", "id": "16728727", "url": "https://glygen.org/publication/PubMed/16728727" } ] }, { "title": "Stable association between G alpha(q) and phospholipase C beta 1 in living cells.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Dowal L, Provitera P, Scarlata S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "16754659", "url": "https://glygen.org/publication/PubMed/16754659" } ] }, { "title": "Structural basis of function in heterotrimeric G proteins.", "journal": "Quarterly reviews of biophysics", "date": "2006", "authors": "Oldham WM, Hamm HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "16923326", "url": "https://glygen.org/publication/PubMed/16923326" } ] }, { "title": "Cell physiology of cAMP sensor Epac.", "journal": "The Journal of physiology", "date": "2006", "authors": "Holz GG, Kang G, Harbeck M, Roe MW, Chepurny OG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "16973695", "url": "https://glygen.org/publication/PubMed/16973695" } ] }, { "title": "Meat hydrolysate and essential amino acid-induced glucagon-like peptide-1 secretion, in the human NCI-H716 enteroendocrine cell line, is regulated by extracellular signal-regulated kinase1/2 and p38 mitogen-activated protein kinases.", "journal": "The Journal of endocrinology", "date": "2006", "authors": "Reimer RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381771" } ], "reference": [ { "type": "PubMed", "id": "17065399", "url": "https://glygen.org/publication/PubMed/17065399" } ] }, { "title": "Some G protein heterotrimers physically dissociate in living cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Digby GJ, Lober RM, Sethi PR, Lambert NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "17095603", "url": "https://glygen.org/publication/PubMed/17095603" } ] }, { "title": "Phosphodiesterase 4 inhibitors for the treatment of asthma and COPD.", "journal": "Current medicinal chemistry", "date": "2006", "authors": "Huang Z, Mancini JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "17168849", "url": "https://glygen.org/publication/PubMed/17168849" } ] }, { "title": "Ghrelin interacts with human plasma lipoproteins.", "journal": "Endocrinology", "date": "2007", "authors": "De Vriese C, Hacquebard M, Gregoire F, Carpentier Y, Delporte C", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "17289852", "url": "https://glygen.org/publication/PubMed/17289852" } ] }, { "title": "Mechanisms of action of glucagon-like peptide 1 in the pancreas.", "journal": "Pharmacology & therapeutics", "date": "2007", "authors": "Doyle ME, Egan JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "17306374", "url": "https://glygen.org/publication/PubMed/17306374" } ] }, { "title": "Primary structure and characterization of the precursor to human pituitary adenylate cyclase activating polypeptide.", "journal": "DNA and cell biology", "date": "1992", "authors": "Ohkubo S, Kimura C, Ogi K, Okazaki K, Hosoya M, Onda H, Miyata A, Arimura A, Fujino M", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "1739432", "url": "https://glygen.org/publication/PubMed/1739432" } ] }, { "title": "Differential structural properties of GLP-1 and exendin-4 determine their relative affinity for the GLP-1 receptor N-terminal extracellular domain.", "journal": "Biochemistry", "date": "2007", "authors": "Runge S, Schimmer S, Oschmann J, Schiodt CB, Knudsen SM, Jeppesen CB, Madsen K, Lau J, Thogersen H, Rudolph R", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "17444618", "url": "https://glygen.org/publication/PubMed/17444618" } ] }, { "title": "Ghrelin and motilin are cosecreted from a prominent endocrine cell population in the small intestine.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2007", "authors": "Wierup N, Bjorkqvist M, Westrom B, Pierzynowski S, Sundler F, Sjolund K", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "17595255", "url": "https://glygen.org/publication/PubMed/17595255" } ] }, { "title": "GLUT2 and the incretin receptors are involved in glucose-induced incretin secretion.", "journal": "Molecular and cellular endocrinology", "date": "2007", "authors": "Cani PD, Holst JJ, Drucker DJ, Delzenne NM, Thorens B, Burcelin R, Knauf C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381771" } ], "reference": [ { "type": "PubMed", "id": "17681422", "url": "https://glygen.org/publication/PubMed/17681422" } ] }, { "title": "G-protein-coupled receptors and islet function-implications for treatment of type 2 diabetes.", "journal": "Pharmacology & therapeutics", "date": "2007", "authors": "Winzell MS, Ahren B", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "17900700", "url": "https://glygen.org/publication/PubMed/17900700" } ] }, { "title": "PDE4 inhibitors as potential therapeutic agents in the treatment of COPD-focus on roflumilast.", "journal": "International journal of chronic obstructive pulmonary disease", "date": "2007", "authors": "Boswell-Smith V, Spina D", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "18044684", "url": "https://glygen.org/publication/PubMed/18044684" } ] }, { "title": "Role of the cAMP sensor Epac as a determinant of KATP channel ATP sensitivity in human pancreatic beta-cells and rat INS-1 cells.", "journal": "The Journal of physiology", "date": "2008", "authors": "Kang G, Leech CA, Chepurny OG, Coetzee WA, Holz GG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "18202100", "url": "https://glygen.org/publication/PubMed/18202100" } ] }, { "title": "Crystal structure of the ligand-bound glucagon-like peptide-1 receptor extracellular domain.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Runge S, Thogersen H, Madsen K, Lau J, Rudolph R", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "18287102", "url": "https://glygen.org/publication/PubMed/18287102" } ] }, { "title": "Ghrelin, des-acyl ghrelin and obestatin: three pieces of the same puzzle.", "journal": "Peptides", "date": "2008", "authors": "Soares JB, Leite-Moreira AF", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "18396350", "url": "https://glygen.org/publication/PubMed/18396350" } ] }, { "title": "Design and synthesis of conformationally constrained glucagon-like peptide-1 derivatives with increased plasma stability and prolonged in vivo activity.", "journal": "Journal of medicinal chemistry", "date": "2008", "authors": "Miranda LP, Winters KA, Gegg CV, Patel A, Aral J, Long J, Zhang J, Diamond S, Guido M, Stanislaus S, Ma M, Li H, Rose MJ, Poppe L, Veniant MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "18412318", "url": "https://glygen.org/publication/PubMed/18412318" } ] }, { "title": "Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Soundararajan M, Willard FS, Kimple AJ, Turnbull AP, Ball LJ, Schoch GA, Gileadi C, Fedorov OY, Dowler EF, Higman VA, Hutsell SQ, Sundstrom M, Doyle DA, Siderovski DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "18434541", "url": "https://glygen.org/publication/PubMed/18434541" } ] }, { "title": "Ghrelin octanoylation mediated by an orphan lipid transferase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Gutierrez JA, Solenberg PJ, Perkins DR, Willency JA, Knierman MD, Jin Z, Witcher DR, Luo S, Onyia JE, Hale JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "18443287", "url": "https://glygen.org/publication/PubMed/18443287" } ] }, { "title": "Galphaq binds two effectors separately in cells: evidence for predetermined signaling pathways.", "journal": "Biophysical journal", "date": "2008", "authors": "Golebiewska U, Scarlata S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "18515384", "url": "https://glygen.org/publication/PubMed/18515384" } ] }, { "title": "Gpr40 is expressed in enteroendocrine cells and mediates free fatty acid stimulation of incretin secretion.", "journal": "Diabetes", "date": "2008", "authors": "Edfalk S, Steneberg P, Edlund H", "evidence": [ { "database": "Reactome", "id": "R-HSA-381771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381771" } ], "reference": [ { "type": "PubMed", "id": "18519800", "url": "https://glygen.org/publication/PubMed/18519800" } ] }, { "title": "Dissociation of heterotrimeric g proteins in cells.", "journal": "Science signaling", "date": "2008", "authors": "Lambert NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "18577758", "url": "https://glygen.org/publication/PubMed/18577758" } ] }, { "title": "Assembly of high order G alpha q-effector complexes with RGS proteins.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Shankaranarayanan A, Thal DM, Tesmer VM, Roman DL, Neubig RR, Kozasa T, Tesmer JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "18936096", "url": "https://glygen.org/publication/PubMed/18936096" } ] }, { "title": "Nutritional regulation of glucagon-like peptide-1 secretion.", "journal": "The Journal of physiology", "date": "2009", "authors": "Tolhurst G, Reimann F, Gribble FM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381771" } ], "reference": [ { "type": "PubMed", "id": "19001044", "url": "https://glygen.org/publication/PubMed/19001044" } ] }, { "title": "G alpha 16, a G protein alpha subunit specifically expressed in hematopoietic cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1991", "authors": "Amatruda TT 3rd, Steele DA, Slepak VZ, Simon MI", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "1905813", "url": "https://glygen.org/publication/PubMed/1905813" } ] }, { "title": "The efficacy and safety of cilomilast in COPD.", "journal": "Drugs", "date": "2008", "authors": "Rennard S, Knobil K, Rabe KF, Morris A, Schachter N, Locantore N, Canonica WG, Zhu Y, Barnhart F", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "19105585", "url": "https://glygen.org/publication/PubMed/19105585" } ] }, { "title": "Ghrelin fluctuation, what determines its production?", "journal": "Acta biochimica et biophysica Sinica", "date": "2009", "authors": "Yin X, Li Y, Xu G, An W, Zhang W", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "19280057", "url": "https://glygen.org/publication/PubMed/19280057" } ] }, { "title": "KLF4 positively regulates human ghrelin expression.", "journal": "The Biochemical journal", "date": "2009", "authors": "Lee HJ, Kang YM, Moon CS, Joe MK, Lim JH, Suh YH, Song J, Jung MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "19327128", "url": "https://glygen.org/publication/PubMed/19327128" } ] }, { "title": "Production of n-octanoyl-modified ghrelin in cultured cells requires prohormone processing protease and ghrelin O-acyltransferase, as well as n-octanoic acid.", "journal": "Journal of biochemistry", "date": "2009", "authors": "Takahashi T, Ida T, Sato T, Nakashima Y, Nakamura Y, Tsuji A, Kojima M", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "19628676", "url": "https://glygen.org/publication/PubMed/19628676" } ] }, { "title": "Functional characterization of N-terminally GFP-tagged GLP-1 receptor.", "journal": "Journal of biomedicine & biotechnology", "date": "2009", "authors": "Bavec A, Licar A", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "19859570", "url": "https://glygen.org/publication/PubMed/19859570" } ] }, { "title": "Crystal structure of glucagon-like peptide-1 in complex with the extracellular domain of the glucagon-like peptide-1 receptor.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Underwood CR, Garibay P, Knudsen LB, Hastrup S, Peters GH, Rudolph R, Reedtz-Runge S", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "19861722", "url": "https://glygen.org/publication/PubMed/19861722" } ] }, { "title": "AN-2728, a PDE4 inhibitor for the potential topical treatment of psoriasis and atopic dermatitis.", "journal": "Current opinion in investigational drugs (London, England : 2000)", "date": "2009", "authors": "Nazarian R, Weinberg JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "19876791", "url": "https://glygen.org/publication/PubMed/19876791" } ] }, { "title": "Ibudilast: a review of its pharmacology, efficacy and safety in respiratory and neurological disease.", "journal": "Expert opinion on pharmacotherapy", "date": "2009", "authors": "Rolan P, Hutchinson M, Johnson K", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "19929708", "url": "https://glygen.org/publication/PubMed/19929708" } ] }, { "title": "The preclinical pharmacology of roflumilast--a selective, oral phosphodiesterase 4 inhibitor in development for chronic obstructive pulmonary disease.", "journal": "Pulmonary pharmacology & therapeutics", "date": "2010", "authors": "Hatzelmann A, Morcillo EJ, Lungarella G, Adnot S, Sanjar S, Beume R, Schudt C, Tenor H", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "20381629", "url": "https://glygen.org/publication/PubMed/20381629" } ] }, { "title": "Ibudilast, a mixed PDE3/4 inhibitor, causes a selective and nitric oxide/cGMP-independent relaxation of the intracranial vertebrobasilar artery.", "journal": "European journal of pharmacology", "date": "2011", "authors": "Yamazaki T, Anraku T, Matsuzawa S", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "21036126", "url": "https://glygen.org/publication/PubMed/21036126" } ] }, { "title": "beta-Arrestin: a protein that regulates beta-adrenergic receptor function.", "journal": "Science (New York, N.Y.)", "date": "1990", "authors": "Lohse MJ, Benovic JL, Codina J, Caron MG, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "2163110", "url": "https://glygen.org/publication/PubMed/2163110" } ] }, { "title": "Interleukin-6 enhances insulin secretion by increasing glucagon-like peptide-1 secretion from L cells and alpha cells.", "journal": "Nature medicine", "date": "2011-10-30", "authors": "Ellingsgaard Helga, Hauselmann Irina, Schuler Beat, Habib Abdella M, Baggio Laurie L, Meier Daniel T, Eppler Elisabeth, Bouzakri Karim, Wueest Stephan, Muller Yannick D, Hansen Ann Maria Kruse, Reinecke Manfred, Konrad Daniel, Gassmann Max, Reimann Frank, Halban Philippe A, Gromada Jesper, Drucker Daniel J, Gribble Fiona M, Ehses Jan A, Donath Marc Y", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "reference": [ { "type": "PubMed", "id": "22037645", "url": "https://glygen.org/publication/PubMed/22037645" } ] }, { "title": "Structure of the human glucagon class B G-protein-coupled receptor.", "journal": "Nature", "date": "2013", "authors": "Siu FY, He M, de Graaf C, Han GW, Yang D, Zhang Z, Zhou C, Xu Q, Wacker D, Joseph JS, Liu W, Lau J, Cherezov V, Katritch V, Wang MW, Stevens RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-163359", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-163359" } ], "reference": [ { "type": "PubMed", "id": "23863937", "url": "https://glygen.org/publication/PubMed/23863937" } ] }, { "title": "Pharmacology of the bipyridines: amrinone and milrinone.", "journal": "Circulation", "date": "1986", "authors": "Alousi AA, Johnson DC", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "2417744", "url": "https://glygen.org/publication/PubMed/2417744" } ] }, { "title": "Advances in targeting cyclic nucleotide phosphodiesterases.", "journal": "Nature reviews. Drug discovery", "date": "2014", "authors": "Maurice DH, Ke H, Ahmad F, Wang Y, Chung J, Manganiello VC", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "24687066", "url": "https://glygen.org/publication/PubMed/24687066" } ] }, { "title": "Expression of Gs alpha in Escherichia coli. Purification and properties of two forms of the protein.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Graziano MP, Freissmuth M, Gilman AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "2491850", "url": "https://glygen.org/publication/PubMed/2491850" } ] }, { "title": "Pharmacology of positive inotropic phosphodiesterase III inhibitors.", "journal": "European heart journal", "date": "1989", "authors": "Honerjager P", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "2553411", "url": "https://glygen.org/publication/PubMed/2553411" } ] }, { "title": "Multiple signaling pathways of histamine H2 receptors. Identification of an H2 receptor-dependent Ca2+ mobilization pathway in human HL-60 promyelocytic leukemia cells.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Mitsuhashi M, Mitsuhashi T, Payan DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "2553705", "url": "https://glygen.org/publication/PubMed/2553705" } ] }, { "title": "Discovery of the Once-Weekly Glucagon-Like Peptide-1 (GLP-1) Analogue Semaglutide.", "journal": "Journal of medicinal chemistry", "date": "2015", "authors": "Lau J, Bloch P, Schaffer L, Pettersson I, Spetzler J, Kofoed J, Madsen K, Knudsen LB, McGuire J, Steensgaard DB, Strauss HM, Gram DX, Knudsen SM, Nielsen FS, Thygesen P, Reedtz-Runge S, Kruse T", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "26308095", "url": "https://glygen.org/publication/PubMed/26308095" } ] }, { "title": "Pentoxifylline for intermittent claudication.", "journal": "The Cochrane database of systematic reviews", "date": "2015", "authors": "Salhiyyah K, Forster R, Senanayake E, Abdel-Hadi M, Booth A, Michaels JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "26417854", "url": "https://glygen.org/publication/PubMed/26417854" } ] }, { "title": "Complete sequences of glucagon-like peptide-1 from human and pig small intestine.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Orskov C, Bersani M, Johnsen AH, Hojrup P, Holst JJ", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "reference": [ { "type": "PubMed", "id": "2753890", "url": "https://glygen.org/publication/PubMed/2753890" } ] }, { "title": "Identification of the lesion in the stimulatory GTP-binding protein of the uncoupled S49 lymphoma.", "journal": "FEBS letters", "date": "1987", "authors": "Rall T, Harris BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "2826231", "url": "https://glygen.org/publication/PubMed/2826231" } ] }, { "title": "Purification and characterization of membrane-bound phospholipase C specific for phosphoinositides from human platelets.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Banno Y, Yada Y, Nozawa Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "2841328", "url": "https://glygen.org/publication/PubMed/2841328" } ] }, { "title": "Beta-adrenergic receptor kinase: identification of a novel protein kinase that phosphorylates the agonist-occupied form of the receptor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1986", "authors": "Benovic JL, Strasser RH, Caron MG, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "2871555", "url": "https://glygen.org/publication/PubMed/2871555" } ] }, { "title": "Glucagon gene expression in vertebrate brain.", "journal": "J. Biol. Chem.", "date": "1988", "authors": "Drucker D J, Asa S", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "reference": [ { "type": "PubMed", "id": "2901414", "url": "https://glygen.org/publication/PubMed/2901414" } ] }, { "title": "Effect and safety of roflumilast for chronic obstructive pulmonary disease in Chinese patients.", "journal": "Medicine", "date": "2018", "authors": "Liu DY, Wang ZG, Gao Y, Zhang HM, Zhang YX, Wang XJ, Peng D", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "29443750", "url": "https://glygen.org/publication/PubMed/29443750" } ] }, { "title": "Use of cilomilast-loaded phosphatiosomes to suppress neutrophilic inflammation for attenuating acute lung injury: the effect of nanovesicular surface charge.", "journal": "Journal of nanobiotechnology", "date": "2018", "authors": "Liu FC, Yu HP, Lin CY, Elzoghby AO, Hwang TL, Fang JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "29602314", "url": "https://glygen.org/publication/PubMed/29602314" } ] }, { "title": "Physiology and Pharmacology of DPP-4 in Glucose Homeostasis and the Treatment of Type 2 Diabetes.", "journal": "Frontiers in endocrinology", "date": "2019", "authors": "Deacon CF", "evidence": [ { "database": "Reactome", "id": "R-HSA-381771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381771" } ], "reference": [ { "type": "PubMed", "id": "30828317", "url": "https://glygen.org/publication/PubMed/30828317" } ] }, { "title": "IL-12/IL-23p40 identified as a downstream target of apremilast in ex vivo models of arthritis.", "journal": "Therapeutic advances in musculoskeletal disease", "date": "2019", "authors": "Kragstrup TW, Adams M, Lomholt S, Nielsen MA, Heftdal LD, Schafer P, Deleuran B", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "30833991", "url": "https://glygen.org/publication/PubMed/30833991" } ] }, { "title": "The influence of bound GDP on the kinetics of guanine nucleotide binding to G proteins.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Ferguson KM, Higashijima T, Smigel MD, Gilman AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "3086311", "url": "https://glygen.org/publication/PubMed/3086311" } ] }, { "title": "Isolation and characterization of the human Gs alpha gene.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1988", "authors": "Kozasa T, Itoh H, Tsukamoto T, Kaziro Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "3127824", "url": "https://glygen.org/publication/PubMed/3127824" } ] }, { "title": "Crisaborole 2% ointment for the treatment of intertriginous, anogenital, and facial psoriasis: A double-blind, randomized, vehicle-controlled trial.", "journal": "Journal of the American Academy of Dermatology", "date": "2020", "authors": "Hashim PW, Chima M, Kim HJ, Bares J, Yao CJ, Singer G, Chen T, Genece J, Baum D, Kimmel GW, Nia JK, Gagliotti M, Lebwohl MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "31279028", "url": "https://glygen.org/publication/PubMed/31279028" } ] }, { "title": "Effect of the inhaled PDE4 inhibitor CHF6001 on biomarkers of inflammation in COPD.", "journal": "Respiratory research", "date": "2019", "authors": "Singh D, Beeh KM, Colgan B, Kornmann O, Leaker B, Watz H, Lucci G, Geraci S, Emirova A, Govoni M, Nandeuil MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "31399091", "url": "https://glygen.org/publication/PubMed/31399091" } ] }, { "title": "Simple assessment of quality of life and lower limb functional capacity during cilostazol treatment - results of the SHort-tERm cIlostazol eFFicacy and quality of life (SHERIFF) study.", "journal": "VASA. Zeitschrift fur Gefasskrankheiten", "date": "2020", "authors": "Farkas K, Kolossvary E, Jarai Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "31983287", "url": "https://glygen.org/publication/PubMed/31983287" } ] }, { "title": "Inhaled Phosphodiesterase 4 (PDE4) Inhibitors for Inflammatory Respiratory Diseases.", "journal": "Frontiers in pharmacology", "date": "2020", "authors": "Phillips JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "32226383", "url": "https://glygen.org/publication/PubMed/32226383" } ] }, { "title": "Commentary: Phosphodiesterase 4 inhibitors as potential adjunct treatment targeting the cytokine storm in COVID-19.", "journal": "Metabolism: clinical and experimental", "date": "2020", "authors": "Dalamaga M, Karampela I, Mantzoros CS", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "32497535", "url": "https://glygen.org/publication/PubMed/32497535" } ] }, { "title": "Repositioning of pentoxifylline as an immunomodulator and regulator of the renin-angiotensin system in the treatment of COVID-19.", "journal": "Medical hypotheses", "date": "2020", "authors": "Maldonado V, Loza-Mejia MA, Chavez-Alderete J", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "32540603", "url": "https://glygen.org/publication/PubMed/32540603" } ] }, { "title": "COVID-19 patients with psoriasis and psoriatic arthritis on biologic immunosuppressant therapy vs apremilast in North Spain.", "journal": "Dermatologic therapy", "date": "2020", "authors": "Queiro Silva R, Armesto S, Gonzalez Vela C, Naharro Fernandez C, Gonzalez-Gay MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "32618402", "url": "https://glygen.org/publication/PubMed/32618402" } ] }, { "title": "Hypothesis: Pentoxifylline is a potential cytokine modulator therapeutic in COVID-19 patients.", "journal": "Pharmacology research & perspectives", "date": "2020", "authors": "Hendry BM, Stafford N, Arnold AD, Sangwaiya A, Manglam V, Rosen SD, Arnold J", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "32715661", "url": "https://glygen.org/publication/PubMed/32715661" } ] }, { "title": "Pentoxifylline: A Drug with Antiviral and Anti-Inflammatory Effects to Be Considered in the Treatment of Coronavirus Disease 2019.", "journal": "Medical principles and practice : international journal of the Kuwait University, Health Science Centre", "date": "2021", "authors": "Ghasemnejad-Berenji M, Pashapour S, Sadeghpour S", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "33049737", "url": "https://glygen.org/publication/PubMed/33049737" } ] }, { "title": "Structure of the human glucagon gene.", "journal": "Nucleic Acids Res.", "date": "1986", "authors": "White J W, Saunders G F", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "reference": [ { "type": "PubMed", "id": "3725587", "url": "https://glygen.org/publication/PubMed/3725587" } ] }, { "title": "Regulation of Human Sortilin Alternative Splicing by Glucagon-like Peptide-1 (GLP1) in Adipocytes.", "journal": "International journal of molecular sciences", "date": "2023-09-20", "authors": "Lui Ashley, Patel Rekha S, Krause-Hauch Meredith, Sparks Robert P, Patel Niketa A", "evidence": [ { "database": "RefSeq", "id": "NP_002045", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002045" } ], "reference": [ { "type": "PubMed", "id": "37762628", "url": "https://glygen.org/publication/PubMed/37762628" } ] }, { "title": "Colonic L-cell impairment in aged subjects with type 2 diabetes leads to diminished GLP-1 production.", "journal": "Diabetes & metabolic syndrome", "date": "2023-12", "authors": "Wang Qing-Yu, Zhang Wei, Zhao Yue, Chen Hui-Lian, Liu Qian, Wang Zi-Hui, Zeng Lv-Tao, Li Jin, Chen Si-Jie, Wei Lei, Iwakuma Tomoo, Cai Jian-Ping", "evidence": [ { "database": "RefSeq", "id": "NP_002045", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002045" } ], "reference": [ { "type": "PubMed", "id": "37980723", "url": "https://glygen.org/publication/PubMed/37980723" } ] }, { "title": "Crosstalk between glucagon-like peptide 1 and gut microbiota in metabolic diseases.", "journal": "mBio", "date": "2024-01-16", "authors": "Zeng Yuan, Wu Yifan, Zhang Qian, Xiao Xinhua", "evidence": [ { "database": "RefSeq", "id": "NP_002045", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002045" } ], "reference": [ { "type": "PubMed", "id": "38055342", "url": "https://glygen.org/publication/PubMed/38055342" } ] }, { "title": "Association of GLP-1 secretion with parameters of glycemic control in women after gestational diabetes mellitus.", "journal": "BMJ open diabetes research & care", "date": "2024-01-10", "authors": "Pappa Eleni, Busygina Kristina, Harada Saori, Hermann Hana, Then Cornelia, Lechner Andreas, Ferrari Uta, Seissler Jochen", "evidence": [ { "database": "RefSeq", "id": "NP_002045", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002045" } ], "reference": [ { "type": "PubMed", "id": "38199777", "url": "https://glygen.org/publication/PubMed/38199777" } ] }, { "title": "Glucagon- and PP-related peptides of intestinal L cells and pancreatic/gastric A or PP cells. Possible interrelationships of peptides and cells during evolution, fetal development and tumor growth.", "journal": "Peptides", "date": "1985", "authors": "Solcia E, Fiocca R, Capella C, Usellini L, Sessa F, Rindi G, Schwartz TW, Yanaihara N", "evidence": [ { "database": "Reactome", "id": "R-HSA-381771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381771" } ], "reference": [ { "type": "PubMed", "id": "3841689", "url": "https://glygen.org/publication/PubMed/3841689" } ] }, { "title": "Structure of the human vasoactive intestinal polypeptide gene.", "journal": "DNA (Mary Ann Liebert, Inc.)", "date": "1985", "authors": "Tsukada T, Horovitch SJ, Montminy MR, Mandel G, Goodman RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "3899557", "url": "https://glygen.org/publication/PubMed/3899557" } ] }, { "title": "Localization of glucagon-like peptide (GLP) immunoreactants in human gut and pancreas using light and electron microscopic immunocytochemistry.", "journal": "The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society", "date": "1985", "authors": "Varndell IM, Bishop AE, Sikri KL, Uttenthal LO, Bloom SR, Polak JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381771" } ], "reference": [ { "type": "PubMed", "id": "3900195", "url": "https://glygen.org/publication/PubMed/3900195" } ] }, { "title": "The new inotropic phosphodiesterase inhibitors.", "journal": "Archives internationales de physiologie et de biochimie", "date": "1984", "authors": "el Allaf D, D'Orio V, Carlier J", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "6085243", "url": "https://glygen.org/publication/PubMed/6085243" } ] }, { "title": "Cloning and sequence analysis of cDNA for the precursor of human growth hormone-releasing factor, somatocrinin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1983", "authors": "Gubler U, Monahan JJ, Lomedico PT, Bhatt RS, Collier KJ, Hoffman BJ, Bohlen P, Esch F, Ling N, Zeytin F, Brazeau P, Poonian MS, Gage LP", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "6192430", "url": "https://glygen.org/publication/PubMed/6192430" } ] }, { "title": "The isolation and sequencing of human gastric inhibitory peptide (GIP).", "journal": "FEBS letters", "date": "1984", "authors": "Moody AJ, Thim L, Valverde I", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "6745415", "url": "https://glygen.org/publication/PubMed/6745415" } ] }, { "title": "Exon duplication and divergence in the human preproglucagon gene.", "journal": "Nature", "date": "1983", "authors": "Bell G I, Sanchez-Pescador R, Laybourn P J, Najarian R C", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "reference": [ { "type": "PubMed", "id": "6877358", "url": "https://glygen.org/publication/PubMed/6877358" } ] }, { "title": "Molecular cloning, functional expression, and signal transduction of the GIP-receptor cloned from a human insulinoma.", "journal": "FEBS letters", "date": "1995", "authors": "Volz A, Goke R, Lankat-Buttgereit B, Fehmann HC, Bode HP, Goke B", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "7589426", "url": "https://glygen.org/publication/PubMed/7589426" } ] }, { "title": "Stimulation of cloned human glucagon-like peptide 1 receptor expressed in HEK 293 cells induces cAMP-dependent activation of calcium-induced calcium release.", "journal": "FEBS letters", "date": "1995", "authors": "Gromada J, Rorsman P, Dissing S, Wulff BS", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "7589461", "url": "https://glygen.org/publication/PubMed/7589461" } ] }, { "title": "Molecular cloning and expression of a human anterior pituitary receptor for growth hormone-releasing hormone.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1993", "authors": "Gaylinn BD, Harrison JK, Zysk JR, Lyons CE, Lynch KR, Thorner MO", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "7680413", "url": "https://glygen.org/publication/PubMed/7680413" } ] }, { "title": "Molecular cloning and expression of a human secretin receptor.", "journal": "Molecular pharmacology", "date": "1995", "authors": "Patel DR, Kong Y, Sreedharan SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "7700244", "url": "https://glygen.org/publication/PubMed/7700244" } ] }, { "title": "Molecular cloning and functional characterization of a human VIP receptor from SUP-T1 lymphoblasts.", "journal": "Biochemical and biophysical research communications", "date": "1994", "authors": "Svoboda M, Tastenoy M, Van Rampelbergh J, Goossens JF, De Neef P, Waelbroeck M, Robberecht P", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "7811244", "url": "https://glygen.org/publication/PubMed/7811244" } ] }, { "title": "Degradation of glucagon-like peptide-1 by human plasma in vitro yields an N-terminally truncated peptide that is a major endogenous metabolite in vivo.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1995", "authors": "Deacon CF, Johnsen AH, Holst JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-381771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381771" } ], "reference": [ { "type": "PubMed", "id": "7883856", "url": "https://glygen.org/publication/PubMed/7883856" } ] }, { "title": "Molecular cloning and functional expression of a cDNA encoding a human pituitary adenylate cyclase activating polypeptide receptor.", "journal": "Biochemical and biophysical research communications", "date": "1993", "authors": "Ogi K, Miyamoto Y, Masuda Y, Habata Y, Hosoya M, Ohtaki T, Masuo Y, Onda H, Fujino M", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "7902709", "url": "https://glygen.org/publication/PubMed/7902709" } ] }, { "title": "Mechanism of GTP hydrolysis by G-protein alpha subunits.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Kleuss C, Raw AS, Lee E, Sprang SR, Gilman AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "7937899", "url": "https://glygen.org/publication/PubMed/7937899" } ] }, { "title": "Dipeptidyl-peptidase IV hydrolyses gastric inhibitory polypeptide, glucagon-like peptide-1(7-36)amide, peptide histidine methionine and is responsible for their degradation in human serum.", "journal": "European journal of biochemistry", "date": "1993", "authors": "Mentlein R, Gallwitz B, Schmidt WE", "evidence": [ { "database": "Reactome", "id": "R-HSA-381771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381771" } ], "reference": [ { "type": "PubMed", "id": "8100523", "url": "https://glygen.org/publication/PubMed/8100523" } ] }, { "title": "Tissue and plasma concentrations of amidated and glycine-extended glucagon-like peptide I in humans.", "journal": "Diabetes", "date": "1994", "authors": "Orskov C, Rabenhoj L, Wettergren A, Kofod H, Holst JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "8138058", "url": "https://glygen.org/publication/PubMed/8138058" } ] }, { "title": "The human glucagon receptor encoding gene: structure, cDNA sequence and chromosomal localization.", "journal": "Gene", "date": "1994", "authors": "Lok S, Kuijper JL, Jelinek LJ, Kramer JM, Whitmore TE, Sprecher CA, Mathewes S, Grant FJ, Biggs SH, Rosenberg GB, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "8144028", "url": "https://glygen.org/publication/PubMed/8144028" } ] }, { "title": "Polypeptide variants of beta-arrestin and arrestin3.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Sterne-Marr R, Gurevich VV, Goldsmith P, Bodine RC, Sanders C, Donoso LA, Benovic JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "8340388", "url": "https://glygen.org/publication/PubMed/8340388" } ] }, { "title": "Cloning and functional expression of a human neuroendocrine vasoactive intestinal peptide receptor.", "journal": "Biochemical and biophysical research communications", "date": "1993", "authors": "Sreedharan SP, Patel DR, Huang JX, Goetzl EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "8390245", "url": "https://glygen.org/publication/PubMed/8390245" } ] }, { "title": "Cloning and functional expression of the human glucagon-like peptide-1 (GLP-1) receptor.", "journal": "Endocrinology", "date": "1993", "authors": "Dillon JS, Tanizawa Y, Wheeler MB, Leng XH, Ligon BB, Rabin DU, Yoo-Warren H, Permutt MA, Boyd AE 3rd", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "8404634", "url": "https://glygen.org/publication/PubMed/8404634" } ] }, { "title": "Cloning and functional expression of the human islet GLP-1 receptor. Demonstration that exendin-4 is an agonist and exendin-(9-39) an antagonist of the receptor.", "journal": "Diabetes", "date": "1993", "authors": "Thorens B, Porret A, Buhler L, Deng SP, Morel P, Widmann C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "8405712", "url": "https://glygen.org/publication/PubMed/8405712" } ] }, { "title": "Biological effects and metabolic rates of glucagonlike peptide-1 7-36 amide and glucagonlike peptide-1 7-37 in healthy subjects are indistinguishable.", "journal": "Diabetes", "date": "1993", "authors": "Orskov C, Wettergren A, Holst J J", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "reference": [ { "type": "PubMed", "id": "8482423", "url": "https://glygen.org/publication/PubMed/8482423" } ] }, { "title": "Phosphorylation and desensitization of human m2 muscarinic cholinergic receptors by two isoforms of the beta-adrenergic receptor kinase.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Richardson RM, Kim C, Benovic JL, Hosey MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "8514797", "url": "https://glygen.org/publication/PubMed/8514797" } ] }, { "title": "Human G(alpha q): cDNA and tissue distribution.", "journal": "Biochimica et biophysica acta", "date": "1996", "authors": "Chen B, Leverette RD, Schwinn DA, Kwatra MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "8664309", "url": "https://glygen.org/publication/PubMed/8664309" } ] }, { "title": "Members of the G protein-coupled receptor kinase family that phosphorylate the beta2-adrenergic receptor facilitate sequestration.", "journal": "Biochemistry", "date": "1996", "authors": "Menard L, Ferguson SS, Barak LS, Bertrand L, Premont RT, Colapietro AM, Lefkowitz RJ, Caron MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "8672451", "url": "https://glygen.org/publication/PubMed/8672451" } ] }, { "title": "Investigation of glucose-dependent insulinotropic polypeptide-(1-42) and glucagon-like peptide-1-(7-36) degradation in vitro by dipeptidyl peptidase IV using matrix-assisted laser desorption/ionization-time of flight mass spectrometry. A novel kinetic approach.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Pauly RP, Rosche F, Wermann M, McIntosh CH, Pederson RA, Demuth HU", "evidence": [ { "database": "Reactome", "id": "R-HSA-381771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381771" } ], "reference": [ { "type": "PubMed", "id": "8798518", "url": "https://glygen.org/publication/PubMed/8798518" } ] }, { "title": "Molecular mechanism underlying glucagon-like peptide 1 induced calcium mobilization from internal stores in insulin-secreting beta TC3 cells.", "journal": "Acta physiologica Scandinavica", "date": "1996", "authors": "Gromada J, Rorsman P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "8830891", "url": "https://glygen.org/publication/PubMed/8830891" } ] }, { "title": "Anagrelide as a new platelet-lowering agent in essential thrombocythemia: mechanism of actin, efficacy, toxicity, current indications.", "journal": "Seminars in thrombosis and hemostasis", "date": "1997", "authors": "Tefferi A, Silverstein MN, Petitt RM, Mesa RA, Solberg LA Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "9263355", "url": "https://glygen.org/publication/PubMed/9263355" } ] }, { "title": "Role of the prohormone convertase PC2 in the processing of proglucagon to glucagon.", "journal": "FEBS letters", "date": "1997", "authors": "Rouille Y, Bianchi M, Irminger JC, Halban PA", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "reference": [ { "type": "PubMed", "id": "9287128", "url": "https://glygen.org/publication/PubMed/9287128" } ] }, { "title": "Direct stimulation of Bruton's tyrosine kinase by G(q)-protein alpha-subunit.", "journal": "Nature", "date": "1997", "authors": "Bence K, Ma W, Kozasa T, Huang XY", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "9305846", "url": "https://glygen.org/publication/PubMed/9305846" } ] }, { "title": "Crystal structure of the catalytic domains of adenylyl cyclase in a complex with Gsalpha.GTPgammaS.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Tesmer JJ, Sunahara RK, Gilman AG, Sprang SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "9417641", "url": "https://glygen.org/publication/PubMed/9417641" } ] }, { "title": "Phosphorylation of inositol 1,4,5-trisphosphate receptors by cAMP-dependent protein kinase. Type I, II, and III receptors are differentially susceptible to phosphorylation and are phosphorylated in intact cells.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Wojcikiewicz RJ, Luo SG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "9488697", "url": "https://glygen.org/publication/PubMed/9488697" } ] }, { "title": "Stimulation of type 1 and type 8 Ca2+/calmodulin-sensitive adenylyl cyclases by the Gs-coupled 5-hydroxytryptamine subtype 5-HT7A receptor.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Baker LP, Nielsen MD, Impey S, Metcalf MA, Poser SW, Chan G, Obrietan K, Hamblin MW, Storm DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "9651336", "url": "https://glygen.org/publication/PubMed/9651336" } ] }, { "title": "Structure-function studies on positions 17, 18, and 21 replacement analogues of glucagon: the importance of charged residues and salt bridges in glucagon biological activity.", "journal": "J. Med. Chem.", "date": "1998", "authors": "Sturm N S, Lin Y, Burley S K, Krstenansky J L, Ahn J M, Azizeh B Y, Trivedi D, Hruby V J", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "reference": [ { "type": "PubMed", "id": "9667960", "url": "https://glygen.org/publication/PubMed/9667960" } ] }, { "title": "Identification of the binding site for Gqalpha on its effector Bruton's tyrosine kinase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Ma YC, Huang XY", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "9770463", "url": "https://glygen.org/publication/PubMed/9770463" } ] }, { "title": "Expression of adenylyl cyclase subtypes in pancreatic beta-cells.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Leech CA, Castonguay MA, Habener JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "9920805", "url": "https://glygen.org/publication/PubMed/9920805" } ] }, { "title": "Prototypic G protein-coupled receptor for the intestinotrophic factor glucagon-like peptide 2.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Munroe DG, Gupta AK, Kooshesh F, Vyas TB, Rizkalla G, Wang H, Demchyshyn L, Yang ZJ, Kamboj RK, Chen H, McCallum K, Sumner-Smith M, Drucker DJ, Crivici A", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "9990065", "url": "https://glygen.org/publication/PubMed/9990065" } ] } ], "pathway": [ { "id": "R-HSA-163359", "name": "Glucagon signaling in metabolic regulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-163359", "resource": "Reactome", "description": "Glucagon signaling in metabolic regulation" }, { "id": "R-HSA-381676", "name": "Glucagon-like Peptide-1 (GLP1) regulates insulin secretion", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676", "resource": "Reactome", "description": "Glucagon-like Peptide-1 (GLP1) regulates insulin secretion" }, { "id": "R-HSA-381771", "name": "Synthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381771", "resource": "Reactome", "description": "Synthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1)" }, { "id": "R-HSA-416476", "name": "G alpha (q) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476", "resource": "Reactome", "description": "G alpha (q) signalling events" }, { "id": "R-HSA-418555", "name": "G alpha (s) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555", "resource": "Reactome", "description": "G alpha (s) signalling events" }, { "id": "R-HSA-420092", "name": "Glucagon-type ligand receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092", "resource": "Reactome", "description": "Glucagon-type ligand receptors" }, { "id": "R-HSA-422085", "name": "Synthesis, secretion, and deacylation of Ghrelin", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085", "resource": "Reactome", "description": "Synthesis, secretion, and deacylation of Ghrelin" } ], "orthologs": [ { "uniprot_canonical_ac": "P01274-1", "protein_name": "Pro-glucagon", "gene_name": "GCG", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MKTIYFVAGLFVMLVQGSWQRSLQNTEEKSRSFPAPQTDPLDDPDQMTEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVTIVEELRRRHADGSFSDEMNTVLDNLATRDFINWLLHTKITDSL", "length": 180 }, "evidence": [ { "id": "P01275", "url": "https://omabrowser.org/oma/group/P01275/", "database": "OMA" } ], "common_name": "Pig" }, { "uniprot_canonical_ac": "P06883-1", "protein_name": "Pro-glucagon", "gene_name": "Gcg", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MKTVYIVAGLFVMLVQGSWQHAPQDTEENARSFPASQTEPLEDPDQINEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIAEELGRRHADGSFSDEMNTILDNLATRDFINWLIQTKITDKK", "length": 180 }, "evidence": [ { "id": "45917194", "url": "http://www.informatics.jax.org/homology/45917194", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P55095-1", "protein_name": "Pro-glucagon", "gene_name": "Gcg", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKTIYFVAGLLIMLVQGSWQHALQDTEENPRSFPASQTEAHEDPDEMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIAEELGRRHADGSFSDEMSTILDNLATRDFINWLIQTKITDKK", "length": 180 }, "evidence": [ { "id": "45917194", "url": "http://www.informatics.jax.org/homology/45917194", "database": "MGI" }, { "id": "P01275", "url": "https://omabrowser.org/oma/group/P01275/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "glucagon receptor binding", "id": "GO:0031769", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031769", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "pmid": "" }, { "name": "signaling receptor binding", "id": "GO:0005102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005102", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "pmid": "" }, { "name": "hormone activity", "id": "GO:0005179", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005179", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 19, "go_terms": [ { "name": "protein kinase A signaling", "id": "GO:0010737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010737", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "pmid": "" }, { "name": "G protein-coupled receptor signaling pathway", "id": "GO:0007186", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "pmid": "" }, { "name": "adenylate cyclase-activating G protein-coupled receptor signaling pathway", "id": "GO:0007189", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007189", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "pmid": "" }, { "name": "positive regulation of peptidyl-threonine phosphorylation", "id": "GO:0010800", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010800", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "pmid": "" }, { "name": "positive regulation of peptidyl-serine phosphorylation", "id": "GO:0033138", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033138", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "pmid": "" }, { "name": "negative regulation of apoptotic process", "id": "GO:0043066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043066", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "pmid": "" }, { "name": "positive regulation of ERK1 and ERK2 cascade", "id": "GO:0070374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070374", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "pmid": "" }, { "name": "cellular response to glucagon stimulus", "id": "GO:0071377", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071377", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "pmid": "" }, { "name": "positive regulation of insulin secretion involved in cellular response to glucose stimulus", "id": "GO:0035774", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035774", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "pmid": "" }, { "name": "adenylate cyclase-modulating G protein-coupled receptor signaling pathway", "id": "GO:0007188", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007188", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "pmid": "" }, { "name": "gluconeogenesis", "id": "GO:0006094", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006094", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "pmid": "" }, { "name": "glucose homeostasis", "id": "GO:0042593", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042593", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "pmid": "" }, { "name": "regulation of insulin secretion", "id": "GO:0050796", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050796", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "pmid": "" }, { "name": "feeding behavior", "id": "GO:0007631", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007631", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "pmid": "" }, { "name": "response to activity", "id": "GO:0014823", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014823", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "pmid": "" }, { "name": "positive regulation of histone H3-K4 methylation", "id": "GO:0051571", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051571", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "pmid": "" }, { "name": "positive regulation of calcium ion import", "id": "GO:0090280", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090280", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "pmid": "" }, { "name": "positive regulation of gluconeogenesis", "id": "GO:0045722", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045722", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "pmid": "" }, { "name": "negative regulation of execution phase of apoptosis", "id": "GO:1900118", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900118", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "pmid": "" }, { "name": "endoplasmic reticulum lumen", "id": "GO:0005788", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005788", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "pmid": "" }, { "name": "secretory granule lumen", "id": "GO:0034774", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034774", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "Proglucagon is post-translationally processed in a tissue-specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by post-translational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas.", "evidence": [ { "database": "UniProtKB", "id": "P01275", "url": "https://www.uniprot.org/uniprot/P01275" }, { "database": "PubMed", "id": "12651102", "url": "https://glygen.org/publication/PubMed/12651102" }, { "database": "PubMed", "id": "2753890", "url": "https://glygen.org/publication/PubMed/2753890" }, { "database": "PubMed", "id": "9287128", "url": "https://glygen.org/publication/PubMed/9287128" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 54, 105, 108, 150, 152 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 189 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }