{ "uniprot_canonical_ac": "P01215-1", "uniprot_ac": "P01215", "uniprot_id": "GLHA_HUMAN", "mass": { "chemical_mass": 13075.0, "monoisotopic_mass": 13075.0 }, "refseq": { "ac": "NP_001239312", "name": "glycoprotein hormones alpha chain isoform 1 precursor", "summary": "The four human glycoprotein hormones chorionic gonadotropin (CG), luteinizing hormone (LH), follicle stimulating hormone (FSH), and thyroid stimulating hormone (TSH) are dimers consisting of alpha and beta subunits that are associated noncovalently. The alpha subunits of these hormones are identical, however, their beta chains are unique and confer biological specificity. The protein encoded by this gene is the alpha subunit and belongs to the glycoprotein hormones alpha chain family. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239312" }, "gene_names": [ { "name": "CGA", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P01215", "id": "P01215" }, { "name": "CG-ALPHA; FSHA; GPA1; GPHa; GPHA1; HCG; LHA; TSHA", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239312", "id": "NP_001239312" }, { "name": "CGA", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239312", "id": "NP_001239312" }, { "name": "hCG_33165", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P01215", "id": "P01215" } ], "protein_names": [ { "name": "Glycoprotein hormones alpha chain", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P01215" }, { "name": "Anterior pituitary glycoprotein hormones common subunit alpha", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01215" }, { "name": "CG-alpha", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01215" }, { "name": "Choriogonadotropin alpha chain", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01215" }, { "name": "Chorionic gonadotrophin subunit alpha", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01215" }, { "name": "FSH-alpha", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01215" }, { "name": "Follicle-stimulating hormone alpha chain", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01215" }, { "name": "Follitropin alpha chain", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01215" }, { "name": "LSH-alpha", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01215" }, { "name": "Luteinizing hormone alpha chain", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01215" }, { "name": "Lutropin alpha chain", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01215" }, { "name": "TSH-alpha", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01215" }, { "name": "Thyroid-stimulating hormone alpha chain", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01215" }, { "name": "Thyrotropin alpha chain", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01215" }, { "name": "glycoprotein hormones alpha chain isoform 1 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239312", "id": "NP_001239312" }, { "name": "glycoprotein hormones alpha chain; chorionic gonadotropin, alpha polypeptide; follicle-stimulating hormone alpha subunit; FSH-alpha; LSH-alpha; TSH-alpha; lutropin alpha chain; follitropin alpha chain; thyrotropin alpha chain; choriogonadotropin alpha chain; luteinizing hormone alpha chain; chorionic gonadotrophin subunit alpha; thyroid-stimulating hormone alpha chain; follicle-stimulating hormone alpha chain; anterior pituitary glycoprotein hormones common subunit alpha", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239312", "id": "NP_001239312" } ], "function": [ { "annotation": "Analysis of the human chorionic gonadotropin protein at the intact level by HILIC-MS and comparison with RPLC-MS.", "evidence": [ { "database": "RefSeq", "id": "NP_001239312", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239312" }, { "database": "PubMed", "id": "32377867", "url": "https://glygen.org/publication/PubMed/32377867" } ] }, { "annotation": "GWAS of thyroid stimulating hormone highlights pleiotropic effects and inverse association with thyroid cancer. Erratum:[Nat Commun. 2021 Dec 16;12(1):7354. PMID: 34916535] Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001239312", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239312" }, { "database": "PubMed", "id": "32769997", "url": "https://glygen.org/publication/PubMed/32769997" } ] }, { "annotation": "Myocardial perfusion SPECT as a potential mediator on circulating chromogranin A in patients with old myocardial infarction.", "evidence": [ { "database": "RefSeq", "id": "NP_001239312", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239312" }, { "database": "PubMed", "id": "34352046", "url": "https://glygen.org/publication/PubMed/34352046" } ] }, { "annotation": "Prevalence and predictors of colonoscopic findings in patients with autoimmune gastritis.", "evidence": [ { "database": "RefSeq", "id": "NP_001239312", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239312" }, { "database": "PubMed", "id": "34341100", "url": "https://glygen.org/publication/PubMed/34341100" } ] }, { "annotation": "Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH, follitropin/follicle stimulating hormone/FSH and choriogonadotropin/CG. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways.", "evidence": [ { "database": "UniProtKB", "id": "A0A0D9SFJ6", "url": "https://www.uniprot.org/uniprot/A0A0D9SFJ6#function" }, { "database": "UniProtKB", "id": "ARBA00037611", "url": "https://www.uniprot.org/uniprot/ARBA00037611#function" }, { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215#function" }, { "database": "PubMed", "id": "24692546", "url": "https://glygen.org/publication/PubMed/24692546" }, { "database": "PubMed", "id": "2494176", "url": "https://glygen.org/publication/PubMed/2494176" }, { "database": "UniProtKB", "id": "A0A0R4J2F0", "url": "https://www.uniprot.org/uniprot/A0A0R4J2F0#function" }, { "database": "UniProtKB", "id": "A0A0D9SGA7", "url": "https://www.uniprot.org/uniprot/A0A0D9SGA7#function" }, { "database": "UniProtKB", "id": "A0A087WYZ4", "url": "https://www.uniprot.org/uniprot/A0A087WYZ4#function" } ] }, { "annotation": "The four human glycoprotein hormones chorionic gonadotropin (CG), luteinizing hormone (LH), follicle stimulating hormone (FSH), and thyroid stimulating hormone (TSH) are dimers consisting of alpha and beta subunits that are associated noncovalently. The alpha subunits of these hormones are identical, however, their beta chains are unique and confer biological specificity. The protein encoded by this gene is the alpha subunit and belongs to the glycoprotein hormones alpha chain family. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011].", "evidence": [ { "database": "RefSeq", "id": "NP_001239312", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239312" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs142907318", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142907318" }, { "id": "rs142907318", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142907318" }, { "id": "rs142907318", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs142907318" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 68, "end_pos": 68, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KKT->NKT).", "chr_id": "6", "chr_pos": "87086319", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K68", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs373317335", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373317335" }, { "id": "rs373317335", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373317335" }, { "id": "rs373317335", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs373317335" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 76, "end_pos": 76, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->IVT).", "chr_id": "6", "chr_pos": "87086296", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N76", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 76, "end_pos": 76, "sequence_org": "N", "sequence_mut": "D", "comment": "Increases from 1 to 3 the number of FSH binding a single FSHR receptor.", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" }, { "database": "PubMed", "id": "24692546", "url": "https://glygen.org/publication/PubMed/24692546" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "60.11", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000135346", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135346" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "41.27", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000135346", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135346" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "32.46", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000135346", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135346" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000135346", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135346" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "17.43", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000135346", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135346" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "41.06", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000135346", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135346" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000135346", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135346" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "41.86", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000135346", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135346" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "41.99", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000135346", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135346" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000135346", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135346" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "44.36", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000135346", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135346" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "57.81", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000135346", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135346" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "50.74", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000135346", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135346" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P01215", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01215" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P01215", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01215" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P01215", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01215" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P01215", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01215" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P01215", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01215" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P01215", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01215" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P01215", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01215" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P01215", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01215" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P01215", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01215" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P01215", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01215" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P01215", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01215" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P01215", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01215" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "common_name": "Human" } ], "gene": [ { "name": "CGA", "url": "https://www.uniprot.org/uniprot/P01215", "locus": { "chromosome": "6", "start_pos": 87085498, "end_pos": 87095106, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000135346", "url": "https://www.ensembl.org/id/ENSG00000135346" } ] } } ], "crossref": [ { "id": "ENSG00000135346", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135346", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "CHEMBL2146305", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2146305", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "CGA", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CGA", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "1081", "url": "https://www.ncbi.nlm.nih.gov/gene/1081", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "194", "url": "https://glyconnect.expasy.org/browser/proteins/194", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "1885", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=1885", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P01215", "url": "https://www.ebi.ac.uk/intact/interactors/id:P01215*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000476", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000476", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029034", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029034", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:1081", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:1081", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "118850", "url": "http://www.omim.org/entry/118850", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P01215", "url": "https://www.nextprot.org/entry/NX_P01215", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P01215", "url": "https://oglcnac.org/atlas/detail/P01215", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P01215", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01215", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "ATVMGNT", "url": "https://omabrowser.org/oma/group/ATVMGNT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4182331at2759", "url": "http://www.orthodb.org/?query=4182331at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11509", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11509", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11509:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11509:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1DZ7", "url": "https://www.rcsb.org/structure/1DZ7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1E9J", "url": "https://www.rcsb.org/structure/1E9J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1FL7", "url": "https://www.rcsb.org/structure/1FL7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1HCN", "url": "https://www.rcsb.org/structure/1HCN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1HD4", "url": "https://www.rcsb.org/structure/1HD4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1HRP", "url": "https://www.rcsb.org/structure/1HRP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1QFW", "url": "https://www.rcsb.org/structure/1QFW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1XWD", "url": "https://www.rcsb.org/structure/1XWD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4AY9", "url": "https://www.rcsb.org/structure/4AY9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4MQW", "url": "https://www.rcsb.org/structure/4MQW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FIG", "url": "https://www.rcsb.org/structure/7FIG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FIH", "url": "https://www.rcsb.org/structure/7FIH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FII", "url": "https://www.rcsb.org/structure/7FII", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7T9I", "url": "https://www.rcsb.org/structure/7T9I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7UTZ", "url": "https://www.rcsb.org/structure/7UTZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7XW5", "url": "https://www.rcsb.org/structure/7XW5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8I2G", "url": "https://www.rcsb.org/structure/8I2G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00236", "url": "http://pfam.xfam.org/family/PF00236", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P01215", "url": "https://pharos.nih.gov/targets/P01215", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000051640", "url": "https://proconsortium.org/app/entry/PR:000051640", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051641", "url": "https://proconsortium.org/app/entry/PR:000051641", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051642", "url": "https://proconsortium.org/app/entry/PR:000051642", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051643", "url": "https://proconsortium.org/app/entry/PR:000051643", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051644", "url": "https://proconsortium.org/app/entry/PR:000051644", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051645", "url": "https://proconsortium.org/app/entry/PR:000051645", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051646", "url": "https://proconsortium.org/app/entry/PR:000051646", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051647", "url": "https://proconsortium.org/app/entry/PR:000051647", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051648", "url": "https://proconsortium.org/app/entry/PR:000051648", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051649", "url": "https://proconsortium.org/app/entry/PR:000051649", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051650", "url": "https://proconsortium.org/app/entry/PR:000051650", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051651", "url": "https://proconsortium.org/app/entry/PR:000051651", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051652", "url": "https://proconsortium.org/app/entry/PR:000051652", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051653", "url": "https://proconsortium.org/app/entry/PR:000051653", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051654", "url": "https://proconsortium.org/app/entry/PR:000051654", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051655", "url": "https://proconsortium.org/app/entry/PR:000051655", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051656", "url": "https://proconsortium.org/app/entry/PR:000051656", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051657", "url": "https://proconsortium.org/app/entry/PR:000051657", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051658", "url": "https://proconsortium.org/app/entry/PR:000051658", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051659", "url": "https://proconsortium.org/app/entry/PR:000051659", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051660", "url": "https://proconsortium.org/app/entry/PR:000051660", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051661", "url": "https://proconsortium.org/app/entry/PR:000051661", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051662", "url": "https://proconsortium.org/app/entry/PR:000051662", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051663", "url": "https://proconsortium.org/app/entry/PR:000051663", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051664", "url": "https://proconsortium.org/app/entry/PR:000051664", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051665", "url": "https://proconsortium.org/app/entry/PR:000051665", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051666", "url": "https://proconsortium.org/app/entry/PR:000051666", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051667", "url": "https://proconsortium.org/app/entry/PR:000051667", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051668", "url": "https://proconsortium.org/app/entry/PR:000051668", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051669", "url": "https://proconsortium.org/app/entry/PR:000051669", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051670", "url": "https://proconsortium.org/app/entry/PR:000051670", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051671", "url": "https://proconsortium.org/app/entry/PR:000051671", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051672", "url": "https://proconsortium.org/app/entry/PR:000051672", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051673", "url": "https://proconsortium.org/app/entry/PR:000051673", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051674", "url": "https://proconsortium.org/app/entry/PR:000051674", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051675", "url": "https://proconsortium.org/app/entry/PR:000051675", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051676", "url": "https://proconsortium.org/app/entry/PR:000051676", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051677", "url": "https://proconsortium.org/app/entry/PR:000051677", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051678", "url": "https://proconsortium.org/app/entry/PR:000051678", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051679", "url": "https://proconsortium.org/app/entry/PR:000051679", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051680", "url": "https://proconsortium.org/app/entry/PR:000051680", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051681", "url": "https://proconsortium.org/app/entry/PR:000051681", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051682", "url": "https://proconsortium.org/app/entry/PR:000051682", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051683", "url": "https://proconsortium.org/app/entry/PR:000051683", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051684", "url": "https://proconsortium.org/app/entry/PR:000051684", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051685", "url": "https://proconsortium.org/app/entry/PR:000051685", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051686", "url": "https://proconsortium.org/app/entry/PR:000051686", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051687", "url": "https://proconsortium.org/app/entry/PR:000051687", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051688", "url": "https://proconsortium.org/app/entry/PR:000051688", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051689", "url": "https://proconsortium.org/app/entry/PR:000051689", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051690", "url": "https://proconsortium.org/app/entry/PR:000051690", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051691", "url": "https://proconsortium.org/app/entry/PR:000051691", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051692", "url": "https://proconsortium.org/app/entry/PR:000051692", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051693", "url": "https://proconsortium.org/app/entry/PR:000051693", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051694", "url": "https://proconsortium.org/app/entry/PR:000051694", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051695", "url": "https://proconsortium.org/app/entry/PR:000051695", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051696", "url": "https://proconsortium.org/app/entry/PR:000051696", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051697", "url": "https://proconsortium.org/app/entry/PR:000051697", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051698", "url": "https://proconsortium.org/app/entry/PR:000051698", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051699", "url": "https://proconsortium.org/app/entry/PR:000051699", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051700", "url": "https://proconsortium.org/app/entry/PR:000051700", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051701", "url": "https://proconsortium.org/app/entry/PR:000051701", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051702", "url": "https://proconsortium.org/app/entry/PR:000051702", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051703", "url": "https://proconsortium.org/app/entry/PR:000051703", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051704", "url": "https://proconsortium.org/app/entry/PR:000051704", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051705", "url": "https://proconsortium.org/app/entry/PR:000051705", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051706", "url": "https://proconsortium.org/app/entry/PR:000051706", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051707", "url": "https://proconsortium.org/app/entry/PR:000051707", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051708", "url": "https://proconsortium.org/app/entry/PR:000051708", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051709", "url": "https://proconsortium.org/app/entry/PR:000051709", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051710", "url": "https://proconsortium.org/app/entry/PR:000051710", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051711", "url": "https://proconsortium.org/app/entry/PR:000051711", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051712", "url": "https://proconsortium.org/app/entry/PR:000051712", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051713", "url": "https://proconsortium.org/app/entry/PR:000051713", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051714", "url": "https://proconsortium.org/app/entry/PR:000051714", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051715", "url": "https://proconsortium.org/app/entry/PR:000051715", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051716", "url": "https://proconsortium.org/app/entry/PR:000051716", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051717", "url": "https://proconsortium.org/app/entry/PR:000051717", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051718", "url": "https://proconsortium.org/app/entry/PR:000051718", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051719", "url": "https://proconsortium.org/app/entry/PR:000051719", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051720", "url": "https://proconsortium.org/app/entry/PR:000051720", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051721", "url": "https://proconsortium.org/app/entry/PR:000051721", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051722", "url": "https://proconsortium.org/app/entry/PR:000051722", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P01215", "url": "http://purl.obolibrary.org/obo/PR_P01215", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-193048", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193048", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-193993", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193993", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-209822", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-209822", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-209968", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-209968", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-375281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375281", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-975578", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975578", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001239312", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239312", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P01215", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "A0A087WYZ4", "url": "https://www.uniprot.org/uniprot/A0A087WYZ4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WYZ4-1", "url": "https://www.uniprot.org/uniprot/A0A087WYZ4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0D9SFJ6", "url": "https://www.uniprot.org/uniprot/A0A0D9SFJ6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0D9SFJ6-1", "url": "https://www.uniprot.org/uniprot/A0A0D9SFJ6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0D9SGA7", "url": "https://www.uniprot.org/uniprot/A0A0D9SGA7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0D9SGA7-1", "url": "https://www.uniprot.org/uniprot/A0A0D9SGA7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0R4J2F0", "url": "https://www.uniprot.org/uniprot/A0A0R4J2F0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0R4J2F0-1", "url": "https://www.uniprot.org/uniprot/A0A0R4J2F0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01215-1", "url": "https://www.uniprot.org/uniprot/P01215-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS", "length": 116, "header": "sp|P01215-1|GLHA_HUMAN Isoform 1 of Glycoprotein hormones alpha chain OS=Homo sapiens OX=9606 GN=CGA PE=1 SV=1 CANONICAL=P01215-1" }, "isoforms": [ { "isoform_ac": "A0A087WYZ4-1", "url": "", "sequence": { "sequence": "MDYYRKYAAIFLVTLSVFLHVLHSAPDVQETGFHHVAQAALKLLSSSNPPTKASQSARITDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS", "length": 147, "header": "tr|A0A087WYZ4-1|A0A087WYZ4_HUMAN Computationally mapped isoform of Glycoprotein hormones alpha chain OS=Homo sapiens OX=9606 GN=CGA PE=1 SV=1 CANONICAL=P01215-1" }, "locus": { "chromosome": "6", "start_pos": 87088200, "end_pos": 87085759, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000610310.3", "url": "https://www.ensembl.org/id/ENST00000610310.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000482232.1", "url": "https://www.ensembl.org/id/ENSP00000482232.1" } ] } }, { "isoform_ac": "A0A0D9SFJ6-1", "url": "", "sequence": { "sequence": "MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYP", "length": 62, "header": "tr|A0A0D9SFJ6-1|GLHA_HUMAN Computationally mapped isoform of Glycoprotein hormones alpha chain OS=Homo sapiens OX=9606 GN=CGA PE=1 SV=1 CANONICAL=P01215-1" }, "locus": { "chromosome": "6", "start_pos": 87088200, "end_pos": 87086337, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000625577.1", "url": "https://www.ensembl.org/id/ENST00000625577.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000486666.1", "url": "https://www.ensembl.org/id/ENSP00000486666.1" } ] } }, { "isoform_ac": "A0A0D9SGA7-1", "url": "", "sequence": { "sequence": "MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVRTSRSPEAF", "length": 101, "header": "tr|A0A0D9SGA7-1|A0A0D9SGA7_HUMAN Computationally mapped isoform of Glycoprotein hormones alpha chain OS=Homo sapiens OX=9606 GN=CGA PE=1 SV=1 CANONICAL=P01215-1" }, "locus": { "chromosome": "6", "start_pos": 87088200, "end_pos": 87086220, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000630630.2", "url": "https://www.ensembl.org/id/ENST00000630630.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000487300.1", "url": "https://www.ensembl.org/id/ENSP00000487300.1" } ] } }, { "isoform_ac": "A0A0R4J2F0-1", "url": "", "sequence": { "sequence": "MQLSFWSHCRCFCMFSIPLLMCRVRDQICDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS", "length": 116, "header": "tr|A0A0R4J2F0-1|A0A0R4J2F0_HUMAN Computationally mapped isoform of Glycoprotein hormones alpha chain OS=Homo sapiens OX=9606 GN=CGA PE=1 SV=1 CANONICAL=P01215-1" }, "locus": { "chromosome": "6", "start_pos": 87088181, "end_pos": 87085759, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000369582.6", "url": "https://www.ensembl.org/id/ENST00000369582.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000358595.3", "url": "https://www.ensembl.org/id/ENSP00000358595.3" } ] } }, { "isoform_ac": "P01215-1", "url": "", "sequence": { "sequence": "MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS", "length": 116, "header": "sp|P01215-1|GLHA_HUMAN Isoform 1 of Glycoprotein hormones alpha chain OS=Homo sapiens OX=9606 GN=CGA PE=1 SV=1 CANONICAL=P01215-1" }, "locus": { "chromosome": "6", "start_pos": 87088200, "end_pos": 87085759, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000627148.3", "url": "https://www.ensembl.org/id/ENST00000627148.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000486024.1", "url": "https://www.ensembl.org/id/ENSP00000486024.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G04077XA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1457969", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1457969" } ] }, { "glytoucan_ac": "G06209KS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" } ] }, { "glytoucan_ac": "G08185DV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1457969", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1457969" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" } ] }, { "glytoucan_ac": "G10258MC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G14047PA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G14358WN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1457969", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1457969" } ] }, { "glytoucan_ac": "G14996IQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G14998UC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G16828VN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" } ] }, { "glytoucan_ac": "G24413UY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G24835MQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" } ] }, { "glytoucan_ac": "G24954RW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1457969", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1457969" } ] }, { "glytoucan_ac": "G25835MT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G26403SG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" } ] }, { "glytoucan_ac": "G29857RC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" } ] }, { "glytoucan_ac": "G36191CD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" } ] }, { "glytoucan_ac": "G38217AM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1457969", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1457969" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" } ] }, { "glytoucan_ac": "G39540XG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G40671AG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" } ] }, { "glytoucan_ac": "G41708PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1457969", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1457969" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" } ] }, { "glytoucan_ac": "G43346PX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G43664YB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" } ] }, { "glytoucan_ac": "G46422KL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" } ] }, { "glytoucan_ac": "G49743VF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G51367TM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" } ] }, { "glytoucan_ac": "G53933HU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G53962WT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" } ] }, { "glytoucan_ac": "G53985AY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G54612UD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" } ] }, { "glytoucan_ac": "G56271TF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G56345UO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" } ] }, { "glytoucan_ac": "G57196QI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" } ] }, { "glytoucan_ac": "G65890UA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" } ] }, { "glytoucan_ac": "G69411IG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" } ] }, { "glytoucan_ac": "G77198CF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1457969", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1457969" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" } ] }, { "glytoucan_ac": "G77252PU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" } ] }, { "glytoucan_ac": "G78890OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G81198YO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" } ] }, { "glytoucan_ac": "G83951ZY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" } ] }, { "glytoucan_ac": "G84467IZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G86357DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" } ] }, { "glytoucan_ac": "G91365ZQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G93284HQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" } ] }, { "glytoucan_ac": "G96921ZU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G99897FQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1457969", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1457969" }, { "id": "P01215", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01215#ptm_processing" }, { "id": "15662415", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15662415" }, { "id": "4MQW", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MQW" }, { "id": "24692546", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24692546" }, { "id": "1E9J", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1E9J" }, { "id": "1FL7", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1FL7" }, { "id": "1HCN", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1HCN" }, { "id": "1HD4", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1HD4" }, { "id": "1HRP", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1HRP" }, { "id": "1QFW", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1QFW" }, { "id": "1XWD", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1XWD" }, { "id": "4AY9", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4AY9" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06209KS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" } ] }, { "glytoucan_ac": "G08185DV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1457969", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1457969" } ] }, { "glytoucan_ac": "G10258MC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: ASN-76", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G11870QZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14047PA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G14358WN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1457969", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1457969" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" } ] }, { "glytoucan_ac": "G14996IQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G14998UC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: ASN-76", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G16758MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "16834341", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16834341" } ] }, { "glytoucan_ac": "G16828VN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" } ] }, { "glytoucan_ac": "G24131KD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "16834341", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16834341" } ] }, { "glytoucan_ac": "G24413UY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: ASN-76", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G24835MQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" } ] }, { "glytoucan_ac": "G24954RW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1457969", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1457969" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" } ] }, { "glytoucan_ac": "G25835MT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "ASN-76 ; ASN-76", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G26403SG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" } ] }, { "glytoucan_ac": "G29857RC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" } ] }, { "glytoucan_ac": "G31372JR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "16834341", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16834341" } ] }, { "glytoucan_ac": "G36191CD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" } ] }, { "glytoucan_ac": "G38217AM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1457969", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1457969" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G39540XG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "ASN-76 ; ASN-76", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G39917RN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "16834341", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16834341" } ] }, { "glytoucan_ac": "G40671AG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" } ] }, { "glytoucan_ac": "G41708PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1457969", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1457969" } ] }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "16834341", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16834341" } ] }, { "glytoucan_ac": "G42826YI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "16834341", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16834341" } ] }, { "glytoucan_ac": "G43346PX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "ASN-76 AND ASN-102 ; ASN-76 AND ASN-102", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G43664YB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" } ] }, { "glytoucan_ac": "G44659VQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "16834341", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16834341" } ] }, { "glytoucan_ac": "G46422KL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" } ] }, { "glytoucan_ac": "G49743VF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "ASN-76 AND ASN-102", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G51367TM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" } ] }, { "glytoucan_ac": "G53933HU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "ASN-76 ; ASN-76", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G53962WT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "ASN-76 AND ASN-102", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G53985AY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "ASN-76 ; ASN-76", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G54612UD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" } ] }, { "glytoucan_ac": "G55504WE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "16834341", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16834341" } ] }, { "glytoucan_ac": "G56271TF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "ASN-76 AND ASN-102 ; ASN-76 AND ASN-102", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G56345UO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" } ] }, { "glytoucan_ac": "G57196QI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" } ] }, { "glytoucan_ac": "G65890UA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "1457969", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1457969" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G69411IG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" } ] }, { "glytoucan_ac": "G77198CF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1457969", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1457969" } ] }, { "glytoucan_ac": "G77252PU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: ASN-76", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" } ] }, { "glytoucan_ac": "G78890OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G80678MA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "16834341", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16834341" } ] }, { "glytoucan_ac": "G81198YO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" } ] }, { "glytoucan_ac": "G83951ZY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" } ] }, { "glytoucan_ac": "G84467IZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: ASN-76", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G86357DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" } ] }, { "glytoucan_ac": "G91365ZQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G93284HQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-102", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" } ] }, { "glytoucan_ac": "G96921ZU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "ASN-76 AND ASN-102 ; ASN-76 AND ASN-102", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "G97028UT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "16834341", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16834341" } ] }, { "glytoucan_ac": "G99897FQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "ASN-76 AND ASN-102 ; ASN-76 AND ASN-102", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "1991473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1991473" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "1457969", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1457969" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "16834341", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16834341" }, { "id": "P01215", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01215#ptm_processing" }, { "id": "15662415", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15662415" }, { "id": "4MQW", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MQW" }, { "id": "24692546", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24692546" }, { "id": "1E9J", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1E9J" }, { "id": "1FL7", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1FL7" }, { "id": "1HCN", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1HCN" }, { "id": "1HRP", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1HRP" }, { "id": "1QFW", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1QFW" }, { "id": "1XWD", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1XWD" }, { "id": "4AY9", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4AY9" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "NVTSESTCCVAK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 76, "start_aa": "Asn", "end_pos": 87, "end_aa": "Lys", "evidence": [ { "id": "P01215", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 78, "start_aa": "Thr", "end_pos": 78, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr78", "evidence": [ { "id": "P01215", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01215" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 81, "start_aa": "Ser", "end_pos": 81, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser81", "evidence": [ { "id": "P01215", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01215" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "P01215", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P01215" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "3335536", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3335536" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" } ] }, { "glytoucan_ac": "G01614ZM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "3335536", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3335536" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "165", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/165" }, { "id": "2121479", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2121479" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" } ] }, { "glytoucan_ac": "G11457RF", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "3335536", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3335536" } ] }, { "glytoucan_ac": "G12398HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" }, { "id": "6643471", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6643471" } ] }, { "glytoucan_ac": "G14996IQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "165", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/165" }, { "id": "2121479", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2121479" } ] }, { "glytoucan_ac": "G16155TD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "165", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/165" }, { "id": "2121479", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2121479" } ] }, { "glytoucan_ac": "G16828VN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" } ] }, { "glytoucan_ac": "G17689DH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "165", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/165" }, { "id": "2121479", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2121479" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" }, { "id": "6643471", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6643471" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "165", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/165" }, { "id": "2121479", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2121479" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" } ] }, { "glytoucan_ac": "G23453IV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" }, { "id": "6643471", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6643471" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" }, { "id": "6643471", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6643471" } ] }, { "glytoucan_ac": "G25520XG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" } ] }, { "glytoucan_ac": "G29857RC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" }, { "id": "6643471", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6643471" } ] }, { "glytoucan_ac": "G29880MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" }, { "id": "6643471", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6643471" } ] }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "3335536", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3335536" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" } ] }, { "glytoucan_ac": "G33609NS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" } ] }, { "glytoucan_ac": "G36191CD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" }, { "id": "6643471", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6643471" } ] }, { "glytoucan_ac": "G43664YB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" }, { "id": "6643471", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6643471" } ] }, { "glytoucan_ac": "G45209NR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "165", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/165" }, { "id": "2121479", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2121479" } ] }, { "glytoucan_ac": "G45560HM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "165", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/165" }, { "id": "2121479", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2121479" } ] }, { "glytoucan_ac": "G46748BU", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "3335536", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3335536" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "165", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/165" }, { "id": "2121479", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2121479" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "165", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/165" }, { "id": "2121479", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2121479" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" }, { "id": "6643471", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6643471" } ] }, { "glytoucan_ac": "G51367TM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" } ] }, { "glytoucan_ac": "G52428MJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" }, { "id": "6643471", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6643471" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "165", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/165" }, { "id": "2121479", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2121479" } ] }, { "glytoucan_ac": "G52934AK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" } ] }, { "glytoucan_ac": "G53962WT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" } ] }, { "glytoucan_ac": "G56318NV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "165", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/165" }, { "id": "2121479", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2121479" } ] }, { "glytoucan_ac": "G56682BC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "3335536", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3335536" } ] }, { "glytoucan_ac": "G59970QL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "3335536", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3335536" } ] }, { "glytoucan_ac": "G60890ZT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "3335536", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3335536" } ] }, { "glytoucan_ac": "G63628AV", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "3335536", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3335536" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" } ] }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "3335536", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3335536" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" } ] }, { "glytoucan_ac": "G65562ZE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "3335536", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3335536" } ] }, { "glytoucan_ac": "G65890UA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" } ] }, { "glytoucan_ac": "G66088HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "165", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/165" }, { "id": "2121479", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2121479" } ] }, { "glytoucan_ac": "G69411IG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" }, { "id": "6643471", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6643471" } ] }, { "glytoucan_ac": "G69834CE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "165", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/165" }, { "id": "2121479", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2121479" } ] }, { "glytoucan_ac": "G70375MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" } ] }, { "glytoucan_ac": "G72735IY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" }, { "id": "6643471", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6643471" } ] }, { "glytoucan_ac": "G74645FT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" } ] }, { "glytoucan_ac": "G74722FL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "3335536", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3335536" } ] }, { "glytoucan_ac": "G77252PU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "165", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/165" }, { "id": "2121479", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2121479" }, { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" } ] }, { "glytoucan_ac": "G78030KJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "165", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/165" }, { "id": "2121479", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2121479" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" }, { "id": "6643471", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6643471" } ] }, { "glytoucan_ac": "G78790NZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" } ] }, { "glytoucan_ac": "G79568CQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" } ] }, { "glytoucan_ac": "G81006GJ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "3335536", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3335536" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" } ] }, { "glytoucan_ac": "G86357DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" }, { "id": "6643471", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6643471" } ] }, { "glytoucan_ac": "G91413ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "165", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/165" }, { "id": "2121479", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2121479" } ] }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" } ] }, { "glytoucan_ac": "G93284HQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "194", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/194" }, { "id": "8026573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8026573" } ] }, { "glytoucan_ac": "G94531EZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "165", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/165" }, { "id": "2121479", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2121479" } ] }, { "glytoucan_ac": "G95898GD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" } ] }, { "glytoucan_ac": "G98366ZJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "165", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/165" }, { "id": "2121479", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2121479" } ] } ], "phosphorylation": [ { "start_pos": 63, "end_pos": 63, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P01215", "url": "http://phospho.elm.eu.org/byAccession/P01215.html" }, { "database": "iPTMnet", "id": "P01215", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01215" }, { "database": "PubMed", "id": "2466636", "url": "https://glygen.org/publication/PubMed/2466636" } ], "site_lbl": "Thr63" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology", "journal": "EMBO J", "date": "2013", "authors": "Steentoft C., Vakhrushev S.Y., Joshi H.J., Kong Y., Vester-Christensen M.B., Schjoldager K.T., Lavrsen K., Dabelsteen S., Pedersen N.B., Marcos-Silva L., Gupta R., Bennett E.P., Mandel U., Brunak S., Wandall H.H., Levery S.B., Clausen H.", "evidence": [ { "database": "UniCarbKB", "id": "P01215", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1038/emboj.2013.79", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "title": "Spectrum of mutations in fucosidosis.", "journal": "European journal of human genetics : EJHG", "date": "1999", "authors": "Willems PJ, Seo HC, Coucke P, Tonlorenzi R, O'Brien JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-975578", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975578" } ], "reference": [ { "type": "PubMed", "id": "10094192", "url": "https://glygen.org/publication/PubMed/10094192" } ] }, { "title": "Mapping of the alpha-1,6-fucosyltransferase gene, FUT8, to human chromosome 14q24.3.", "journal": "Cytogenetics and cell genetics", "date": "1999", "authors": "Yamaguchi Y, Fujii J, Inoue S, Uozumi N, Yanagidani S, Ikeda Y, Egashira M, Miyoshi O, Niikawa N, Taniguchi N", "evidence": [ { "database": "Reactome", "id": "R-HSA-975578", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975578" } ], "reference": [ { "type": "PubMed", "id": "10343104", "url": "https://glygen.org/publication/PubMed/10343104" } ] }, { "title": "Molecular modeling of human P450c17 (17alpha-hydroxylase/17,20-lyase): insights into reaction mechanisms and effects of mutations.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1999", "authors": "Auchus RJ, Miller WL", "evidence": [ { "database": "Reactome", "id": "R-HSA-193048", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193048" } ], "reference": [ { "type": "PubMed", "id": "10406467", "url": "https://glygen.org/publication/PubMed/10406467" } ] }, { "title": "Structure and function of HNK-1 sulfotransferase. Identification of donor and acceptor binding sites by site-directed mutagenesis.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Ong E, Yeh JC, Ding Y, Hindsgaul O, Pedersen LC, Negishi M, Fukuda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-975578", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975578" } ], "reference": [ { "type": "PubMed", "id": "10464296", "url": "https://glygen.org/publication/PubMed/10464296" } ] }, { "title": "AP2alpha and AP2gamma: a comparison of binding site specificity and trans-activation of the estrogen receptor promoter and single site promoter constructs.", "journal": "Nucleic acids research", "date": "1999", "authors": "McPherson LA, Weigel RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "10497269", "url": "https://glygen.org/publication/PubMed/10497269" } ] }, { "title": "AP-2 family members regulate basal and cAMP-induced expression of human chorionic gonadotropin.", "journal": "Nucleic acids research", "date": "2000", "authors": "LiCalsi C, Christophe S, Steger DJ, Buescher M, Fischer W, Mellon PL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "10648798", "url": "https://glygen.org/publication/PubMed/10648798" } ] }, { "title": "Genomic structure and promoter analysis of the human alpha1, 6-fucosyltransferase gene (FUT8).", "journal": "Glycobiology", "date": "2000", "authors": "Yamaguchi Y, Ikeda Y, Takahashi T, Ihara H, Tanaka T, Sasho C, Uozumi N, Yanagidani S, Inoue S, Fujii J, Taniguchi N", "evidence": [ { "database": "Reactome", "id": "R-HSA-975578", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975578" } ], "reference": [ { "type": "PubMed", "id": "10814706", "url": "https://glygen.org/publication/PubMed/10814706" } ] }, { "title": "Molecular cloning and expression of the pituitary glycoprotein hormone N-acetylgalactosamine-4-O-sulfotransferase.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Xia G, Evers MR, Kang HG, Schachner M, Baenziger JU", "evidence": [ { "database": "Reactome", "id": "R-HSA-975578", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975578" } ], "reference": [ { "type": "PubMed", "id": "10988300", "url": "https://glygen.org/publication/PubMed/10988300" } ] }, { "title": "Src tyrosine kinase is a novel direct effector of G proteins.", "journal": "Cell", "date": "2000", "authors": "Ma YC, Huang J, Ali S, Lowry W, Huang XY", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "11007482", "url": "https://glygen.org/publication/PubMed/11007482" } ] }, { "title": "Molecular cloning and expression of two distinct human N-acetylgalactosamine 4-O-sulfotransferases that transfer sulfate to GalNAc beta 1-->4GlcNAc beta 1-->R in both N- and O-glycans.", "journal": "Glycobiology", "date": "2001", "authors": "Hiraoka N, Misra A, Belot F, Hindsgaul O, Fukuda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-975578", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975578" } ], "reference": [ { "type": "PubMed", "id": "11445554", "url": "https://glygen.org/publication/PubMed/11445554" } ] }, { "title": "The amino acid sequence of human chorionic gonadotropin. The alpha subunit and beta subunit.", "journal": "J. Biol. Chem.", "date": "1975", "authors": "Morgan FJ, Birken S, Canfield RE", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "reference": [ { "type": "PubMed", "id": "1150658", "url": "https://glygen.org/publication/PubMed/1150658" } ] }, { "title": "Tyrosine cross-linking of extracellular matrix is catalyzed by Duox, a multidomain oxidase/peroxidase with homology to the phagocyte oxidase subunit gp91phox.", "journal": "The Journal of cell biology", "date": "2001", "authors": "Edens WA, Sharling L, Cheng G, Shapira R, Kinkade JM, Lee T, Edens HA, Tang X, Sullards C, Flaherty DB, Benian GM, Lambeth JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-209968", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-209968" } ], "reference": [ { "type": "PubMed", "id": "11514595", "url": "https://glygen.org/publication/PubMed/11514595" } ] }, { "title": "Primary amino acid sequence of follicle-stimulating hormone from human pituitary glands. I. alpha subunit.", "journal": "J. Biol. Chem.", "date": "1975", "authors": "Rathnam P, Saxena BB", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "reference": [ { "type": "PubMed", "id": "1158880", "url": "https://glygen.org/publication/PubMed/1158880" } ] }, { "title": "The genes encoding the type II gonadotropin-releasing hormone receptor and the ribonucleoprotein RBM8A in humans overlap in two genomic loci.", "journal": "Genomics", "date": "2001", "authors": "Faurholm B, Millar RP, Katz AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-375281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375281" } ], "reference": [ { "type": "PubMed", "id": "11707068", "url": "https://glygen.org/publication/PubMed/11707068" } ] }, { "title": "Structure-function studies of linear and cyclized peptide antagonists of the GnRH receptor.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Beckers T, Bernd M, Kutscher B, Kuhne R, Hoffmann S, Reissmann T", "evidence": [ { "database": "Reactome", "id": "R-HSA-375281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375281" } ], "reference": [ { "type": "PubMed", "id": "11726197", "url": "https://glygen.org/publication/PubMed/11726197" } ] }, { "title": "Human pituitary lutropin. Isolation, properties, and the complete amino acid sequence of the beta-subunit.", "journal": "Biochimica et biophysica acta", "date": "1975", "authors": "Sairam MR, Li CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-209822", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-209822" } ], "reference": [ { "type": "PubMed", "id": "1191677", "url": "https://glygen.org/publication/PubMed/1191677" } ] }, { "title": "Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Feldman DS, Zamah AM, Pierce KL, Miller WE, Kelly F, Rapacciuolo A, Rockman HA, Koch WJ, Luttrell LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "12036966", "url": "https://glygen.org/publication/PubMed/12036966" } ] }, { "title": "Structural determinants in the second intracellular loop of the human follicle-stimulating hormone receptor are involved in G(s) protein activation.", "journal": "Molecular and cellular endocrinology", "date": "2002", "authors": "Timossi C, Maldonado D, Vizcaino A, Lindau-Shepard B, Conn PM, Ulloa-Aguirre A", "evidence": [ { "database": "Reactome", "id": "R-HSA-375281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375281" } ], "reference": [ { "type": "PubMed", "id": "12039074", "url": "https://glygen.org/publication/PubMed/12039074" } ] }, { "title": "Thyrostimulin, a heterodimer of two new human glycoprotein hormone subunits, activates the thyroid-stimulating hormone receptor.", "journal": "The Journal of clinical investigation", "date": "2002", "authors": "Nakabayashi K, Matsumi H, Bhalla A, Bae J, Mosselman S, Hsu SY, Hsueh AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-375281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375281" } ], "reference": [ { "type": "PubMed", "id": "12045258", "url": "https://glygen.org/publication/PubMed/12045258" } ] }, { "title": "Mechanism of Galpha i-mediated inhibition of type V adenylyl cyclase.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Dessauer CW, Chen-Goodspeed M, Chen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "12058044", "url": "https://glygen.org/publication/PubMed/12058044" } ] }, { "title": "Similarities and differences in the coupling of human beta1- and beta2-adrenoceptors to Gs(alpha) splice variants.", "journal": "Biochemical pharmacology", "date": "2002", "authors": "Wenzel-Seifert K, Liu HY, Seifert R", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "12106601", "url": "https://glygen.org/publication/PubMed/12106601" } ] }, { "title": "The pharmacology of cilostazol.", "journal": "Diabetes, obesity & metabolism", "date": "2002", "authors": "Schror K", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "12180353", "url": "https://glygen.org/publication/PubMed/12180353" } ] }, { "title": "Mice with a homozygous deletion of the Mgat2 gene encoding UDP-N-acetylglucosamine:alpha-6-D-mannoside beta1,2-N-acetylglucosaminyltransferase II: a model for congenital disorder of glycosylation type IIa.", "journal": "Biochimica et biophysica acta", "date": "2002", "authors": "Wang Y, Schachter H, Marth JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-975578", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975578" } ], "reference": [ { "type": "PubMed", "id": "12417412", "url": "https://glygen.org/publication/PubMed/12417412" } ] }, { "title": "Finasteride for benign prostatic hyperplasia.", "journal": "American family physician", "date": "1992", "authors": "Hasinski S, Miller JL, Rose LI", "evidence": [ { "database": "Reactome", "id": "R-HSA-193048", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193048" } ], "reference": [ { "type": "PubMed", "id": "1279965", "url": "https://glygen.org/publication/PubMed/1279965" } ] }, { "title": "Structure/function relationships responsible for coenzyme specificity and the isomerase activity of human type 1 3 beta-hydroxysteroid dehydrogenase/isomerase.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Thomas JL, Duax WL, Addlagatta A, Brandt S, Fuller RR, Norris W", "evidence": [ { "database": "Reactome", "id": "R-HSA-193993", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193993" } ], "reference": [ { "type": "PubMed", "id": "12832414", "url": "https://glygen.org/publication/PubMed/12832414" } ] }, { "title": "Characterization of the 5-HT6 receptor coupled to Ca2+ signaling using an enabling chimeric G-protein.", "journal": "European journal of pharmacology", "date": "2003", "authors": "Zhang JY, Nawoschik S, Kowal D, Smith D, Spangler T, Ochalski R, Schechter L, Dunlop J", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "12860470", "url": "https://glygen.org/publication/PubMed/12860470" } ] }, { "title": "Cloning, sequencing, and expression of human gonadotropin releasing hormone (GnRH) receptor.", "journal": "Biochemical and biophysical research communications", "date": "1992", "authors": "Kakar SS, Musgrove LC, Devor DC, Sellers JC, Neill JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-375281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375281" } ], "reference": [ { "type": "PubMed", "id": "1333190", "url": "https://glygen.org/publication/PubMed/1333190" } ] }, { "title": "Fractionation and characterization of a cyclic adenine ribonucleotide formed by tissue particles.", "journal": "The Journal of biological chemistry", "date": "1958", "authors": "SUTHERLAND EW, RALL TW", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "13549488", "url": "https://glygen.org/publication/PubMed/13549488" } ] }, { "title": "The asparagine-linked oligosaccharides at individual glycosylation sites in human thyrotrophin.", "journal": "Glycobiology", "date": "1992", "authors": "Hiyama J, Weisshaar G, Renwick AG", "evidence": [ { "database": "UniCarbKB", "id": "P01215", "url": "" } ], "reference": [ { "type": "PubMed", "id": "1457969", "url": "https://glygen.org/publication/PubMed/1457969" } ] }, { "title": "Insights into G protein structure, function, and regulation.", "journal": "Endocrine reviews", "date": "2003", "authors": "Cabrera-Vera TM, Vanhauwe J, Thomas TO, Medkova M, Preininger A, Mazzoni MR, Hamm HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "14671004", "url": "https://glygen.org/publication/PubMed/14671004" } ] }, { "title": "Activator protein 2alpha inhibits tumorigenicity and represses vascular endothelial growth factor transcription in prostate cancer cells.", "journal": "Cancer research", "date": "2004", "authors": "Ruiz M, Pettaway C, Song R, Stoeltzing O, Ellis L, Bar-Eli M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "14744778", "url": "https://glygen.org/publication/PubMed/14744778" } ] }, { "title": "Beta-arrestin2, a novel member of the arrestin/beta-arrestin gene family.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Attramadal H, Arriza JL, Aoki C, Dawson TM, Codina J, Kwatra MM, Snyder SH, Caron MG, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "1517224", "url": "https://glygen.org/publication/PubMed/1517224" } ] }, { "title": "Abnormal biantennary sugar chains are expressed in human chorionic gonadotropin produced in the choriocarcinoma cell line, JEG-3.", "journal": "Glycoconjugate journal", "date": "2004", "authors": "Takamatsu S, Katsumata T, Inoue N, Watanabe T, Fujibayashi Y, Takeuchi M", "evidence": [ { "database": "GlyConnect", "id": "88", "url": "https://glyconnect.expasy.org/browser/proteins/88" } ], "reference": [ { "type": "PubMed", "id": "15316280", "url": "https://glygen.org/publication/PubMed/15316280" } ] }, { "title": "Structure of human follicle-stimulating hormone in complex with its receptor.", "journal": "Nature", "date": "2005", "authors": "Fan QR, Hendrickson WA", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215#ptm_processing" }, { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "reference": [ { "type": "PubMed", "id": "15662415", "url": "https://glygen.org/publication/PubMed/15662415" } ] }, { "title": "Effects of piclamilast, a selective phosphodiesterase-4 inhibitor, on oxidative burst of sputum cells from mild asthmatics and stable COPD patients.", "journal": "Lung", "date": "2004", "authors": "Beeh KM, Beier J, Lerch C, Schulz AK, Buhl R", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "15765929", "url": "https://glygen.org/publication/PubMed/15765929" } ] }, { "title": "Cyclic nucleotide phosphodiesterase-mediated integration of cGMP and cAMP signaling in cells of the cardiovascular system.", "journal": "Frontiers in bioscience : a journal and virtual library", "date": "2005", "authors": "Maurice DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "15769620", "url": "https://glygen.org/publication/PubMed/15769620" } ] }, { "title": "Yin Yang 1 cooperates with activator protein 2 to stimulate ERBB2 gene expression in mammary cancer cells.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Begon DY, Delacroix L, Vernimmen D, Jackers P, Winkler R", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "15870067", "url": "https://glygen.org/publication/PubMed/15870067" } ] }, { "title": "The GAPs, GEFs, and GDIs of heterotrimeric G-protein alpha subunits.", "journal": "International journal of biological sciences", "date": "2005", "authors": "Siderovski DP, Willard FS", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "15951850", "url": "https://glygen.org/publication/PubMed/15951850" } ] }, { "title": "Dual oxidase-2 has an intrinsic Ca2+-dependent H2O2-generating activity.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Ameziane-El-Hassani R, Morand S, Boucher JL, Frapart YM, Apostolou D, Agnandji D, Gnidehou S, Ohayon R, Noel-Hudson MS, Francon J, Lalaoui K, Virion A, Dupuy C", "evidence": [ { "database": "Reactome", "id": "R-HSA-209968", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-209968" } ], "reference": [ { "type": "PubMed", "id": "15972824", "url": "https://glygen.org/publication/PubMed/15972824" } ] }, { "title": "Expression of beta-subunit of HCG genes during normal and failed pregnancy.", "journal": "Human reproduction (Oxford, England)", "date": "2005", "authors": "Rull K, Laan M", "evidence": [ { "database": "Reactome", "id": "R-HSA-209822", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-209822" } ], "reference": [ { "type": "PubMed", "id": "16123088", "url": "https://glygen.org/publication/PubMed/16123088" } ] }, { "title": "Preferential inhibition of human phosphodiesterase 4 by ibudilast.", "journal": "Life sciences", "date": "2006", "authors": "Huang Z, Liu S, Zhang L, Salem M, Greig GM, Chan CC, Natsumeda Y, Noguchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "16313925", "url": "https://glygen.org/publication/PubMed/16313925" } ] }, { "title": "The role of O-linked and N-linked oligosaccharides on the structure-function of glycoprotein hormones: development of agonists and antagonists.", "journal": "Biochimica et biophysica acta", "date": "2006", "authors": "Fares F", "evidence": [ { "database": "Reactome", "id": "R-HSA-209822", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-209822" } ], "reference": [ { "type": "PubMed", "id": "16527410", "url": "https://glygen.org/publication/PubMed/16527410" } ] }, { "title": "G-protein-coupled receptor kinase specificity for beta-arrestin recruitment to the beta2-adrenergic receptor revealed by fluorescence resonance energy transfer.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Violin JD, Ren XR, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "16687412", "url": "https://glygen.org/publication/PubMed/16687412" } ] }, { "title": "Essential and mutually compensatory roles of {alpha}-mannosidase II and {alpha}-mannosidase IIx in N-glycan processing in vivo in mice.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Akama TO, Nakagawa H, Wong NK, Sutton-Smith M, Dell A, Morris HR, Nakayama J, Nishimura S, Pai A, Moremen KW, Marth JD, Fukuda MN", "evidence": [ { "database": "Reactome", "id": "R-HSA-975578", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975578" } ], "reference": [ { "type": "PubMed", "id": "16754854", "url": "https://glygen.org/publication/PubMed/16754854" } ] }, { "title": "Comparative glycomics of the glycoprotein follicle stimulating hormone: glycopeptide analysis of isolates from two mammalian species.", "journal": "Biochemistry", "date": "2006", "authors": "Dalpathado DS, Irungu J, Go EP, Butnev VY, Norton K, Bousfield GR, Desaire H", "evidence": [ { "database": "UniCarbKB", "id": "P01215", "url": "" } ], "reference": [ { "type": "PubMed", "id": "16834341", "url": "https://glygen.org/publication/PubMed/16834341" } ] }, { "title": "Role of disulfide bond formation in the folding of human chorionic gonadotropin beta subunit into an alpha beta dimer assembly-competent form.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Beebe JS, Mountjoy K, Krzesicki RF, Perini F, Ruddon RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-209822", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-209822" } ], "reference": [ { "type": "PubMed", "id": "1688430", "url": "https://glygen.org/publication/PubMed/1688430" } ] }, { "title": "Cloning and characterization of a novel isoform of iodotyrosine dehalogenase 1 (DEHAL1) DEHAL1C from human thyroid: comparisons with DEHAL1 and DEHAL1B.", "journal": "Thyroid : official journal of the American Thyroid Association", "date": "2006", "authors": "Gnidehou S, Lacroix L, Sezan A, Ohayon R, Noel-Hudson MS, Morand S, Francon J, Courtin F, Virion A, Dupuy C", "evidence": [ { "database": "Reactome", "id": "R-HSA-209968", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-209968" } ], "reference": [ { "type": "PubMed", "id": "16910871", "url": "https://glygen.org/publication/PubMed/16910871" } ] }, { "title": "Structural basis of function in heterotrimeric G proteins.", "journal": "Quarterly reviews of biophysics", "date": "2006", "authors": "Oldham WM, Hamm HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "16923326", "url": "https://glygen.org/publication/PubMed/16923326" } ] }, { "title": "Cloning and sequencing of human FSH receptor cDNA.", "journal": "Biochemical and biophysical research communications", "date": "1991", "authors": "Minegishi T, Nakamura K, Takakura Y, Ibuki Y, Igarashi M, Minegish T [corrected to Minegishi T]", "evidence": [ { "database": "Reactome", "id": "R-HSA-375281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375281" } ], "reference": [ { "type": "PubMed", "id": "1709010", "url": "https://glygen.org/publication/PubMed/1709010" } ] }, { "title": "Pharmacological characterization of a novel nonpeptide antagonist of the human gonadotropin-releasing hormone receptor, NBI-42902.", "journal": "Endocrinology", "date": "2007", "authors": "Struthers RS, Xie Q, Sullivan SK, Reinhart GJ, Kohout TA, Zhu YF, Chen C, Liu XJ, Ling N, Yang W, Maki RA, Bonneville AK, Chen TK, Bozigian HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-375281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375281" } ], "reference": [ { "type": "PubMed", "id": "17095587", "url": "https://glygen.org/publication/PubMed/17095587" } ] }, { "title": "Azelaic acid. A review of its pharmacological properties and therapeutic efficacy in acne and hyperpigmentary skin disorders.", "journal": "Drugs", "date": "1991", "authors": "Fitton A, Goa KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-193048", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193048" } ], "reference": [ { "type": "PubMed", "id": "1712709", "url": "https://glygen.org/publication/PubMed/1712709" } ] }, { "title": "Phosphodiesterase 4 inhibitors for the treatment of asthma and COPD.", "journal": "Current medicinal chemistry", "date": "2006", "authors": "Huang Z, Mancini JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "17168849", "url": "https://glygen.org/publication/PubMed/17168849" } ] }, { "title": "Comparative and phylogenetic analysis of alpha-L-fucosidase genes.", "journal": "Gene", "date": "2007", "authors": "Intra J, Perotti ME, Pavesi G, Horner D", "evidence": [ { "database": "Reactome", "id": "R-HSA-975578", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975578" } ], "reference": [ { "type": "PubMed", "id": "17175120", "url": "https://glygen.org/publication/PubMed/17175120" } ] }, { "title": "Formation of molecular iodine during oxidation of iodide by the peroxidase/H2O2 system. Implications for antithyroid therapy.", "journal": "Biochemical pharmacology", "date": "1991", "authors": "Lagorce JF, Thomes JC, Catanzano G, Buxeraud J, Raby M, Raby C", "evidence": [ { "database": "Reactome", "id": "R-HSA-209968", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-209968" } ], "reference": [ { "type": "PubMed", "id": "1722671", "url": "https://glygen.org/publication/PubMed/1722671" } ] }, { "title": "Disruption of alpha-mannosidase processing induces non-canonical hybrid-type glycosylation.", "journal": "FEBS letters", "date": "2007", "authors": "Crispin M, Aricescu AR, Chang VT, Jones EY, Stuart DI, Dwek RA, Davis SJ, Harvey DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-975578", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975578" } ], "reference": [ { "type": "PubMed", "id": "17466984", "url": "https://glygen.org/publication/PubMed/17466984" } ] }, { "title": "Novel 5 alpha-steroid reductase (SRD5A3, type-3) is overexpressed in hormone-refractory prostate cancer.", "journal": "Cancer science", "date": "2008", "authors": "Uemura M, Tamura K, Chung S, Honma S, Okuyama A, Nakamura Y, Nakagawa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-193048", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193048" } ], "reference": [ { "type": "PubMed", "id": "17986282", "url": "https://glygen.org/publication/PubMed/17986282" } ] }, { "title": "ANCCA, an estrogen-regulated AAA+ ATPase coactivator for ERalpha, is required for coregulator occupancy and chromatin modification.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Zou JX, Revenko AS, Li LB, Gemo AT, Chen HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "17998543", "url": "https://glygen.org/publication/PubMed/17998543" } ] }, { "title": "PDE4 inhibitors as potential therapeutic agents in the treatment of COPD-focus on roflumilast.", "journal": "International journal of chronic obstructive pulmonary disease", "date": "2007", "authors": "Boswell-Smith V, Spina D", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "18044684", "url": "https://glygen.org/publication/PubMed/18044684" } ] }, { "title": "Site-specific N-glycosylation of human chorionic gonadotrophin--structural analysis of glycopeptides by one- and two-dimensional 1H NMR spectroscopy.", "journal": "Glycobiology", "date": "1991", "authors": "Weisshaar G, Hiyama J, Renwick AG", "evidence": [ { "database": "UniCarbKB", "id": "P01215", "url": "" }, { "database": "GlyConnect", "id": "194", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ], "reference": [ { "type": "PubMed", "id": "1820200", "url": "https://glygen.org/publication/PubMed/1820200" } ] }, { "title": "Dutasteride: a review of its use in the management of prostate disorders.", "journal": "Drugs", "date": "2008", "authors": "Keam SJ, Scott LJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-193048", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193048" } ], "reference": [ { "type": "PubMed", "id": "18318566", "url": "https://glygen.org/publication/PubMed/18318566" } ] }, { "title": "Ablation of GalNAc-4-sulfotransferase-1 enhances reproduction by altering the carbohydrate structures of luteinizing hormone in mice.", "journal": "The Journal of clinical investigation", "date": "2008", "authors": "Mi Y, Fiete D, Baenziger JU", "evidence": [ { "database": "Reactome", "id": "R-HSA-975578", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975578" } ], "reference": [ { "type": "PubMed", "id": "18431515", "url": "https://glygen.org/publication/PubMed/18431515" } ] }, { "title": "Dissociation of heterotrimeric g proteins in cells.", "journal": "Science signaling", "date": "2008", "authors": "Lambert NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "18577758", "url": "https://glygen.org/publication/PubMed/18577758" } ] }, { "title": "Discovery of sodium R-(+)-4-2-[5-(2-fluoro-3-methoxyphenyl)-3-(2-fluoro-6-[trifluoromethyl]benzyl)-4-methyl-2,6-dioxo-3,6-dihydro-2H-pyrimidin-1-yl]-1-phenylethylaminobutyrate (elagolix), a potent and orally available nonpeptide antagonist of the human gonadotropin-releasing hormone receptor.", "journal": "Journal of medicinal chemistry", "date": "2008", "authors": "Chen C, Wu D, Guo Z, Xie Q, Reinhart GJ, Madan A, Wen J, Chen T, Huang CQ, Chen M, Chen Y, Tucci FC, Rowbottom M, Pontillo J, Zhu YF, Wade W, Saunders J, Bozigian H, Struthers RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-375281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375281" } ], "reference": [ { "type": "PubMed", "id": "19006286", "url": "https://glygen.org/publication/PubMed/19006286" } ] }, { "title": "The efficacy and safety of cilomilast in COPD.", "journal": "Drugs", "date": "2008", "authors": "Rennard S, Knobil K, Rabe KF, Morris A, Schachter N, Locantore N, Canonica WG, Zhu Y, Barnhart F", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "19105585", "url": "https://glygen.org/publication/PubMed/19105585" } ] }, { "title": "Expression of human luteinizing hormone (LH) receptor: interaction with LH and chorionic gonadotropin from human but not equine, rat, and ovine species.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1991", "authors": "Jia XC, Oikawa M, Bo M, Tanaka T, Ny T, Boime I, Hsueh AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-375281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375281" } ], "reference": [ { "type": "PubMed", "id": "1922095", "url": "https://glygen.org/publication/PubMed/1922095" } ] }, { "title": "Androgen-induced coactivator ANCCA mediates specific androgen receptor signaling in prostate cancer.", "journal": "Cancer research", "date": "2009", "authors": "Zou JX, Guo L, Revenko AS, Tepper CG, Gemo AT, Kung HJ, Chen HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "19318566", "url": "https://glygen.org/publication/PubMed/19318566" } ] }, { "title": "Structure and expression of a new complementary DNA encoding the almost exclusive 3 beta-hydroxysteroid dehydrogenase/delta 5-delta 4-isomerase in human adrenals and gonads.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1991", "authors": "Rheaume E, Lachance Y, Zhao HF, Breton N, Dumont M, de Launoit Y, Trudel C, Luu-The V, Simard J, Labrie F", "evidence": [ { "database": "Reactome", "id": "R-HSA-193993", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193993" } ], "reference": [ { "type": "PubMed", "id": "1944309", "url": "https://glygen.org/publication/PubMed/1944309" } ] }, { "title": "Deletion of steroid 5 alpha-reductase 2 gene in male pseudohermaphroditism.", "journal": "Nature", "date": "1991", "authors": "Andersson S, Berman DM, Jenkins EP, Russell DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-193048", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193048" } ], "reference": [ { "type": "PubMed", "id": "1944596", "url": "https://glygen.org/publication/PubMed/1944596" } ] }, { "title": "Altered glycosylation of human chorionic gonadotropin decreases its hormonal activity as determined by cyclic-adenosine 3',5'-monophosphate production in MA-10 cells.", "journal": "Glycobiology", "date": "1990", "authors": "Amano J, Nishimura R, Sato S, Kobata A", "evidence": [ { "database": "GlyConnect", "id": "88", "url": "https://glyconnect.expasy.org/browser/proteins/88" } ], "reference": [ { "type": "PubMed", "id": "1967025", "url": "https://glygen.org/publication/PubMed/1967025" } ] }, { "title": "ATAD2 is a novel cofactor for MYC, overexpressed and amplified in aggressive tumors.", "journal": "Cancer research", "date": "2009", "authors": "Ciro M, Prosperini E, Quarto M, Grazini U, Walfridsson J, McBlane F, Nucifero P, Pacchiana G, Capra M, Christensen J, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "19843847", "url": "https://glygen.org/publication/PubMed/19843847" } ] }, { "title": "AN-2728, a PDE4 inhibitor for the potential topical treatment of psoriasis and atopic dermatitis.", "journal": "Current opinion in investigational drugs (London, England : 2000)", "date": "2009", "authors": "Nazarian R, Weinberg JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "19876791", "url": "https://glygen.org/publication/PubMed/19876791" } ] }, { "title": "An overview on 5alpha-reductase inhibitors.", "journal": "Steroids", "date": "2010", "authors": "Aggarwal S, Thareja S, Verma A, Bhardwaj TR, Kumar M", "evidence": [ { "database": "Reactome", "id": "R-HSA-193048", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193048" } ], "reference": [ { "type": "PubMed", "id": "19879888", "url": "https://glygen.org/publication/PubMed/19879888" } ] }, { "title": "NMR investigations of the N-linked oligosaccharides at individual glycosylation sites of human lutropin.", "journal": "Eur. J. Biochem.", "date": "1991", "authors": "Weisshaar G, Hiyama J, Renwick AG, Nimtz M", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" }, { "database": "UniCarbKB", "id": "P01215", "url": "" }, { "database": "GlyConnect", "id": "194", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ], "reference": [ { "type": "PubMed", "id": "1991473", "url": "https://glygen.org/publication/PubMed/1991473" } ] }, { "title": "Ibudilast: a review of its pharmacology, efficacy and safety in respiratory and neurological disease.", "journal": "Expert opinion on pharmacotherapy", "date": "2009", "authors": "Rolan P, Hutchinson M, Johnson K", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "19929708", "url": "https://glygen.org/publication/PubMed/19929708" } ] }, { "title": "Therapeutic options in the treatment of benign prostatic hyperplasia.", "journal": "Patient preference and adherence", "date": "2009", "authors": "Sandhu JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-193048", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193048" } ], "reference": [ { "type": "PubMed", "id": "19936164", "url": "https://glygen.org/publication/PubMed/19936164" } ] }, { "title": "The preclinical pharmacology of roflumilast--a selective, oral phosphodiesterase 4 inhibitor in development for chronic obstructive pulmonary disease.", "journal": "Pulmonary pharmacology & therapeutics", "date": "2010", "authors": "Hatzelmann A, Morcillo EJ, Lungarella G, Adnot S, Sanjar S, Beume R, Schudt C, Tenor H", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "20381629", "url": "https://glygen.org/publication/PubMed/20381629" } ] }, { "title": "Functional characterization of ATAD2 as a new cancer/testis factor and a predictor of poor prognosis in breast and lung cancers.", "journal": "Oncogene", "date": "2010", "authors": "Caron C, Lestrat C, Marsal S, Escoffier E, Curtet S, Virolle V, Barbry P, Debernardi A, Brambilla C, Brambilla E, Rousseaux S, Khochbin S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "20581866", "url": "https://glygen.org/publication/PubMed/20581866" } ] }, { "title": "Ibudilast, a mixed PDE3/4 inhibitor, causes a selective and nitric oxide/cGMP-independent relaxation of the intracranial vertebrobasilar artery.", "journal": "European journal of pharmacology", "date": "2011", "authors": "Yamazaki T, Anraku T, Matsuzawa S", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "21036126", "url": "https://glygen.org/publication/PubMed/21036126" } ] }, { "title": "Isolation and structure determination of the intact sialylated N-linked carbohydrate chains of recombinant human follitropin expressed in Chinese hamster ovary cells.", "journal": "European journal of biochemistry", "date": "1990", "authors": "Hard K, Mekking A, Damm JB, Kamerling JP, de Boer W, Wijnands RA, Vliegenthart JF", "evidence": [ { "database": "GlyConnect", "id": "165", "url": "https://glyconnect.expasy.org/browser/proteins/165" } ], "reference": [ { "type": "PubMed", "id": "2121479", "url": "https://glygen.org/publication/PubMed/2121479" } ] }, { "title": "beta-Arrestin: a protein that regulates beta-adrenergic receptor function.", "journal": "Science (New York, N.Y.)", "date": "1990", "authors": "Lohse MJ, Benovic JL, Codina J, Caron MG, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "2163110", "url": "https://glygen.org/publication/PubMed/2163110" } ] }, { "title": "Discovery of 1-4-[1-(2,6-difluorobenzyl)-5-[(dimethylamino)methyl]-3-(6-methoxypyridazin-3-yl)-2,4-dioxo-1,2,3,4-tetrahydrothieno[2,3-d]pyrimidin-6-yl]phenyl-3-methoxyurea (TAK-385) as a potent, orally active, non-peptide antagonist of the human gonadotropin-releasing hormone receptor.", "journal": "Journal of medicinal chemistry", "date": "2011", "authors": "Miwa K, Hitaka T, Imada T, Sasaki S, Yoshimatsu M, Kusaka M, Tanaka A, Nakata D, Furuya S, Endo S, Hamamura K, Kitazaki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-375281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375281" } ], "reference": [ { "type": "PubMed", "id": "21657270", "url": "https://glygen.org/publication/PubMed/21657270" } ] }, { "title": "Purification, cloning, complementary DNA structure, and predicted amino acid sequence of human estradiol 17 beta-dehydrogenase.", "journal": "Annals of the New York Academy of Sciences", "date": "1990", "authors": "Luu-The V, Labrie C, Zhao HF, Couet J, Lachance Y, Simard J, Cote J, Leblanc G, Lagace L, Berube D, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-193048", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193048" } ], "reference": [ { "type": "PubMed", "id": "2197970", "url": "https://glygen.org/publication/PubMed/2197970" } ] }, { "title": "Characterization of human 3 beta-hydroxysteroid dehydrogenase/delta 5-delta 4-isomerase gene and its expression in mammalian cells.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Lachance Y, Luu-The V, Labrie C, Simard J, Dumont M, de Launoit Y, Guerin S, Leblanc G, Labrie F", "evidence": [ { "database": "Reactome", "id": "R-HSA-193993", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193993" } ], "reference": [ { "type": "PubMed", "id": "2243100", "url": "https://glygen.org/publication/PubMed/2243100" } ] }, { "title": "Cloning and sequencing of human LH/hCG receptor cDNA.", "journal": "Biochemical and biophysical research communications", "date": "1990", "authors": "Minegishi T, Nakamura K, Takakura Y, Miyamoto K, Hasegawa Y, Ibuki Y, Igarashi M, Minegish T [corrected to Minegishi T]", "evidence": [ { "database": "Reactome", "id": "R-HSA-375281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375281" } ], "reference": [ { "type": "PubMed", "id": "2244890", "url": "https://glygen.org/publication/PubMed/2244890" } ] }, { "title": "Structural and biochemical properties of cloned and expressed human and rat steroid 5 alpha-reductases.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990", "authors": "Andersson S, Russell DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-193048", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193048" } ], "reference": [ { "type": "PubMed", "id": "2339109", "url": "https://glygen.org/publication/PubMed/2339109" } ] }, { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology.", "journal": "The EMBO journal", "date": "2013", "authors": "Steentoft C, Vakhrushev SY, Joshi HJ, Kong Y, Vester-Christensen MB, Schjoldager KT, Lavrsen K, Dabelsteen S, Pedersen NB, Marcos-Silva L, Gupta R, Bennett EP, Mandel U, Brunak S, Wandall HH, Levery SB, Clausen H", "evidence": [ { "database": "UniCarbKB", "id": "P01215", "url": "" } ], "reference": [ { "type": "PubMed", "id": "23584533", "url": "https://glygen.org/publication/PubMed/23584533" } ] }, { "title": "Chromatin and epigenetic determinants of estrogen receptor alpha (ESR1) signaling.", "journal": "Molecular and cellular endocrinology", "date": "2014", "authors": "Magnani L, Lupien M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "23684889", "url": "https://glygen.org/publication/PubMed/23684889" } ] }, { "title": "Pharmacology of the bipyridines: amrinone and milrinone.", "journal": "Circulation", "date": "1986", "authors": "Alousi AA, Johnson DC", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "2417744", "url": "https://glygen.org/publication/PubMed/2417744" } ] }, { "title": "Identification and characterization of subpopulations of the free alpha-subunit that vary in their ability to combine with chorionic gonadotropin-beta.", "journal": "Endocrinology", "date": "1989", "authors": "Beebe JS, Krzesicki RF, Norton SE, Perini F, Peters BP, Ruddon RW", "evidence": [ { "database": "iPTMnet", "id": "P01215", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01215" } ], "reference": [ { "type": "PubMed", "id": "2466636", "url": "https://glygen.org/publication/PubMed/2466636" } ] }, { "title": "Advances in targeting cyclic nucleotide phosphodiesterases.", "journal": "Nature reviews. Drug discovery", "date": "2014", "authors": "Maurice DH, Ke H, Ahmad F, Wang Y, Chung J, Manganiello VC", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "24687066", "url": "https://glygen.org/publication/PubMed/24687066" } ] }, { "title": "Evidence for Follicle-stimulating Hormone Receptor as a Functional Trimer.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Jiang X, Fischer D, Chen X, McKenna SD, Liu H, Sriraman V, Yu HN, Goutopoulos A, Arkinstall S, He X", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215#ptm_processing" }, { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "reference": [ { "type": "PubMed", "id": "24692546", "url": "https://glygen.org/publication/PubMed/24692546" } ] }, { "title": "Expression of Gs alpha in Escherichia coli. Purification and properties of two forms of the protein.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Graziano MP, Freissmuth M, Gilman AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "2491850", "url": "https://glygen.org/publication/PubMed/2491850" } ] }, { "title": "Expression of biologically active human follitropin in Chinese hamster ovary cells.", "journal": "The Journal of biological chemistry", "date": "1989-03-25", "authors": "Keene J L, Matzuk M M, Otani T, Fauser B C, Galway A B, Hsueh A J, Boime I", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "reference": [ { "type": "PubMed", "id": "2494176", "url": "https://glygen.org/publication/PubMed/2494176" } ] }, { "title": "[Mechanism of azelaic acid action in acne].", "journal": "Giornale italiano di dermatologia e venereologia : organo ufficiale, Societa italiana di dermatologia e sifilografia", "date": "1989", "authors": "Passi S, Picardo M, De Luca C, Nazzaro-Porro M", "evidence": [ { "database": "Reactome", "id": "R-HSA-193048", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193048" } ], "reference": [ { "type": "PubMed", "id": "2534550", "url": "https://glygen.org/publication/PubMed/2534550" } ] }, { "title": "Pharmacology of positive inotropic phosphodiesterase III inhibitors.", "journal": "European heart journal", "date": "1989", "authors": "Honerjager P", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "2553411", "url": "https://glygen.org/publication/PubMed/2553411" } ] }, { "title": "Multiple signaling pathways of histamine H2 receptors. Identification of an H2 receptor-dependent Ca2+ mobilization pathway in human HL-60 promyelocytic leukemia cells.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Mitsuhashi M, Mitsuhashi T, Payan DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "2553705", "url": "https://glygen.org/publication/PubMed/2553705" } ] }, { "title": "Molecular cloning, sequence and functional expression of the cDNA for the human thyrotropin receptor.", "journal": "Biochemical and biophysical research communications", "date": "1989", "authors": "Nagayama Y, Kaufman KD, Seto P, Rapoport B", "evidence": [ { "database": "Reactome", "id": "R-HSA-375281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375281" } ], "reference": [ { "type": "PubMed", "id": "2558651", "url": "https://glygen.org/publication/PubMed/2558651" } ] }, { "title": "The role of Tcfap2c in tumorigenesis and cancer growth in an activated Neu model of mammary carcinogenesis.", "journal": "Oncogene", "date": "2015", "authors": "Park JM, Wu T, Cyr AR, Woodfield GW, De Andrade JP, Spanheimer PM, Li T, Sugg SL, Lal G, Domann FE, Zhang W, Weigel RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "25772240", "url": "https://glygen.org/publication/PubMed/25772240" } ] }, { "title": "In search of the molecular mechanisms mediating the inhibitory effect of the GnRH antagonist degarelix on human prostate cell growth.", "journal": "PloS one", "date": "2015", "authors": "Sakai M, Martinez-Arguelles DB, Patterson NH, Chaurand P, Papadopoulos V", "evidence": [ { "database": "Reactome", "id": "R-HSA-375281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375281" } ], "reference": [ { "type": "PubMed", "id": "25811175", "url": "https://glygen.org/publication/PubMed/25811175" } ] }, { "title": "Human type 3 5alpha-reductase is expressed in peripheral tissues at higher levels than types 1 and 2 and its activity is potently inhibited by finasteride and dutasteride.", "journal": "Hormone molecular biology and clinical investigation", "date": "2010", "authors": "Yamana K, Labrie F, Luu-The V", "evidence": [ { "database": "Reactome", "id": "R-HSA-193048", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193048" } ], "reference": [ { "type": "PubMed", "id": "25961201", "url": "https://glygen.org/publication/PubMed/25961201" } ] }, { "title": "ATAD2 overexpression links to enrichment of B-MYB-translational signatures and development of aggressive endometrial carcinoma.", "journal": "Oncotarget", "date": "2015", "authors": "Krakstad C, Tangen IL, Hoivik EA, Halle MK, Berg A, Werner HM, Raeder MB, Kusonmano K, Zou JX, Oyan AM, Stefansson I, Trovik J, Kalland KH, Chen HW, Salvesen HB", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "26308378", "url": "https://glygen.org/publication/PubMed/26308378" } ] }, { "title": "Characterization of 12 GnRH peptide agonists - a kinetic perspective.", "journal": "British journal of pharmacology", "date": "2016", "authors": "Nederpelt I, Georgi V, Schiele F, Nowak-Reppel K, Fernandez-Montalvan AE, IJzerman AP, Heitman LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-375281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375281" } ], "reference": [ { "type": "PubMed", "id": "26398856", "url": "https://glygen.org/publication/PubMed/26398856" } ] }, { "title": "Pentoxifylline for intermittent claudication.", "journal": "The Cochrane database of systematic reviews", "date": "2015", "authors": "Salhiyyah K, Forster R, Senanayake E, Abdel-Hadi M, Booth A, Michaels JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "26417854", "url": "https://glygen.org/publication/PubMed/26417854" } ] }, { "title": "Persistent GnRH receptor activation in pituitary alphaT3-1 cells analyzed with a label-free technology.", "journal": "Biosensors & bioelectronics", "date": "2016", "authors": "Nederpelt I, Vergroesen RD, IJzerman AP, Heitman LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-375281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375281" } ], "reference": [ { "type": "PubMed", "id": "26774084", "url": "https://glygen.org/publication/PubMed/26774084" } ] }, { "title": "EGFR Is Regulated by TFAP2C in Luminal Breast Cancer and Is a Target for Vandetanib.", "journal": "Molecular cancer therapeutics", "date": "2016", "authors": "De Andrade JP, Park JM, Gu VW, Woodfield GW, Kulak MV, Lorenzen AW, Wu VT, Van Dorin SE, Spanheimer PM, Weigel RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "26832794", "url": "https://glygen.org/publication/PubMed/26832794" } ] }, { "title": "Human placental 3 beta-hydroxy-5-ene-steroid dehydrogenase and steroid 5----4-ene-isomerase: purification from mitochondria and kinetic profiles, biophysical characterization of the purified mitochondrial and microsomal enzymes.", "journal": "Journal of steroid biochemistry", "date": "1989", "authors": "Thomas JL, Myers RP, Strickler RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-193993", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193993" } ], "reference": [ { "type": "PubMed", "id": "2770297", "url": "https://glygen.org/publication/PubMed/2770297" } ] }, { "title": "Beta-adrenergic receptor kinase: identification of a novel protein kinase that phosphorylates the agonist-occupied form of the receptor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1986", "authors": "Benovic JL, Strasser RH, Caron MG, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "2871555", "url": "https://glygen.org/publication/PubMed/2871555" } ] }, { "title": "Effect and safety of roflumilast for chronic obstructive pulmonary disease in Chinese patients.", "journal": "Medicine", "date": "2018", "authors": "Liu DY, Wang ZG, Gao Y, Zhang HM, Zhang YX, Wang XJ, Peng D", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "29443750", "url": "https://glygen.org/publication/PubMed/29443750" } ] }, { "title": "Use of cilomilast-loaded phosphatiosomes to suppress neutrophilic inflammation for attenuating acute lung injury: the effect of nanovesicular surface charge.", "journal": "Journal of nanobiotechnology", "date": "2018", "authors": "Liu FC, Yu HP, Lin CY, Elzoghby AO, Hwang TL, Fang JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "29602314", "url": "https://glygen.org/publication/PubMed/29602314" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "GlyConnect", "id": "194", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "IL-12/IL-23p40 identified as a downstream target of apremilast in ex vivo models of arthritis.", "journal": "Therapeutic advances in musculoskeletal disease", "date": "2019", "authors": "Kragstrup TW, Adams M, Lomholt S, Nielsen MA, Heftdal LD, Schafer P, Deleuran B", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "30833991", "url": "https://glygen.org/publication/PubMed/30833991" } ] }, { "title": "Isolation and characterization of the human Gs alpha gene.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1988", "authors": "Kozasa T, Itoh H, Tsukamoto T, Kaziro Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "3127824", "url": "https://glygen.org/publication/PubMed/3127824" } ] }, { "title": "Crisaborole 2% ointment for the treatment of intertriginous, anogenital, and facial psoriasis: A double-blind, randomized, vehicle-controlled trial.", "journal": "Journal of the American Academy of Dermatology", "date": "2020", "authors": "Hashim PW, Chima M, Kim HJ, Bares J, Yao CJ, Singer G, Chen T, Genece J, Baum D, Kimmel GW, Nia JK, Gagliotti M, Lebwohl MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "31279028", "url": "https://glygen.org/publication/PubMed/31279028" } ] }, { "title": "Effect of the inhaled PDE4 inhibitor CHF6001 on biomarkers of inflammation in COPD.", "journal": "Respiratory research", "date": "2019", "authors": "Singh D, Beeh KM, Colgan B, Kornmann O, Leaker B, Watz H, Lucci G, Geraci S, Emirova A, Govoni M, Nandeuil MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "31399091", "url": "https://glygen.org/publication/PubMed/31399091" } ] }, { "title": "Simple assessment of quality of life and lower limb functional capacity during cilostazol treatment - results of the SHort-tERm cIlostazol eFFicacy and quality of life (SHERIFF) study.", "journal": "VASA. Zeitschrift fur Gefasskrankheiten", "date": "2020", "authors": "Farkas K, Kolossvary E, Jarai Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "31983287", "url": "https://glygen.org/publication/PubMed/31983287" } ] }, { "title": "Inhibition of 5 alpha-reductase activity in human skin by zinc and azelaic acid.", "journal": "The British journal of dermatology", "date": "1988", "authors": "Stamatiadis D, Bulteau-Portois MC, Mowszowicz I", "evidence": [ { "database": "Reactome", "id": "R-HSA-193048", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193048" } ], "reference": [ { "type": "PubMed", "id": "3207614", "url": "https://glygen.org/publication/PubMed/3207614" } ] }, { "title": "Inhaled Phosphodiesterase 4 (PDE4) Inhibitors for Inflammatory Respiratory Diseases.", "journal": "Frontiers in pharmacology", "date": "2020", "authors": "Phillips JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "32226383", "url": "https://glygen.org/publication/PubMed/32226383" } ] }, { "title": "Analysis of the human chorionic gonadotropin protein at the intact level by HILIC-MS and comparison with RPLC-MS.", "journal": "Analytical and bioanalytical chemistry", "date": "2020", "authors": "Camperi J, Combes A, Fournier T, Pichon V, Delaunay N", "evidence": [ { "database": "RefSeq", "id": "NP_001239312", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239312" } ], "reference": [ { "type": "PubMed", "id": "32377867", "url": "https://glygen.org/publication/PubMed/32377867" } ] }, { "title": "Commentary: Phosphodiesterase 4 inhibitors as potential adjunct treatment targeting the cytokine storm in COVID-19.", "journal": "Metabolism: clinical and experimental", "date": "2020", "authors": "Dalamaga M, Karampela I, Mantzoros CS", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "32497535", "url": "https://glygen.org/publication/PubMed/32497535" } ] }, { "title": "Repositioning of pentoxifylline as an immunomodulator and regulator of the renin-angiotensin system in the treatment of COVID-19.", "journal": "Medical hypotheses", "date": "2020", "authors": "Maldonado V, Loza-Mejia MA, Chavez-Alderete J", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "32540603", "url": "https://glygen.org/publication/PubMed/32540603" } ] }, { "title": "COVID-19 patients with psoriasis and psoriatic arthritis on biologic immunosuppressant therapy vs apremilast in North Spain.", "journal": "Dermatologic therapy", "date": "2020", "authors": "Queiro Silva R, Armesto S, Gonzalez Vela C, Naharro Fernandez C, Gonzalez-Gay MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "32618402", "url": "https://glygen.org/publication/PubMed/32618402" } ] }, { "title": "Hypothesis: Pentoxifylline is a potential cytokine modulator therapeutic in COVID-19 patients.", "journal": "Pharmacology research & perspectives", "date": "2020", "authors": "Hendry BM, Stafford N, Arnold AD, Sangwaiya A, Manglam V, Rosen SD, Arnold J", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "32715661", "url": "https://glygen.org/publication/PubMed/32715661" } ] }, { "title": "GWAS of thyroid stimulating hormone highlights pleiotropic effects and inverse association with thyroid cancer.", "journal": "Nature communications", "date": "2020", "authors": "Zhou W, Brumpton B, Kabil O, Gudmundsson J, Thorleifsson G, Weinstock J, Zawistowski M, Nielsen JB, Chaker L, Medici M, Teumer A, Naitza S, Sanna S, Schultheiss UT, Cappola A, Karjalainen J, Kurki M, Oneka M, Taylor P, Fritsche LG, Graham SE, Wolford BN, Overton W, Rasheed H, Haug EB, Gabrielsen ME, Skogholt AH, Surakka I, Davey Smith G, Pandit A, Roychowdhury T, Hornsby WE, Jonasson JG, Senter L, Liyanarachchi S, Ringel MD, Xu L, Kiemeney LA, He H, Netea-Maier RT, Mayordomo JI, Plantinga TS, Hrafnkelsson J, Hjartarson H, Sturgis EM, Palotie A, Daly M, Citterio CE, Arvan P, Brummett CM, Boehnke M, de la Chapelle A, Stefansson K, Hveem K, Willer CJ, Asvold BO", "evidence": [ { "database": "RefSeq", "id": "NP_001239312", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239312" } ], "reference": [ { "type": "PubMed", "id": "32769997", "url": "https://glygen.org/publication/PubMed/32769997" } ] }, { "title": "Pentoxifylline: A Drug with Antiviral and Anti-Inflammatory Effects to Be Considered in the Treatment of Coronavirus Disease 2019.", "journal": "Medical principles and practice : international journal of the Kuwait University, Health Science Centre", "date": "2021", "authors": "Ghasemnejad-Berenji M, Pashapour S, Sadeghpour S", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "33049737", "url": "https://glygen.org/publication/PubMed/33049737" } ] }, { "title": "Comparative study of the mucin-type sugar chains of human chorionic gonadotropin present in the urine of patients with trophoblastic diseases and healthy pregnant women.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Amano J, Nishimura R, Mochizuki M, Kobata A", "evidence": [ { "database": "GlyConnect", "id": "88", "url": "https://glyconnect.expasy.org/browser/proteins/88" } ], "reference": [ { "type": "PubMed", "id": "3335536", "url": "https://glygen.org/publication/PubMed/3335536" } ] }, { "title": "Prevalence and predictors of colonoscopic findings in patients with autoimmune gastritis.", "journal": "Journal of investigative medicine : the official publication of the American Federation for Clinical Research", "date": "2022", "authors": "Asfuroglu Kalkan E, Kalkan C, Gumussoy M, Gucbey O, Soykan I", "evidence": [ { "database": "RefSeq", "id": "NP_001239312", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239312" } ], "reference": [ { "type": "PubMed", "id": "34341100", "url": "https://glygen.org/publication/PubMed/34341100" } ] }, { "title": "Myocardial perfusion SPECT as a potential mediator on circulating chromogranin A in patients with old myocardial infarction.", "journal": "Hellenic journal of nuclear medicine", "date": "2021", "authors": "Xourgia X, Tsiouris S, Kolettis T, Goudevenos I, Arseniou A, Fotopoulos AD", "evidence": [ { "database": "RefSeq", "id": "NP_001239312", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239312" } ], "reference": [ { "type": "PubMed", "id": "34352046", "url": "https://glygen.org/publication/PubMed/34352046" } ] }, { "title": "Highly Efficient Enrichment of O-GlcNAc Glycopeptides Based on Chemical Oxidation and Reversible Hydrazide Chemistry.", "journal": "Analytical chemistry", "date": "2021", "authors": "Chen Y, Qin H, Yue X, Zhou J, Liu L, Nie Y, Ye M", "evidence": [ { "database": "O-GlcNAc Atlas", "id": "P01215", "url": "https://oglcnac.org/atlas/detail/P01215" } ], "reference": [ { "type": "PubMed", "id": "34846842", "url": "https://glygen.org/publication/PubMed/34846842" } ] }, { "title": "Endo-M Mediated Chemoenzymatic Approach Enables Reversible Glycopeptide Labeling for O-GlcNAcylation Analysis.", "journal": "Angewandte Chemie (International ed. in English)", "date": "2022", "authors": "Chen Y, Tang F, Qin H, Yue X, Nie Y, Huang W, Ye M", "evidence": [ { "database": "O-GlcNAc Database", "id": "P01215", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01215" } ], "reference": [ { "type": "PubMed", "id": "35289036", "url": "https://glygen.org/publication/PubMed/35289036" } ] }, { "title": "Azasteroids: structure-activity relationships for inhibition of 5 alpha-reductase and of androgen receptor binding.", "journal": "Journal of medicinal chemistry", "date": "1986", "authors": "Rasmusson GH, Reynolds GF, Steinberg NG, Walton E, Patel GF, Liang T, Cascieri MA, Cheung AH, Brooks JR, Berman C", "evidence": [ { "database": "Reactome", "id": "R-HSA-193048", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193048" } ], "reference": [ { "type": "PubMed", "id": "3783591", "url": "https://glygen.org/publication/PubMed/3783591" } ] }, { "title": "Human chorionic gonadotropin. Linear amino acid sequence of the alpha subunit.", "journal": "J. Biol. Chem.", "date": "1973", "authors": "Bellisario R, Carlsen R B, Bahl O P", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "reference": [ { "type": "PubMed", "id": "4745444", "url": "https://glygen.org/publication/PubMed/4745444" } ] }, { "title": "Isolation, cloning and sequence analysis of the cDNA for the alpha-subunit of human chorionic gonadotropin.", "journal": "Nature", "date": "1979", "authors": "Fiddes JC, Goodman HM", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "reference": [ { "type": "PubMed", "id": "481597", "url": "https://glygen.org/publication/PubMed/481597" } ] }, { "title": "Human follicle stimulating hormone (hFSH): first proposal for the amino acid sequence of the alpha-subunit (hFSHa) and first demonstration of its identity with the alpha-subunit of human luteinizing hormone (hLHa).", "journal": "J. Clin. Endocrinol. Metab.", "date": "1974", "authors": "Shome B, Parlow A F", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "reference": [ { "type": "PubMed", "id": "4835135", "url": "https://glygen.org/publication/PubMed/4835135" } ] }, { "title": "Human pituitary interstitial cell stimulating hormone: primary structure of the alpha-subunit.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1972", "authors": "Sairam M R, Papkoff H, Li C H", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "reference": [ { "type": "PubMed", "id": "5065401", "url": "https://glygen.org/publication/PubMed/5065401" } ] }, { "title": "The new inotropic phosphodiesterase inhibitors.", "journal": "Archives internationales de physiologie et de biochimie", "date": "1984", "authors": "el Allaf D, D'Orio V, Carlier J", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "6085243", "url": "https://glygen.org/publication/PubMed/6085243" } ] }, { "title": "Characterization of cDNA for precursor of human luteinizing hormone releasing hormone.", "journal": "Nature", "date": "1984", "authors": "Seeburg PH, Adelman JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-375281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375281" } ], "reference": [ { "type": "PubMed", "id": "6090951", "url": "https://glygen.org/publication/PubMed/6090951" } ] }, { "title": "The gene encoding the common alpha subunit of the four human glycoprotein hormones.", "journal": "J. Mol. Appl. Genet.", "date": "1981", "authors": "Fiddes J C, Goodman H M", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "reference": [ { "type": "PubMed", "id": "6286817", "url": "https://glygen.org/publication/PubMed/6286817" } ] }, { "title": "Structures of the asparagine-linked sugar chains of human chorionic gonadotropin produced in choriocarcinoma. Appearance of triantennary sugar chains and unique biantennary sugar chains.", "journal": "The Journal of biological chemistry", "date": "1983", "authors": "Mizuochi T, Nishimura R, Derappe C, Taniguchi T, Hamamoto T, Mochizuki M, Kobata A", "evidence": [ { "database": "GlyConnect", "id": "88", "url": "https://glyconnect.expasy.org/browser/proteins/88" } ], "reference": [ { "type": "PubMed", "id": "6643471", "url": "https://glygen.org/publication/PubMed/6643471" } ] }, { "title": "Biosynthesis of thyroid hormone: basic and clinical aspects.", "journal": "Metabolism: clinical and experimental", "date": "1977", "authors": "Degroot LJ, Niepomniszcze H", "evidence": [ { "database": "Reactome", "id": "R-HSA-209968", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-209968" } ], "reference": [ { "type": "PubMed", "id": "67547", "url": "https://glygen.org/publication/PubMed/67547" } ] }, { "title": "Studies on the disulfide bonds in human pituitary follicle-stimulating hormone.", "journal": "Biochim. Biophys. Acta", "date": "1980", "authors": "Fujiki Y, Rathnam P, Saxena BB", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" }, { "database": "Reactome", "id": "R-HSA-209822", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-209822" } ], "reference": [ { "type": "PubMed", "id": "6774759", "url": "https://glygen.org/publication/PubMed/6774759" } ] }, { "title": "Thyroid-stimulating hormone subunits: evidence from endoglycosidase-H cleavage for late presecretory glycosylation.", "journal": "Endocrinology", "date": "1981", "authors": "Chin WW, Habener JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-209822", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-209822" } ], "reference": [ { "type": "PubMed", "id": "7215288", "url": "https://glygen.org/publication/PubMed/7215288" } ] }, { "title": "Assignment of disulfide bonds in the alpha subunit of human chorionic gonadotropin.", "journal": "J. Biol. Chem.", "date": "1980", "authors": "Mise T, Bahl O P", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "reference": [ { "type": "PubMed", "id": "7410374", "url": "https://glygen.org/publication/PubMed/7410374" } ] }, { "title": "The amino acid sequences of the prepeptides contained in the alpha and beta subunits of human choriogonadotropin.", "journal": "J. Biol. Chem.", "date": "1981", "authors": "Birken S, Fetherston J, Canfield R, Boime I", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "reference": [ { "type": "PubMed", "id": "7462224", "url": "https://glygen.org/publication/PubMed/7462224" } ] }, { "title": "The human UDP-N-acetylglucosamine: alpha-6-D-mannoside-beta-1,2- N-acetylglucosaminyltransferase II gene (MGAT2). Cloning of genomic DNA, localization to chromosome 14q21, expression in insect cells and purification of the recombinant protein.", "journal": "European journal of biochemistry", "date": "1995", "authors": "Tan J, D'Agostaro AF, Bendiak B, Reck F, Sarkar M, Squire JA, Leong P, Schachter H", "evidence": [ { "database": "Reactome", "id": "R-HSA-975578", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975578" } ], "reference": [ { "type": "PubMed", "id": "7635144", "url": "https://glygen.org/publication/PubMed/7635144" } ] }, { "title": "Selection and characterization of mammalian cell lines with stable over-expression of human pituitary receptors for gonadoliberin.", "journal": "European journal of biochemistry", "date": "1995", "authors": "Beckers T, Marheineke K, Reilander H, Hilgard P", "evidence": [ { "database": "Reactome", "id": "R-HSA-375281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375281" } ], "reference": [ { "type": "PubMed", "id": "7649152", "url": "https://glygen.org/publication/PubMed/7649152" } ] }, { "title": "Expression of human chromosome 19p alpha(1,3)-fucosyltransferase genes in normal tissues. Alternative splicing, polyadenylation, and isoforms.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Cameron HS, Szczepaniak D, Weston BW", "evidence": [ { "database": "Reactome", "id": "R-HSA-975578", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975578" } ], "reference": [ { "type": "PubMed", "id": "7650030", "url": "https://glygen.org/publication/PubMed/7650030" } ] }, { "title": "Transcriptional regulation of estrogen receptor in breast carcinomas.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "deConinck EC, McPherson LA, Weigel RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "7891714", "url": "https://glygen.org/publication/PubMed/7891714" } ] }, { "title": "Rapid and simple approach for the NMR resonance assignment of the carbohydrate chains of an intact glycoprotein. Application of gradient-enhanced natural abundance 1H-13C HSQC and HSQC-TOCSY to the alpha-subunit of human chorionic gonadotropin.", "journal": "FEBS letters", "date": "1994", "authors": "de Beer T, van Zuylen CW, Hard K, Boelens R, Kaptein R, Kamerling JP, Vliegenthart JF", "evidence": [ { "database": "UniCarbKB", "id": "P01215", "url": "" }, { "database": "GlyConnect", "id": "194", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ], "reference": [ { "type": "PubMed", "id": "8026573", "url": "https://glygen.org/publication/PubMed/8026573" } ] }, { "title": "Male pseudohermaphroditism caused by mutations of testicular 17 beta-hydroxysteroid dehydrogenase 3.", "journal": "Nature genetics", "date": "1994", "authors": "Geissler WM, Davis DL, Wu L, Bradshaw KD, Patel S, Mendonca BB, Elliston KO, Wilson JD, Russell DW, Andersson S", "evidence": [ { "database": "Reactome", "id": "R-HSA-193048", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193048" } ], "reference": [ { "type": "PubMed", "id": "8075637", "url": "https://glygen.org/publication/PubMed/8075637" } ] }, { "title": "The human thyrotropin receptor activates G-proteins Gs and Gq/11.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Allgeier A, Offermanns S, Van Sande J, Spicher K, Schultz G, Dumont JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-375281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375281" } ], "reference": [ { "type": "PubMed", "id": "8188646", "url": "https://glygen.org/publication/PubMed/8188646" } ] }, { "title": "Structure and regulation of human thyroid-stimulating hormone (TSH) gene.", "journal": "Nippon Rinsho", "date": "1994", "authors": "Miyoshi I, Kasai N, Hayashizaki Y", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "reference": [ { "type": "PubMed", "id": "8196184", "url": "https://glygen.org/publication/PubMed/8196184" } ] }, { "title": "Crystal structure of human chorionic gonadotropin.", "journal": "Nature", "date": "1994", "authors": "Lapthorn AJ, Harris DC, Littlejohn A, Lustbader JW, Canfield RE, Machin KJ, Morgan FJ, Isaacs NW", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "reference": [ { "type": "PubMed", "id": "8202136", "url": "https://glygen.org/publication/PubMed/8202136" } ] }, { "title": "Polypeptide variants of beta-arrestin and arrestin3.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Sterne-Marr R, Gurevich VV, Goldsmith P, Bodine RC, Sanders C, Donoso LA, Benovic JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "8340388", "url": "https://glygen.org/publication/PubMed/8340388" } ] }, { "title": "Phosphorylation and desensitization of human m2 muscarinic cholinergic receptors by two isoforms of the beta-adrenergic receptor kinase.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Richardson RM, Kim C, Benovic JL, Hosey MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "8514797", "url": "https://glygen.org/publication/PubMed/8514797" } ] }, { "title": "Molecular cloning and expression of cDNAs encoding human alpha-mannosidase II and a previously unrecognized alpha-mannosidase IIx isozyme.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Misago M, Liao YF, Kudo S, Eto S, Mattei MG, Moremen KW, Fukuda MN", "evidence": [ { "database": "Reactome", "id": "R-HSA-975578", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975578" } ], "reference": [ { "type": "PubMed", "id": "8524845", "url": "https://glygen.org/publication/PubMed/8524845" } ] }, { "title": "Characteristics of human types 1, 2 and 3 17 beta-hydroxysteroid dehydrogenase activities: oxidation/reduction and inhibition.", "journal": "The Journal of steroid biochemistry and molecular biology", "date": "1995", "authors": "Luu-The V, Zhang Y, Poirier D, Labrie F", "evidence": [ { "database": "Reactome", "id": "R-HSA-193048", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193048" } ], "reference": [ { "type": "PubMed", "id": "8547185", "url": "https://glygen.org/publication/PubMed/8547185" } ] }, { "title": "Members of the G protein-coupled receptor kinase family that phosphorylate the beta2-adrenergic receptor facilitate sequestration.", "journal": "Biochemistry", "date": "1996", "authors": "Menard L, Ferguson SS, Barak LS, Bertrand L, Premont RT, Colapietro AM, Lefkowitz RJ, Caron MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "8672451", "url": "https://glygen.org/publication/PubMed/8672451" } ] }, { "title": "The luteinizing hormone/chorionic gonadotropin receptor has distinct transmembrane conductors for cAMP and inositol phosphate signals.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Gilchrist RL, Ryu KS, Ji I, Ji TH", "evidence": [ { "database": "Reactome", "id": "R-HSA-375281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375281" } ], "reference": [ { "type": "PubMed", "id": "8702611", "url": "https://glygen.org/publication/PubMed/8702611" } ] }, { "title": "Cloning of the human sodium lodide symporter.", "journal": "Biochemical and biophysical research communications", "date": "1996", "authors": "Smanik PA, Liu Q, Furminger TL, Ryu K, Xing S, Mazzaferri EL, Jhiang SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-209968", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-209968" } ], "reference": [ { "type": "PubMed", "id": "8806637", "url": "https://glygen.org/publication/PubMed/8806637" } ] }, { "title": "Mutations in the MGAT2 gene controlling complex N-glycan synthesis cause carbohydrate-deficient glycoprotein syndrome type II, an autosomal recessive disease with defective brain development.", "journal": "American journal of human genetics", "date": "1996", "authors": "Tan J, Dunn J, Jaeken J, Schachter H", "evidence": [ { "database": "Reactome", "id": "R-HSA-975578", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975578" } ], "reference": [ { "type": "PubMed", "id": "8808595", "url": "https://glygen.org/publication/PubMed/8808595" } ] }, { "title": "A family of AP-2 proteins regulates c-erbB-2 expression in mammary carcinoma.", "journal": "Oncogene", "date": "1996", "authors": "Bosher JM, Totty NF, Hsuan JJ, Williams T, Hurst HC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "8895516", "url": "https://glygen.org/publication/PubMed/8895516" } ] }, { "title": "NMR studies of the free alpha subunit of human chorionic gonadotropin. Structural influences of N-glycosylation and the beta subunit on the conformation of the alpha subunit.", "journal": "Eur. J. Biochem.", "date": "1996", "authors": "De Beer T, Van Zuylen C W, Leeflang B R, H\u00e5rd K, Boelens R, Kaptein R, Kamerling J P, Vliegenthart J F", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "reference": [ { "type": "PubMed", "id": "8898911", "url": "https://glygen.org/publication/PubMed/8898911" } ] }, { "title": "Human pituitary thyrotropin. The primary structure of the alpha and beta subunits.", "journal": "Can. J. Biochem.", "date": "1977", "authors": "Sairam MR, Li CH", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "reference": [ { "type": "PubMed", "id": "890569", "url": "https://glygen.org/publication/PubMed/890569" } ] }, { "title": "Transcription factor AP-2 controls transcription of the human transforming growth factor-alpha gene.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Wang D, Shin TH, Kudlow JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "9162057", "url": "https://glygen.org/publication/PubMed/9162057" } ] }, { "title": "Regulation of the human chorionic gonadotropin alpha- and beta-subunit promoters by AP-2.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Johnson W, Albanese C, Handwerger S, Williams T, Pestell RG, Jameson JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "9182571", "url": "https://glygen.org/publication/PubMed/9182571" } ] }, { "title": "Male pseudohermaphroditism resulting from a novel mutation in the human steroid 5 alpha-reductase type 2 gene (SRD5A2).", "journal": "Molecular pathology : MP", "date": "1997", "authors": "Anwar R, Gilbey SG, New JP, Markham AF", "evidence": [ { "database": "Reactome", "id": "R-HSA-193048", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193048" } ], "reference": [ { "type": "PubMed", "id": "9208814", "url": "https://glygen.org/publication/PubMed/9208814" } ] }, { "title": "Anagrelide as a new platelet-lowering agent in essential thrombocythemia: mechanism of actin, efficacy, toxicity, current indications.", "journal": "Seminars in thrombosis and hemostasis", "date": "1997", "authors": "Tefferi A, Silverstein MN, Petitt RM, Mesa RA, Solberg LA Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "9263355", "url": "https://glygen.org/publication/PubMed/9263355" } ] }, { "title": "Characterization of gonadotropin-releasing hormone analogs based on a sensitive cellular luciferase reporter gene assay.", "journal": "Analytical biochemistry", "date": "1997", "authors": "Beckers T, Reilander H, Hilgard P", "evidence": [ { "database": "Reactome", "id": "R-HSA-375281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375281" } ], "reference": [ { "type": "PubMed", "id": "9300077", "url": "https://glygen.org/publication/PubMed/9300077" } ] }, { "title": "Crystal structure of the catalytic domains of adenylyl cyclase in a complex with Gsalpha.GTPgammaS.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Tesmer JJ, Sunahara RK, Gilman AG, Sprang SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "9417641", "url": "https://glygen.org/publication/PubMed/9417641" } ] }, { "title": "Second gene for gonadotropin-releasing hormone in humans.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "White RB, Eisen JA, Kasten TL, Fernald RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-375281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375281" } ], "reference": [ { "type": "PubMed", "id": "9419371", "url": "https://glygen.org/publication/PubMed/9419371" } ] }, { "title": "Carbohydrate and peptide structure of the alpha- and beta-subunits of human chorionic gonadotropin from normal and aberrant pregnancy and choriocarcinoma.", "journal": "Endocrine", "date": "1997", "authors": "Elliott MM, Kardana A, Lustbader JW, Cole LA", "evidence": [ { "database": "UniCarbKB", "id": "P01215", "url": "" }, { "database": "GlyConnect", "id": "194", "url": "https://glyconnect.expasy.org/browser/proteins/194" } ], "reference": [ { "type": "PubMed", "id": "9449027", "url": "https://glygen.org/publication/PubMed/9449027" } ] }, { "title": "Expression cloning of a human sulfotransferase that directs the synthesis of the HNK-1 glycan on the neural cell adhesion molecule and glycolipids.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Ong E, Yeh JC, Ding Y, Hindsgaul O, Fukuda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-975578", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975578" } ], "reference": [ { "type": "PubMed", "id": "9478973", "url": "https://glygen.org/publication/PubMed/9478973" } ] }, { "title": "A critical review of the origin and control of adrenal androgens.", "journal": "Bailliere's clinical obstetrics and gynaecology", "date": "1997", "authors": "McKenna TJ, Fearon U, Clarke D, Cunningham SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-193048", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193048" } ], "reference": [ { "type": "PubMed", "id": "9536209", "url": "https://glygen.org/publication/PubMed/9536209" } ] }, { "title": "Stimulation of type 1 and type 8 Ca2+/calmodulin-sensitive adenylyl cyclases by the Gs-coupled 5-hydroxytryptamine subtype 5-HT7A receptor.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Baker LP, Nielsen MD, Impey S, Metcalf MA, Poser SW, Chan G, Obrietan K, Hamblin MW, Storm DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "9651336", "url": "https://glygen.org/publication/PubMed/9651336" } ] }, { "title": "Loss of AP-2 results in downregulation of c-KIT and enhancement of melanoma tumorigenicity and metastasis.", "journal": "The EMBO journal", "date": "1998", "authors": "Huang S, Jean D, Luca M, Tainsky MA, Bar-Eli M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "9687504", "url": "https://glygen.org/publication/PubMed/9687504" } ] }, { "title": "Expression of AP-2 transcription factors in human breast cancer correlates with the regulation of multiple growth factor signalling pathways.", "journal": "Cancer research", "date": "1998", "authors": "Turner BC, Zhang J, Gumbs AA, Maher MG, Kaplan L, Carter D, Glazer PM, Hurst HC, Haffty BG, Williams T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "9850080", "url": "https://glygen.org/publication/PubMed/9850080" } ] }, { "title": "A model for the turnover of dihydrotestosterone in the presence of the irreversible 5 alpha-reductase inhibitors GI198745 and finasteride.", "journal": "Clinical pharmacology and therapeutics", "date": "1998", "authors": "Gisleskog PO, Hermann D, Hammarlund-Udenaes M, Karlsson MO", "evidence": [ { "database": "Reactome", "id": "R-HSA-193048", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193048" } ], "reference": [ { "type": "PubMed", "id": "9871428", "url": "https://glygen.org/publication/PubMed/9871428" } ] }, { "title": "Expression of human alpha-l-fucosyltransferase gene homologs in monkey kidney COS cells and modification of potential fucosyltransferase acceptor substrates by an endogenous glycosidase.", "journal": "Glycobiology", "date": "1999", "authors": "Clarke JL, Watkins WM", "evidence": [ { "database": "Reactome", "id": "R-HSA-975578", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975578" } ], "reference": [ { "type": "PubMed", "id": "9949196", "url": "https://glygen.org/publication/PubMed/9949196" } ] } ], "pathway": [ { "id": "hsa:1081", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:1081", "resource": "KEGG Pathway" }, { "id": "R-HSA-193048", "name": "Androgen biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193048", "resource": "Reactome", "description": "Androgen biosynthesis" }, { "id": "R-HSA-193993", "name": "Mineralocorticoid biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193993", "resource": "Reactome", "description": "Mineralocorticoid biosynthesis" }, { "id": "R-HSA-209822", "name": "Glycoprotein hormones", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-209822", "resource": "Reactome", "description": "Glycoprotein hormones" }, { "id": "R-HSA-209968", "name": "Thyroxine biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-209968", "resource": "Reactome", "description": "Thyroxine biosynthesis" }, { "id": "R-HSA-375281", "name": "Hormone ligand-binding receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375281", "resource": "Reactome", "description": "Hormone ligand-binding receptors" }, { "id": "R-HSA-418555", "name": "G alpha (s) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555", "resource": "Reactome", "description": "G alpha (s) signalling events" }, { "id": "R-HSA-8866910", "name": "TFAP2 (AP-2) family regulates transcription of growth factors and their receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910", "resource": "Reactome", "description": "TFAP2 (AP-2) family regulates transcription of growth factors and their receptors" }, { "id": "R-HSA-975578", "name": "Reactions specific to the complex N-glycan synthesis pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975578", "resource": "Reactome", "description": "Reactions specific to the complex N-glycan synthesis pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P01216-1", "protein_name": "Glycoprotein hormones alpha chain", "gene_name": "Cga", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MDYYRKYAAVILVMLSMFLHILHSLPDGDFIIQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNARVENHTECHCSTCYYHKS", "length": 120 }, "evidence": [ { "id": "45919381", "url": "http://www.informatics.jax.org/homology/45919381", "database": "MGI" }, { "id": "P01215", "url": "https://omabrowser.org/oma/group/P01215/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P01219-1", "protein_name": "Glycoprotein hormones alpha chain", "gene_name": "CGA", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MDYYRKYAAVILAILSVFLQILHSFPDGEFTMQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNARVENHTECHCSTCYYHKS", "length": 120 }, "evidence": [ { "id": "P01215", "url": "https://omabrowser.org/oma/group/P01215/", "database": "OMA" } ], "common_name": "Pig" }, { "uniprot_canonical_ac": "P11962-1", "protein_name": "Glycoprotein hormones alpha chain", "gene_name": "Cga", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MDCYRRYAAVILVMLSMVLHILHSLPDGDLIIQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKSFTKATVMGNARVENHTDCHCSTCYYHKS", "length": 120 }, "evidence": [ { "id": "45919381", "url": "http://www.informatics.jax.org/homology/45919381", "database": "MGI" }, { "id": "P01215", "url": "https://omabrowser.org/oma/group/P01215/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 14, "go_terms": [ { "name": "thyroid gland development", "id": "GO:0030878", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030878", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "pmid": "" }, { "name": "luteinizing hormone secretion", "id": "GO:0032275", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032275", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "pmid": "" }, { "name": "negative regulation of organ growth", "id": "GO:0046621", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046621", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "pmid": "" }, { "name": "follicle-stimulating hormone secretion", "id": "GO:0046884", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046884", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "pmid": "" }, { "name": "G protein-coupled receptor signaling pathway", "id": "GO:0007186", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "pmid": "" }, { "name": "positive regulation of cell population proliferation", "id": "GO:0008284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008284", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "pmid": "" }, { "name": "positive regulation of cell migration", "id": "GO:0030335", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030335", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "pmid": "" }, { "name": "regulation of signaling receptor activity", "id": "GO:0010469", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010469", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "pmid": "" }, { "name": "hormone-mediated signaling pathway", "id": "GO:0009755", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009755", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "pmid": "" }, { "name": "organ growth", "id": "GO:0035265", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035265", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "pmid": "" }, { "name": "follicle-stimulating hormone signaling pathway", "id": "GO:0042699", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042699", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "pmid": "" }, { "name": "thyroid hormone generation", "id": "GO:0006590", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006590", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "pmid": "" }, { "name": "positive regulation of steroid biosynthetic process", "id": "GO:0010893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010893", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "pmid": "" }, { "name": "Golgi lumen", "id": "GO:0005796", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005796", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "pmid": "" }, { "name": "follicle-stimulating hormone complex", "id": "GO:0016914", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016914", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "pmid": "" }, { "name": "pituitary gonadotropin complex", "id": "GO:0061696", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061696", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "hormone activity", "id": "GO:0005179", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005179", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "pmid": "" }, { "name": "follicle-stimulating hormone activity", "id": "GO:0016913", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016913", "evidence": [ { "database": "UniProtKB", "id": "P01215", "url": "https://www.uniprot.org/uniprot/P01215" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "glycoprotein hormones alpha chain N-glycosylated 1 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G04077XA. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G04077XA. [PRO:DNx, PMID:1457969, PMID:1820200]", "evidence": [ { "id": "PR:000051640", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051640" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 2 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G06209KS. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G06209KS. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051641", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051641" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 3 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G08185DV. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G08185DV. [PRO:DNx, PMID:1457969, PMID:1820200]", "evidence": [ { "id": "PR:000051642", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051642" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 4 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G10258MC. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G10258MC. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051643", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051643" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 5 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G14047PA. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G14047PA. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051644", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051644" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 6 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G14358WN. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G14358WN. [PRO:DNx, PMID:1457969, PMID:1820200]", "evidence": [ { "id": "PR:000051645", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051645" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 7 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G14996IQ. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G14996IQ. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051646", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051646" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 8 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G14998UC. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G14998UC. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051647", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051647" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 9 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G16828VN. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G16828VN. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051648", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051648" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 10 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G24413UY. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G24413UY. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051649", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051649" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 11 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G24954RW. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G24954RW. [PRO:DNx, PMID:1457969, PMID:1820200]", "evidence": [ { "id": "PR:000051650", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051650" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 12 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G25835MT. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G25835MT. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051651", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051651" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 13 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G29857RC. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G29857RC. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051652", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051652" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 14 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G36191CD. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G36191CD. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051653", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051653" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 15 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G38217AM. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G38217AM. [PRO:DNx, PMID:1457969, PMID:1820200]", "evidence": [ { "id": "PR:000051654", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051654" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 16 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G39540XG. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G39540XG. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051655", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051655" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 17 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G41708PN. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G41708PN. [PRO:DNx, PMID:1457969, PMID:1820200]", "evidence": [ { "id": "PR:000051656", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051656" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 18 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G43346PX. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G43346PX. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051657", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051657" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 19 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G43664YB. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G43664YB. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051658", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051658" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 20 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G49743VF. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G49743VF. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051659", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051659" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 21 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G51367TM. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G51367TM. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051660", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051660" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 22 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G53933HU. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G53933HU. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051661", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051661" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 23 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G53962WT. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G53962WT. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051662", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051662" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 24 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G53985AY. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G53985AY. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051663", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051663" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 25 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G56271TF. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G56271TF. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051664", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051664" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 26 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G65890UA. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G65890UA. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051665", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051665" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 27 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G69411IG. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G69411IG. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051666", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051666" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 28 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G77198CF. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G77198CF. [PRO:DNx, PMID:1457969, PMID:1820200]", "evidence": [ { "id": "PR:000051667", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051667" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 29 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G77252PU. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G77252PU. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051668", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051668" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 30 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G78059CC. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G78059CC. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051669", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051669" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 31 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G78890OB. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G78890OB. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051670", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051670" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 32 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G84467IZ. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G84467IZ. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051671", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051671" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 33 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G86357DX. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G86357DX. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051672", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051672" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 34 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G91365ZQ. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G91365ZQ. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051673", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051673" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 35 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G93284HQ. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G93284HQ. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051674", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051674" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 36 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G96921ZU. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G96921ZU. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051675", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051675" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 37 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-102 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G99897FQ. Example: UniProtKB:P01215-1, Asn-102, MOD:00160~GNO:G99897FQ. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051676", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051676" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 38 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G06209KS. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G06209KS. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051677", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051677" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 39 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G08185DV. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G08185DV. [PRO:DNx, PMID:1457969, PMID:1820200]", "evidence": [ { "id": "PR:000051678", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051678" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 40 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G10258MC. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G10258MC. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051679", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051679" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 41 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G14047PA. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G14047PA. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051680", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051680" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 42 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G14358WN. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G14358WN. [PRO:DNx, PMID:1457969, PMID:1820200]", "evidence": [ { "id": "PR:000051681", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051681" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 43 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G14996IQ. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G14996IQ. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051682", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051682" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 44 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G14998UC. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G14998UC. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051683", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051683" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 45 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G16758MX. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G16758MX. [PRO:DNx, PMID:16834341]", "evidence": [ { "id": "PR:000051684", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051684" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 46 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G16828VN. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G16828VN. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051685", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051685" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 47 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G24131KD. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G24131KD. [PRO:DNx, PMID:16834341]", "evidence": [ { "id": "PR:000051686", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051686" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 48 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G24413UY. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G24413UY. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051687", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051687" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 49 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G24954RW. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G24954RW. [PRO:DNx, PMID:1457969, PMID:1820200]", "evidence": [ { "id": "PR:000051688", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051688" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 50 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G25835MT. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G25835MT. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051689", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051689" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 51 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G29857RC. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G29857RC. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051690", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051690" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 52 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G31372JR. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G31372JR. [PRO:DNx, PMID:16834341]", "evidence": [ { "id": "PR:000051691", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051691" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 53 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G36191CD. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G36191CD. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051692", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051692" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 54 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G38217AM. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G38217AM. [PRO:DNx, PMID:1457969, PMID:1820200]", "evidence": [ { "id": "PR:000051693", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051693" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 55 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G39540XG. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G39540XG. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051694", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051694" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 56 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G39917RN. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G39917RN. [PRO:DNx, PMID:16834341]", "evidence": [ { "id": "PR:000051695", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051695" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 57 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G41708PN. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G41708PN. [PRO:DNx, PMID:1457969, PMID:1820200]", "evidence": [ { "id": "PR:000051696", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051696" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 58 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G42358LZ. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G42358LZ. [PRO:DNx, PMID:16834341]", "evidence": [ { "id": "PR:000051697", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051697" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 59 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G42826YI. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G42826YI. [PRO:DNx, PMID:16834341]", "evidence": [ { "id": "PR:000051698", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051698" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 60 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G43346PX. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G43346PX. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051699", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051699" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 61 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G43664YB. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G43664YB. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051700", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051700" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 62 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G44659VQ. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G44659VQ. [PRO:DNx, PMID:16834341]", "evidence": [ { "id": "PR:000051701", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051701" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 63 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G49743VF. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G49743VF. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051702", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051702" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 64 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G51367TM. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G51367TM. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051703", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051703" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 65 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G53933HU. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G53933HU. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051704", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051704" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 66 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G53962WT. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G53962WT. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051705", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051705" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 67 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G53985AY. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G53985AY. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051706", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051706" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 68 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G55504WE. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G55504WE. [PRO:DNx, PMID:16834341]", "evidence": [ { "id": "PR:000051707", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051707" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 69 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G56271TF. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G56271TF. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051708", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051708" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 70 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G65890UA. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G65890UA. [PRO:DNx, PMID:1457969, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051709", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051709" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 71 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G69411IG. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G69411IG. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051710", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051710" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 72 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G77198CF. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G77198CF. [PRO:DNx, PMID:1457969, PMID:1820200]", "evidence": [ { "id": "PR:000051711", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051711" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 73 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G77252PU. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G77252PU. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051712", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051712" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 74 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G78059CC. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G78059CC. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051713", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051713" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 75 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G78890OB. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G78890OB. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051714", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051714" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 76 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G80678MA. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G80678MA. [PRO:DNx, PMID:16834341]", "evidence": [ { "id": "PR:000051715", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051715" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 77 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G84467IZ. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G84467IZ. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051716", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051716" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 78 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G86357DX. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G86357DX. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051717", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051717" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 79 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G91365ZQ. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G91365ZQ. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051718", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051718" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 80 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G93284HQ. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G93284HQ. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051719", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051719" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 81 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G96921ZU. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G96921ZU. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051720", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051720" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 82 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G97028UT. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G97028UT. [PRO:DNx, PMID:16834341]", "evidence": [ { "id": "PR:000051721", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051721" } ] }, { "name": "glycoprotein hormones alpha chain N-glycosylated 83 (human)", "definition": "A glycoprotein hormones alpha chain (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P01215-1, in which the glycan structure is represented by GlyTouCan:G99897FQ. Example: UniProtKB:P01215-1, Asn-76, MOD:00160~GNO:G99897FQ. [PRO:DNx, PMID:1820200, PMID:1991473, PMID:8026573, PMID:9449027]", "evidence": [ { "id": "PR:000051722", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051722" } ] } ], "site_annotation": [ { "start_pos": 102, "end_pos": 104, "annotation": "n_glycosylation_sequon" }, { "start_pos": 76, "end_pos": 78, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 76, 102 ], "o_linked_sites": [ 76, 78, 81 ], "snv_sites": [ 68, 76 ], "glycation_sites": [], "phosphorylation_sites": [ 63 ], "sequon_annotation_sites": [ { "start_pos": 102, "end_pos": 104 }, { "start_pos": 76, "end_pos": 78 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 183 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 97 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycans", "count": 15 }, { "field": "o_linked_glycan_sites", "count": 3 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 181 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 97 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 15 }, { "field": "o_linked_glycan_sites", "count": 3 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 179 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }