{ "uniprot_canonical_ac": "P01135-1", "uniprot_ac": "P01135", "uniprot_id": "TGFA_HUMAN", "mass": { "chemical_mass": 17006.0, "monoisotopic_mass": 17006.0 }, "refseq": { "ac": "NP_001093161", "name": "protransforming growth factor alpha isoform 2 preproprotein", "summary": "This gene encodes a growth factor that is a ligand for the epidermal growth factor receptor, which activates a signaling pathway for cell proliferation, differentiation and development. This protein may act as either a transmembrane-bound ligand or a soluble ligand. This gene has been associated with many types of cancers, and it may also be involved in some cases of cleft lip/palate. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093161" }, "gene_names": [ { "name": "TGFA", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P01135", "id": "P01135" }, { "name": "TFGA", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093161", "id": "NP_001093161" }, { "name": "TGFA", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093161", "id": "NP_001093161" } ], "protein_names": [ { "name": "Protransforming growth factor alpha", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P01135" }, { "name": "EGF-like TGF", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01135" }, { "name": "ETGF", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01135" }, { "name": "TGF type 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01135" }, { "name": "protransforming growth factor alpha isoform 2 preproprotein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093161", "id": "NP_001093161" }, { "name": "protransforming growth factor alpha; TGF-alpha", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093161", "id": "NP_001093161" } ], "function": [ { "annotation": "Autocrine TGF-alpha is associated with Benzo(a)pyrene-induced mucus production and MUC5AC expression during allergic asthma.", "evidence": [ { "database": "RefSeq", "id": "NP_001093161", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093161" }, { "database": "PubMed", "id": "36068759", "url": "https://glygen.org/publication/PubMed/36068759" } ] }, { "annotation": "CircRTN1 acts as a miR-431-5p sponge to promote thyroid cancer progression by upregulating TGFA.", "evidence": [ { "database": "RefSeq", "id": "NP_001093161", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093161" }, { "database": "PubMed", "id": "35804263", "url": "https://glygen.org/publication/PubMed/35804263" } ] }, { "annotation": "EGF, TGF-alpha and Amphiregulin Differently Regulate Endometrium-Derived Mesenchymal Stromal/Stem Cells. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001093161", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093161" }, { "database": "PubMed", "id": "37686213", "url": "https://glygen.org/publication/PubMed/37686213" } ] }, { "annotation": "Genetic markers for non-syndromic orofacial clefts in populations of European ancestry: a meta-analysis. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001093161", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093161" }, { "database": "PubMed", "id": "35075162", "url": "https://glygen.org/publication/PubMed/35075162" } ] }, { "annotation": "TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar.", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135#function" } ] }, { "annotation": "This gene encodes a growth factor that is a ligand for the epidermal growth factor receptor, which activates a signaling pathway for cell proliferation, differentiation and development. This protein may act as either a transmembrane-bound ligand or a soluble ligand. This gene has been associated with many types of cancers, and it may also be involved in some cases of cleft lip/palate. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011].", "evidence": [ { "database": "RefSeq", "id": "NP_001093161", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093161" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "P01135", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P01135" } ], "glycoeffect": [], "start_pos": 19, "end_pos": 19, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "A", "sequence_mut": "V", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "2", "chr_pos": "70514897", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "A19", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] }, { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] }, { "disease_id": "DOID:1319", "recommended_name": { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain." }, "synonyms": [ { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "BT - Brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult malignant brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm, adult", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of Brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of adult brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary malignant neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "tumor of the Brain", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P01135", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P01135" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 25, "end_pos": 25, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "2", "chr_pos": "70514880", "ref_nt": "T", "alt_nt": "C", "minor_allelic_frequency": "", "site_lbl": "N25", "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs200477881", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200477881" }, { "id": "rs200477881", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200477881" }, { "id": "rs200477881", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200477881" }, { "id": "rs200477881", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200477881#frequency_tab" }, { "id": "rs200477881", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200477881" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 25, "end_pos": 25, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->KST).", "chr_id": "2", "chr_pos": "70514878", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "N25", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs138392270", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138392270" }, { "id": "rs138392270", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138392270" }, { "id": "rs138392270", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs138392270#frequency_tab" }, { "id": "rs138392270", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs138392270" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 27, "end_pos": 27, "sequence_org": "T", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->NSK).", "chr_id": "2", "chr_pos": "70514873", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T27", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs138392270", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138392270" }, { "id": "rs138392270", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138392270" }, { "id": "rs138392270", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138392270" }, { "id": "rs138392270", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs138392270#frequency_tab" }, { "id": "rs138392270", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs138392270" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 27, "end_pos": 27, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->NSM).", "chr_id": "2", "chr_pos": "70514873", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T27", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs781919023", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781919023" }, { "id": "rs781919023", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781919023" }, { "id": "rs781919023", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs781919023" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 27, "end_pos": 27, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->NSP).", "chr_id": "2", "chr_pos": "70465656", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T27", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "77.67", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000163235", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163235" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "84.18", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000163235", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163235" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "76.91", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000163235", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163235" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "79.41", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000163235", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163235" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "50.6", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000163235", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163235" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "81.77", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000163235", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163235" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "80.15", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000163235", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163235" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "68.45", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000163235", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163235" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "72.17", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000163235", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163235" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "65.06", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000163235", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163235" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "68.86", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000163235", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163235" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "65.35", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000163235", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163235" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "70.1", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000163235", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163235" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P01135", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01135" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P01135", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01135" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P01135", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01135" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P01135", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01135" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P01135", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01135" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P01135", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01135" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P01135", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01135" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P01135", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01135" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P01135", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01135" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P01135", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01135" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P01135", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01135" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P01135", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01135" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "common_name": "Human" } ], "gene": [ { "name": "TGFA", "url": "https://www.uniprot.org/uniprot/P01135", "locus": { "chromosome": "2", "start_pos": 70447284, "end_pos": 70554193, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000163235", "url": "https://www.ensembl.org/id/ENSG00000163235" } ] } } ], "crossref": [ { "id": "ENSG00000163235", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163235", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P01135", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P01135", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "CHEMBL4662938", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4662938", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "TGFA", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=TGFA", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "7039", "url": "https://www.ncbi.nlm.nih.gov/gene/7039", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "11765", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=11765", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P01135", "url": "https://www.ebi.ac.uk/intact/interactors/id:P01135*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000742", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000742", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:7039", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7039", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "190170", "url": "http://www.omim.org/entry/190170", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P01135", "url": "https://www.nextprot.org/entry/NX_P01135", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "HCEWCRT", "url": "https://omabrowser.org/oma/group/HCEWCRT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4264046at2759", "url": "http://www.orthodb.org/?query=4264046at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10740", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10740", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10740:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10740:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1GK5", "url": "https://www.rcsb.org/structure/1GK5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1MOX", "url": "https://www.rcsb.org/structure/1MOX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1YUF", "url": "https://www.rcsb.org/structure/1YUF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1YUG", "url": "https://www.rcsb.org/structure/1YUG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2TGF", "url": "https://www.rcsb.org/structure/2TGF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3E50", "url": "https://www.rcsb.org/structure/3E50", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3TGF", "url": "https://www.rcsb.org/structure/3TGF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4TGF", "url": "https://www.rcsb.org/structure/4TGF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5KN5", "url": "https://www.rcsb.org/structure/5KN5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7SZ5", "url": "https://www.rcsb.org/structure/7SZ5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7SZ7", "url": "https://www.rcsb.org/structure/7SZ7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "P01135", "url": "https://pharos.nih.gov/targets/P01135", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P01135", "url": "http://purl.obolibrary.org/obo/PR_P01135", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-177929", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-177929", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-179812", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-179812", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-180292", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180292", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-180336", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180336", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-212718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212718", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5638303", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5638303", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6811558", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811558", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001093161", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093161", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "E7EPT6", "url": "https://www.uniprot.org/uniprot/E7EPT6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7EPT6-1", "url": "https://www.uniprot.org/uniprot/E7EPT6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8VNR3", "url": "https://www.uniprot.org/uniprot/F8VNR3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8VNR3-1", "url": "https://www.uniprot.org/uniprot/F8VNR3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WA74", "url": "https://www.uniprot.org/uniprot/F8WA74", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WA74-1", "url": "https://www.uniprot.org/uniprot/F8WA74-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y6S5", "url": "https://www.uniprot.org/uniprot/H0Y6S5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y6S5-1", "url": "https://www.uniprot.org/uniprot/H0Y6S5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01135-1", "url": "https://www.uniprot.org/uniprot/P01135-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01135-2", "url": "https://www.uniprot.org/uniprot/P01135-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01135-3", "url": "https://www.uniprot.org/uniprot/P01135-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01135-4", "url": "https://www.uniprot.org/uniprot/P01135-4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01135-5", "url": "https://www.uniprot.org/uniprot/P01135-5", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV", "length": 160, "header": "sp|P01135-1|TGFA_HUMAN Isoform 1 of Protransforming growth factor alpha OS=Homo sapiens OX=9606 GN=TGFA PE=1 SV=1 CANONICAL=P01135-1" }, "isoforms": [ { "isoform_ac": "E7EPT6-1", "url": "", "sequence": { "sequence": "MFKIGRGALDLFSELLSFGGIVLAACQALENSTSPLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV", "length": 165, "header": "tr|E7EPT6-1|TGFA_HUMAN Computationally mapped isoform of Protransforming growth factor alpha OS=Homo sapiens OX=9606 GN=TGFA PE=1 SV=1 CANONICAL=P01135-1" }, "locus": { "chromosome": "2", "start_pos": 70553241, "end_pos": 70450862, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000450929.5", "url": "https://www.ensembl.org/id/ENST00000450929.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000414127.1", "url": "https://www.ensembl.org/id/ENSP00000414127.1" } ] } }, { "isoform_ac": "F8VNR3-1", "url": "", "sequence": { "sequence": "MFKIGRGALDLFSELLSFGGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV", "length": 166, "header": "tr|F8VNR3-1|F8VNR3_HUMAN Computationally mapped isoform of Transforming growth factor alpha OS=Homo sapiens OX=9606 GN=TGFA PE=1 SV=1 CANONICAL=P01135-1" }, "locus": { "chromosome": "2", "start_pos": 70553241, "end_pos": 70450862, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000444975.5", "url": "https://www.ensembl.org/id/ENST00000444975.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000404131.1", "url": "https://www.ensembl.org/id/ENSP00000404131.1" } ] } }, { "isoform_ac": "F8WA74-1", "url": "", "sequence": { "sequence": "MVPSAGQLALFALGIVLAACQALENSTSPLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLI", "length": 120, "header": "tr|F8WA74-1|F8WA74_HUMAN Computationally mapped isoform of Transforming growth factor alpha OS=Homo sapiens OX=9606 GN=TGFA PE=1 SV=1 CANONICAL=P01135-1" }, "locus": { "chromosome": "2", "start_pos": 70553767, "end_pos": 70456341, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000394241.3", "url": "https://www.ensembl.org/id/ENST00000394241.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000377787.3", "url": "https://www.ensembl.org/id/ENSP00000377787.3" } ] } }, { "isoform_ac": "H0Y6S5-1", "url": "", "sequence": { "sequence": "XPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETGCRLY", "length": 131, "header": "tr|H0Y6S5-1|TGFA_HUMAN Computationally mapped isoform of Protransforming growth factor alpha OS=Homo sapiens OX=9606 GN=TGFA PE=1 SV=1 CANONICAL=P01135-1" }, "locus": { "chromosome": "2", "start_pos": 70465733, "end_pos": 70449607, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000419940.5", "url": "https://www.ensembl.org/id/ENST00000419940.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000407432.1", "url": "https://www.ensembl.org/id/ENSP00000407432.1" } ] } }, { "isoform_ac": "P01135-1", "url": "", "sequence": { "sequence": "MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV", "length": 160, "header": "sp|P01135-1|TGFA_HUMAN Isoform 1 of Protransforming growth factor alpha OS=Homo sapiens OX=9606 GN=TGFA PE=1 SV=1 CANONICAL=P01135-1" }, "locus": { "chromosome": "2", "start_pos": 70553767, "end_pos": 70450862, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000295400.11", "url": "https://www.ensembl.org/id/ENST00000295400.11" }, { "database": "Ensembl Peptide", "id": "ENSP00000295400.6", "url": "https://www.ensembl.org/id/ENSP00000295400.6" } ] } }, { "isoform_ac": "P01135-2", "url": "", "sequence": { "sequence": "MVPSAGQLALFALGIVLAACQALENSTSPLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV", "length": 159, "header": "sp|P01135-2|TGFA_HUMAN Isoform 2 of Protransforming growth factor alpha OS=Homo sapiens OX=9606 GN=TGFA PE=1 SV=1 CANONICAL=P01135-1" }, "locus": { "chromosome": "2", "start_pos": 70553767, "end_pos": 70450862, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000418333.6", "url": "https://www.ensembl.org/id/ENST00000418333.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000404099.2", "url": "https://www.ensembl.org/id/ENSP00000404099.2" } ] } }, { "isoform_ac": "P01135-3", "url": "", "sequence": { "sequence": "MVPSAGQLALFALGIVLAACQALENSTSPLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETATLG", "length": 161, "header": "sp|P01135-3|TGFA_HUMAN Isoform 3 of Protransforming growth factor alpha OS=Homo sapiens OX=9606 GN=TGFA PE=1 SV=1 CANONICAL=P01135-1" }, "locus": { "chromosome": "2", "start_pos": 70553767, "end_pos": 70451750, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000445399.5", "url": "https://www.ensembl.org/id/ENST00000445399.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000387493.1", "url": "https://www.ensembl.org/id/ENSP00000387493.1" } ] } }, { "isoform_ac": "P01135-4", "url": "", "sequence": { "sequence": "MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETGCRLY", "length": 163, "header": "sp|P01135-4|TGFA_HUMAN Isoform 4 of Protransforming growth factor alpha OS=Homo sapiens OX=9606 GN=TGFA PE=1 SV=1 CANONICAL=P01135-1" }, "locus": {} }, { "isoform_ac": "P01135-5", "url": "", "sequence": { "sequence": "MVPSAGQLALFALGIVLAACQALENSTSPLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETGCRLY", "length": 162, "header": "sp|P01135-5|TGFA_HUMAN Isoform 5 of Protransforming growth factor alpha OS=Homo sapiens OX=9606 GN=TGFA PE=1 SV=1 CANONICAL=P01135-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 25, "start_aa": "Asn", "end_pos": 25, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn25", "evidence": [ { "id": "P01135", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01135#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "TGFA: exon-intron structure and evaluation as a candidate gene for Alstrom syndrome.", "journal": "Clin. Genet.", "date": "1999", "authors": "Collin G B, Marshall J D, Naggert J K, Nishina P M", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "reference": [ { "type": "PubMed", "id": "10066034", "url": "https://glygen.org/publication/PubMed/10066034" } ] }, { "title": "The beta2-adrenergic receptor/betaarrestin complex recruits the clathrin adaptor AP-2 during endocytosis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Laporte SA, Oakley RH, Zhang J, Holt JA, Ferguson SS, Caron MG, Barak LS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "10097102", "url": "https://glygen.org/publication/PubMed/10097102" } ] }, { "title": "Akt promotes cell survival by phosphorylating and inhibiting a Forkhead transcription factor.", "journal": "Cell", "date": "1999", "authors": "Brunet A, Bonni A, Zigmond MJ, Lin MZ, Juo P, Hu LS, Anderson MJ, Arden KC, Blenis J, Greenberg ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "10102273", "url": "https://glygen.org/publication/PubMed/10102273" } ] }, { "title": "Activation of serum- and glucocorticoid-regulated protein kinase by agonists that activate phosphatidylinositide 3-kinase is mediated by 3-phosphoinositide-dependent protein kinase-1 (PDK1) and PDK2.", "journal": "The Biochemical journal", "date": "1999", "authors": "Kobayashi T, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "10191262", "url": "https://glygen.org/publication/PubMed/10191262" } ] }, { "title": "Non-transcriptional action of oestradiol and progestin triggers DNA synthesis.", "journal": "The EMBO journal", "date": "1999", "authors": "Castoria G, Barone MV, Di Domenico M, Bilancio A, Ametrano D, Migliaccio A, Auricchio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "10228164", "url": "https://glygen.org/publication/PubMed/10228164" } ] }, { "title": "A role for a PDZ protein in the early secretory pathway for the targeting of proTGF-alpha to the cell surface.", "journal": "Mol. Cell", "date": "1999", "authors": "Fernandez-Larrea J, Merlos-Suarez A, Urena JM, Baselga J, Arribas J", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "reference": [ { "type": "PubMed", "id": "10230395", "url": "https://glygen.org/publication/PubMed/10230395" } ] }, { "title": "Enhancement of insulin-like growth factor signaling in human breast cancer: estrogen regulation of insulin receptor substrate-1 expression in vitro and in vivo.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1999", "authors": "Lee AV, Jackson JG, Gooch JL, Hilsenbeck SG, Coronado-Heinsohn E, Osborne CK, Yee D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "10319328", "url": "https://glygen.org/publication/PubMed/10319328" } ] }, { "title": "Shc and FAK differentially regulate cell motility and directionality modulated by PTEN.", "journal": "The Journal of cell biology", "date": "1999", "authors": "Gu J, Tamura M, Pankov R, Danen EH, Takino T, Matsumoto K, Yamada KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "10427092", "url": "https://glygen.org/publication/PubMed/10427092" } ] }, { "title": "Clathrin assembly lymphoid myeloid leukemia (CALM) protein: localization in endocytic-coated pits, interactions with clathrin, and the impact of overexpression on clathrin-mediated traffic.", "journal": "Molecular biology of the cell", "date": "1999", "authors": "Tebar F, Bohlander SK, Sorkin A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "10436022", "url": "https://glygen.org/publication/PubMed/10436022" } ] }, { "title": "NSF N-terminal domain crystal structure: models of NSF function.", "journal": "Molecular cell", "date": "1999", "authors": "Yu RC, Jahn R, Brunger AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "10445031", "url": "https://glygen.org/publication/PubMed/10445031" } ] }, { "title": "AP2alpha and AP2gamma: a comparison of binding site specificity and trans-activation of the estrogen receptor promoter and single site promoter constructs.", "journal": "Nucleic acids research", "date": "1999", "authors": "McPherson LA, Weigel RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "10497269", "url": "https://glygen.org/publication/PubMed/10497269" } ] }, { "title": "Estrogen induction of the cyclin D1 promoter: involvement of a cAMP response-like element.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Sabbah M, Courilleau D, Mester J, Redeuilh G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "10500157", "url": "https://glygen.org/publication/PubMed/10500157" } ] }, { "title": "Two co-existing mechanisms for nuclear import of MAP kinase: passive diffusion of a monomer and active transport of a dimer.", "journal": "The EMBO journal", "date": "1999", "authors": "Adachi M, Fukuda M, Nishida E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "10508167", "url": "https://glygen.org/publication/PubMed/10508167" } ] }, { "title": "The tyrosine kinase negative regulator c-Cbl as a RING-type, E2-dependent ubiquitin-protein ligase.", "journal": "Science (New York, N.Y.)", "date": "1999", "authors": "Joazeiro CA, Wing SS, Huang H, Leverson JD, Hunter T, Liu YC", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "10514377", "url": "https://glygen.org/publication/PubMed/10514377" } ] }, { "title": "Human keratinocytes and tumor-derived cell lines express alternatively spliced forms of transforming growth factor-alpha mRNA, encoding precursors lacking carboxyl-terminal valine residues.", "journal": "Oncogene", "date": "1999", "authors": "Xu X, Liao J, Creek K E, Pirisi L", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "reference": [ { "type": "PubMed", "id": "10523832", "url": "https://glygen.org/publication/PubMed/10523832" } ] }, { "title": "Essential role of phosphoinositide metabolism in synaptic vesicle recycling.", "journal": "Cell", "date": "1999", "authors": "Cremona O, Di Paolo G, Wenk MR, Luthi A, Kim WT, Takei K, Daniell L, Nemoto Y, Shears SB, Flavell RA, McCormick DA, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10535736", "url": "https://glygen.org/publication/PubMed/10535736" } ] }, { "title": "The SH3 domains of endophilin and amphiphysin bind to the proline-rich region of synaptojanin 1 at distinct sites that display an unconventional binding specificity.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Cestra G, Castagnoli L, Dente L, Minenkova O, Petrelli A, Migone N, Hoffmuller U, Schneider-Mergener J, Cesareni G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10542231", "url": "https://glygen.org/publication/PubMed/10542231" } ] }, { "title": "Mechanisms of transcriptional activation of bcl-2 gene expression by 17beta-estradiol in breast cancer cells.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Dong L, Wang W, Wang F, Stoner M, Reed JC, Harigai M, Samudio I, Kladde MP, Vyhlidal C, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "10542244", "url": "https://glygen.org/publication/PubMed/10542244" } ] }, { "title": "Transforming growth factor-alpha (TGFA): genomic structure, boundary sequences, and mutation analysis in nonsyndromic cleft lip/palate and cleft palate only.", "journal": "Genomics", "date": "1999", "authors": "Machida J, Yoshiura K i, Funkhauser C D, Natsume N, Kawai T, Murray J C", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "reference": [ { "type": "PubMed", "id": "10552925", "url": "https://glygen.org/publication/PubMed/10552925" } ] }, { "title": "Spatial control of coated-pit dynamics in living cells.", "journal": "Nature cell biology", "date": "1999", "authors": "Gaidarov I, Santini F, Warren RA, Keen JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10559856", "url": "https://glygen.org/publication/PubMed/10559856" } ] }, { "title": "Functional partnership between amphiphysin and dynamin in clathrin-mediated endocytosis.", "journal": "Nature cell biology", "date": "1999", "authors": "Takei K, Slepnev VI, Haucke V, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10559861", "url": "https://glygen.org/publication/PubMed/10559861" } ] }, { "title": "Phosphatidylinositol-3-OH kinases are Rab5 effectors.", "journal": "Nature cell biology", "date": "1999", "authors": "Christoforidis S, Miaczynska M, Ashman K, Wilm M, Zhao L, Yip SC, Waterfield MD, Backer JM, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10559924", "url": "https://glygen.org/publication/PubMed/10559924" } ] }, { "title": "The lectin ERGIC-53 is a cargo transport receptor for glycoproteins.", "journal": "Nature cell biology", "date": "1999", "authors": "Appenzeller C, Andersson H, Kappeler F, Hauri HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "10559958", "url": "https://glygen.org/publication/PubMed/10559958" } ] }, { "title": "An NSF function distinct from ATPase-dependent SNARE disassembly is essential for Golgi membrane fusion.", "journal": "Nature cell biology", "date": "1999", "authors": "Muller JM, Rabouille C, Newman R, Shorter J, Freemont P, Schiavo G, Warren G, Shima DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "10559959", "url": "https://glygen.org/publication/PubMed/10559959" } ] }, { "title": "The epsins define a family of proteins that interact with components of the clathrin coat and contain a new protein module.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Rosenthal JA, Chen H, Slepnev VI, Pellegrini L, Salcini AE, Di Fiore PP, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "10567358", "url": "https://glygen.org/publication/PubMed/10567358" } ] }, { "title": "Phospholipase C-gamma as a signal-transducing element.", "journal": "Experimental cell research", "date": "1999", "authors": "Carpenter G, Ji Qs", "evidence": [ { "database": "Reactome", "id": "R-HSA-212718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212718" } ], "reference": [ { "type": "PubMed", "id": "10579907", "url": "https://glygen.org/publication/PubMed/10579907" } ] }, { "title": "The eps15 homology (EH) domain-based interaction between eps15 and hrb connects the molecular machinery of endocytosis to that of nucleocytosolic transport.", "journal": "The Journal of cell biology", "date": "1999", "authors": "Doria M, Salcini AE, Colombo E, Parslow TG, Pelicci PG, Di Fiore PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "10613896", "url": "https://glygen.org/publication/PubMed/10613896" } ] }, { "title": "Role of cyclin G-associated kinase in uncoating clathrin-coated vesicles from non-neuronal cells.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Greener T, Zhao X, Nojima H, Eisenberg E, Greene LE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10625686", "url": "https://glygen.org/publication/PubMed/10625686" } ] }, { "title": "A novel positive feedback loop mediated by the docking protein Gab1 and phosphatidylinositol 3-kinase in epidermal growth factor receptor signaling.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Rodrigues GA, Falasca M, Zhang Z, Ong SH, Schlessinger J", "evidence": [ { "database": "Reactome", "id": "R-HSA-180292", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180292" } ], "reference": [ { "type": "PubMed", "id": "10648629", "url": "https://glygen.org/publication/PubMed/10648629" } ] }, { "title": "AP-2 family members regulate basal and cAMP-induced expression of human chorionic gonadotropin.", "journal": "Nucleic acids research", "date": "2000", "authors": "LiCalsi C, Christophe S, Steger DJ, Buescher M, Fischer W, Mellon PL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "10648798", "url": "https://glygen.org/publication/PubMed/10648798" } ] }, { "title": "ERGIC-53 and traffic in the secretory pathway.", "journal": "Journal of cell science", "date": "2000", "authors": "Hauri HP, Kappeler F, Andersson H, Appenzeller C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "10652252", "url": "https://glygen.org/publication/PubMed/10652252" } ] }, { "title": "Mapping of Eps15 domains involved in its targeting to clathrin-coated pits.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Benmerah A, Poupon V, Cerf-Bensussan N, Dautry-Varsat A", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "10652316", "url": "https://glygen.org/publication/PubMed/10652316" } ] }, { "title": "The role of the tethering proteins p115 and GM130 in transport through the Golgi apparatus in vivo.", "journal": "Molecular biology of the cell", "date": "2000", "authors": "Seemann J, Jokitalo EJ, Warren G", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "10679020", "url": "https://glygen.org/publication/PubMed/10679020" } ] }, { "title": "Sustained recruitment of phospholipase C-gamma to Gab1 is required for HGF-induced branching tubulogenesis.", "journal": "Oncogene", "date": "2000", "authors": "Gual P, Giordano S, Williams TA, Rocchi S, Van Obberghen E, Comoglio PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-180292", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180292" } ], "reference": [ { "type": "PubMed", "id": "10734310", "url": "https://glygen.org/publication/PubMed/10734310" } ] }, { "title": "Asymmetric requirements for a Rab GTPase and SNARE proteins in fusion of COPII vesicles with acceptor membranes.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Cao X, Barlowe C", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "10747087", "url": "https://glygen.org/publication/PubMed/10747087" } ] }, { "title": "Estrogen receptor alpha rapidly activates the IGF-1 receptor pathway.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Kahlert S, Nuedling S, van Eickels M, Vetter H, Meyer R, Grohe C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "10749889", "url": "https://glygen.org/publication/PubMed/10749889" } ] }, { "title": "The class II phosphoinositide 3-kinase PI3K-C2alpha is concentrated in the trans-Golgi network and present in clathrin-coated vesicles.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Domin J, Gaidarov I, Smith ME, Keen JH, Waterfield MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10766823", "url": "https://glygen.org/publication/PubMed/10766823" } ] }, { "title": "Cytosolic adaptor protein Dab2 is an intracellular ligand of endocytic receptor gp600/megalin.", "journal": "The Biochemical journal", "date": "2000", "authors": "Oleinikov AV, Zhao J, Makker SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "10769163", "url": "https://glygen.org/publication/PubMed/10769163" } ] }, { "title": "FAK integrates growth-factor and integrin signals to promote cell migration.", "journal": "Nature cell biology", "date": "2000", "authors": "Sieg DJ, Hauck CR, Ilic D, Klingbeil CK, Schaefer E, Damsky CH, Schlaepfer DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "10806474", "url": "https://glygen.org/publication/PubMed/10806474" } ] }, { "title": "COPI-coated ER-to-Golgi transport complexes segregate from COPII in close proximity to ER exit sites.", "journal": "Journal of cell science", "date": "2000", "authors": "Stephens DJ, Lin-Marq N, Pagano A, Pepperkok R, Paccaud JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "10825291", "url": "https://glygen.org/publication/PubMed/10825291" } ] }, { "title": "Transcriptional activation of transforming growth factor alpha by estradiol: requirement for both a GC-rich site and an estrogen response element half-site.", "journal": "Journal of molecular endocrinology", "date": "2000", "authors": "Vyhlidal C, Samudio I, Kladde MP, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "10828826", "url": "https://glygen.org/publication/PubMed/10828826" } ] }, { "title": "Phosphorylation at serine 10, a major phosphorylation site of p27(Kip1), increases its protein stability.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Ishida N, Kitagawa M, Hatakeyama S, Nakayama K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "10831586", "url": "https://glygen.org/publication/PubMed/10831586" } ] }, { "title": "A novel RalGEF-like protein, RGL3, as a candidate effector for rit and Ras.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Shao H, Andres DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "10869344", "url": "https://glygen.org/publication/PubMed/10869344" } ] }, { "title": "Promoter analysis and chromosomal mapping of human EBAG9 gene.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Ikeda K, Sato M, Tsutsumi O, Tsuchiya F, Tsuneizumi M, Emi M, Imoto I, Inazawa J, Muramatsu M, Inoue S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "10873660", "url": "https://glygen.org/publication/PubMed/10873660" } ] }, { "title": "Rab1 recruitment of p115 into a cis-SNARE complex: programming budding COPII vesicles for fusion.", "journal": "Science (New York, N.Y.)", "date": "2000", "authors": "Allan BB, Moyer BD, Balch WE", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "10903204", "url": "https://glygen.org/publication/PubMed/10903204" } ] }, { "title": "Identification of an atypical Grb2 carboxyl-terminal SH3 domain binding site in Gab docking proteins reveals Grb2-dependent and -independent recruitment of Gab1 to receptor tyrosine kinases.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Lock LS, Royal I, Naujokas MA, Park M", "evidence": [ { "database": "Reactome", "id": "R-HSA-180292", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180292" } ], "reference": [ { "type": "PubMed", "id": "10913131", "url": "https://glygen.org/publication/PubMed/10913131" } ] }, { "title": "Tyrosine phosphorylation of Eps15 is required for ligand-regulated, but not constitutive, endocytosis.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Confalonieri S, Salcini AE, Puri C, Tacchetti C, Di Fiore PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "10953014", "url": "https://glygen.org/publication/PubMed/10953014" } ] }, { "title": "Dynamics of transitional endoplasmic reticulum sites in vertebrate cells.", "journal": "Molecular biology of the cell", "date": "2000", "authors": "Hammond AT, Glick BS", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "10982397", "url": "https://glygen.org/publication/PubMed/10982397" } ] }, { "title": "The hPLIC proteins may provide a link between the ubiquitination machinery and the proteasome.", "journal": "Molecular cell", "date": "2000", "authors": "Kleijnen MF, Shih AH, Zhou P, Kumar S, Soccio RE, Kedersha NL, Gill G, Howley PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "10983987", "url": "https://glygen.org/publication/PubMed/10983987" } ] }, { "title": "Synergistic, p160 coactivator-dependent enhancement of estrogen receptor function by CARM1 and p300.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Chen D, Huang SM, Stallcup MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11010967", "url": "https://glygen.org/publication/PubMed/11010967" } ] }, { "title": "Flt3 ligand induces tyrosine phosphorylation of gab1 and gab2 and their association with shp-2, grb2, and PI3 kinase.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Zhang S, Broxmeyer HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "11027663", "url": "https://glygen.org/publication/PubMed/11027663" } ] }, { "title": "Interaction of oestrogen receptor with the regulatory subunit of phosphatidylinositol-3-OH kinase.", "journal": "Nature", "date": "2000", "authors": "Simoncini T, Hafezi-Moghadam A, Brazil DP, Ley K, Chin WW, Liao JK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "11029009", "url": "https://glygen.org/publication/PubMed/11029009" } ] }, { "title": "Membrane estrogen receptor engagement activates endothelial nitric oxide synthase via the PI3-kinase-Akt pathway in human endothelial cells.", "journal": "Circulation research", "date": "2000", "authors": "Haynes MP, Sinha D, Russell KS, Collinge M, Fulton D, Morales-Ruiz M, Sessa WC, Bender JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "11029403", "url": "https://glygen.org/publication/PubMed/11029403" } ] }, { "title": "MYB oncogene amplification in hereditary BRCA1 breast cancer.", "journal": "Cancer research", "date": "2000", "authors": "Kauraniemi P, Hedenfalk I, Persson K, Duggan DJ, Tanner M, Johannsson O, Olsson H, Trent JM, Isola J, Borg A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11034064", "url": "https://glygen.org/publication/PubMed/11034064" } ] }, { "title": "Subunit structure of a mammalian ER/Golgi SNARE complex.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Xu D, Joglekar AP, Williams AL, Hay JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "11035026", "url": "https://glygen.org/publication/PubMed/11035026" } ] }, { "title": "Estrogen-induced activation of Erk-1 and Erk-2 requires the G protein-coupled receptor homolog, GPR30, and occurs via trans-activation of the epidermal growth factor receptor through release of HB-EGF.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2000", "authors": "Filardo EJ, Quinn JA, Bland KI, Frackelton AR Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "11043579", "url": "https://glygen.org/publication/PubMed/11043579" } ] }, { "title": "Estrogen induces the Akt-dependent activation of endothelial nitric-oxide synthase in vascular endothelial cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Hisamoto K, Ohmichi M, Kurachi H, Hayakawa J, Kanda Y, Nishio Y, Adachi K, Tasaka K, Miyoshi E, Fujiwara N, Taniguchi N, Murata Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "11044445", "url": "https://glygen.org/publication/PubMed/11044445" } ] }, { "title": "Multiple C-terminal motifs of the 46-kDa mannose 6-phosphate receptor tail contribute to efficient binding of medium chains of AP-2 and AP-3.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Storch S, Braulke T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11071885", "url": "https://glygen.org/publication/PubMed/11071885" } ] }, { "title": "Identification of ubiquilin, a novel presenilin interactor that increases presenilin protein accumulation.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Mah AL, Perry G, Smith MA, Monteiro MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11076969", "url": "https://glygen.org/publication/PubMed/11076969" } ] }, { "title": "All three PACSIN isoforms bind to endocytic proteins and inhibit endocytosis.", "journal": "Journal of cell science", "date": "2000", "authors": "Modregger J, Ritter B, Witter B, Paulsson M, Plomann M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11082044", "url": "https://glygen.org/publication/PubMed/11082044" } ] }, { "title": "Flt3 mutations from patients with acute myeloid leukemia induce transformation of 32D cells mediated by the Ras and STAT5 pathways.", "journal": "Blood", "date": "2000", "authors": "Mizuki M, Fenski R, Halfter H, Matsumura I, Schmidt R, Muller C, Gruning W, Kratz-Albers K, Serve S, Steur C, Buchner T, Kienast J, Kanakura Y, Berdel WE, Serve H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "11090077", "url": "https://glygen.org/publication/PubMed/11090077" } ] }, { "title": "PDZK1 and GREB1 are estrogen-regulated genes expressed in hormone-responsive breast cancer.", "journal": "Cancer research", "date": "2000", "authors": "Ghosh MG, Thompson DA, Weigel RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11103799", "url": "https://glygen.org/publication/PubMed/11103799" } ] }, { "title": "Cofactor dynamics and sufficiency in estrogen receptor-regulated transcription.", "journal": "Cell", "date": "2000", "authors": "Shang Y, Hu X, DiRenzo J, Lazar MA, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11136970", "url": "https://glygen.org/publication/PubMed/11136970" } ] }, { "title": "Crystal structure and functional analysis of Ras binding to its effector phosphoinositide 3-kinase gamma.", "journal": "Cell", "date": "2000", "authors": "Pacold ME, Suire S, Perisic O, Lara-Gonzalez S, Davis CT, Walker EH, Hawkins PT, Stephens L, Eccleston JF, Williams RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "11136978", "url": "https://glygen.org/publication/PubMed/11136978" } ] }, { "title": "Estrogen receptor-mediated activation of the serum response element in MCF-7 cells through MAPK-dependent phosphorylation of Elk-1.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Duan R, Xie W, Burghardt RC, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "11145955", "url": "https://glygen.org/publication/PubMed/11145955" } ] }, { "title": "Transcriptional activation of cathepsin D gene expression by 17beta-estradiol: mechanism of aryl hydrocarbon receptor-mediated inhibition.", "journal": "Molecular and cellular endocrinology", "date": "2001", "authors": "Wang F, Samudio I, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11165043", "url": "https://glygen.org/publication/PubMed/11165043" } ] }, { "title": "Sphingosine 1-phosphate activates Erk-1/-2 by transactivating epidermal growth factor receptor in rat-2 cells.", "journal": "IUBMB life", "date": "2000", "authors": "Kim JH, Kim JH, Song WK, Kim JH, Chun JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "11185956", "url": "https://glygen.org/publication/PubMed/11185956" } ] }, { "title": "Clathrin uncoating: Auxilin comes to life.", "journal": "Current biology : CB", "date": "2001", "authors": "Lemmon SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11231140", "url": "https://glygen.org/publication/PubMed/11231140" } ] }, { "title": "The class II phosphoinositide 3-kinase C2alpha is activated by clathrin and regulates clathrin-mediated membrane trafficking.", "journal": "Molecular cell", "date": "2001", "authors": "Gaidarov I, Smith ME, Domin J, Keen JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11239472", "url": "https://glygen.org/publication/PubMed/11239472" } ] }, { "title": "Reduction in cyclin D1/Cdk4/retinoblastoma protein signaling by CRE-decoy oligonucleotide.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Park YG, Park S, Lim SO, Lee MS, Ryu CK, Kim I, Cho-Chung YS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "11243864", "url": "https://glygen.org/publication/PubMed/11243864" } ] }, { "title": "Disabled-2 colocalizes with the LDLR in clathrin-coated pits and interacts with AP-2.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2001", "authors": "Morris SM, Cooper JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11247302", "url": "https://glygen.org/publication/PubMed/11247302" } ] }, { "title": "Rab1 interaction with a GM130 effector complex regulates COPII vesicle cis--Golgi tethering.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2001", "authors": "Moyer BD, Allan BB, Balch WE", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "11285137", "url": "https://glygen.org/publication/PubMed/11285137" } ] }, { "title": "The Golgi matrix protein GM130: a specific interacting partner of the small GTPase rab1b.", "journal": "EMBO reports", "date": "2001", "authors": "Weide T, Bayer M, Koster M, Siebrasse JP, Peters R, Barnekow A", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "11306556", "url": "https://glygen.org/publication/PubMed/11306556" } ] }, { "title": "A novel potential effector of M-Ras and p21 Ras negatively regulates p21 Ras-mediated gene induction and cell growth.", "journal": "Oncogene", "date": "2001", "authors": "Ehrhardt GR, Korherr C, Wieler JS, Knaus M, Schrader JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "11313946", "url": "https://glygen.org/publication/PubMed/11313946" } ] }, { "title": "Phosphotyrosines 627 and 659 of Gab1 constitute a bisphosphoryl tyrosine-based activation motif (BTAM) conferring binding and activation of SHP2.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Cunnick JM, Mei L, Doupnik CA, Wu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-180292", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180292" } ], "reference": [ { "type": "PubMed", "id": "11323411", "url": "https://glygen.org/publication/PubMed/11323411" } ] }, { "title": "Transcriptional activation of genes by 17 beta-estradiol through estrogen receptor-Sp1 interactions.", "journal": "Vitamins and hormones", "date": "2001", "authors": "Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11345900", "url": "https://glygen.org/publication/PubMed/11345900" } ] }, { "title": "Plasma membrane estrogen receptors are coupled to endothelial nitric-oxide synthase through Galpha(i).", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Wyckoff MH, Chambliss KL, Mineo C, Yuhanna IS, Mendelsohn ME, Mumby SM, Shaul PW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "11369763", "url": "https://glygen.org/publication/PubMed/11369763" } ] }, { "title": "Estrogen regulation of cyclin D1 gene expression in ZR-75 breast cancer cells involves multiple enhancer elements.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Castro-Rivera E, Samudio I, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11410592", "url": "https://glygen.org/publication/PubMed/11410592" } ] }, { "title": "Estrogen receptor interaction with estrogen response elements.", "journal": "Nucleic acids research", "date": "2001", "authors": "Klinge CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11452016", "url": "https://glygen.org/publication/PubMed/11452016" } ] }, { "title": "Human stoned B interacts with AP-2 and synaptotagmin and facilitates clathrin-coated vesicle uncoating.", "journal": "EMBO reports", "date": "2001", "authors": "Walther K, Krauss M, Diril MK, Lemke S, Ricotta D, Honing S, Kaiser S, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11454741", "url": "https://glygen.org/publication/PubMed/11454741" } ] }, { "title": "Multiple interactions of auxilin 1 with clathrin and the AP-2 adaptor complex.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Scheele U, Kalthoff C, Ungewickell E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11470803", "url": "https://glygen.org/publication/PubMed/11470803" } ] }, { "title": "Phosphorylation of threonine 156 of the mu2 subunit of the AP2 complex is essential for endocytosis in vitro and in vivo.", "journal": "Current biology : CB", "date": "2001", "authors": "Olusanya O, Andrews PD, Swedlow JR, Smythe E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11516654", "url": "https://glygen.org/publication/PubMed/11516654" } ] }, { "title": "HIP1 functions in clathrin-mediated endocytosis through binding to clathrin and adaptor protein 2.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Metzler M, Legendre-Guillemin V, Gan L, Chopra V, Kwok A, McPherson PS, Hayden MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11517213", "url": "https://glygen.org/publication/PubMed/11517213" } ] }, { "title": "The huntingtin interacting protein HIP1 is a clathrin and alpha-adaptin-binding protein involved in receptor-mediated endocytosis.", "journal": "Human molecular genetics", "date": "2001", "authors": "Waelter S, Scherzinger E, Hasenbank R, Nordhoff E, Lurz R, Goehler H, Gauss C, Sathasivam K, Bates GP, Lehrach H, Wanker EE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11532990", "url": "https://glygen.org/publication/PubMed/11532990" } ] }, { "title": "Evidence for existence of a nuclear pore complex-mediated, cytosol-independent pathway of nuclear translocation of ERK MAP kinase in permeabilized cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Matsubayashi Y, Fukuda M, Nishida E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "11546808", "url": "https://glygen.org/publication/PubMed/11546808" } ] }, { "title": "Clathrin- and AP-2-binding sites in HIP1 uncover a general assembly role for endocytic accessory proteins.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Mishra SK, Agostinelli NR, Brett TJ, Mizukami I, Ross TS, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11577110", "url": "https://glygen.org/publication/PubMed/11577110" } ] }, { "title": "Selective coactivation of estrogen-dependent transcription by CITED1 CBP/p300-binding protein.", "journal": "Genes & development", "date": "2001", "authors": "Yahata T, Shao W, Endoh H, Hur J, Coser KR, Sun H, Ueda Y, Kato S, Isselbacher KJ, Brown M, Shioda T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11581164", "url": "https://glygen.org/publication/PubMed/11581164" } ] }, { "title": "Regulation of receptor fate by ubiquitination of activated beta 2-adrenergic receptor and beta-arrestin.", "journal": "Science (New York, N.Y.)", "date": "2001", "authors": "Shenoy SK, McDonald PH, Kohout TA, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11588219", "url": "https://glygen.org/publication/PubMed/11588219" } ] }, { "title": "Unique phosphorylation mechanism of Gab1 using PI 3-kinase as an adaptor protein.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Onishi-Haraikawa Y, Funaki M, Gotoh N, Shibuya M, Inukai K, Katagiri H, Fukushima Y, Anai M, Ogihara T, Sakoda H, Ono H, Kikuchi M, Oka Y, Asano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-180292", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180292" } ], "reference": [ { "type": "PubMed", "id": "11606067", "url": "https://glygen.org/publication/PubMed/11606067" } ] }, { "title": "Synergism between ERalpha transactivation function 1 (AF-1) and AF-2 mediated by steroid receptor coactivator protein-1: requirement for the AF-1 alpha-helical core and for a direct interaction between the N- and C-terminal domains.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2001", "authors": "Metivier R, Penot G, Flouriot G, Pakdel F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11682626", "url": "https://glygen.org/publication/PubMed/11682626" } ] }, { "title": "PI3-kinase in concert with Src promotes the S-phase entry of oestradiol-stimulated MCF-7 cells.", "journal": "The EMBO journal", "date": "2001", "authors": "Castoria G, Migliaccio A, Bilancio A, Di Domenico M, de Falco A, Lombardi M, Fiorentino R, Varricchio L, Barone MV, Auricchio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "11689445", "url": "https://glygen.org/publication/PubMed/11689445" } ] }, { "title": "PEA-15 mediates cytoplasmic sequestration of ERK MAP kinase.", "journal": "Developmental cell", "date": "2001", "authors": "Formstecher E, Ramos JW, Fauquet M, Calderwood DA, Hsieh JC, Canton B, Nguyen XT, Barnier JV, Camonis J, Ginsberg MH, Chneiweiss H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "11702783", "url": "https://glygen.org/publication/PubMed/11702783" } ] }, { "title": "p27 cytoplasmic localization is regulated by phosphorylation on Ser10 and is not a prerequisite for its proteolysis.", "journal": "The EMBO journal", "date": "2001", "authors": "Rodier G, Montagnoli A, Di Marcotullio L, Coulombe P, Draetta GF, Pagano M, Meloche S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "11726503", "url": "https://glygen.org/publication/PubMed/11726503" } ] }, { "title": "ERs associate with and regulate the production of caveolin: implications for signaling and cellular actions.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2002", "authors": "Razandi M, Oh P, Pedram A, Schnitzer J, Levin ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "11773442", "url": "https://glygen.org/publication/PubMed/11773442" } ] }, { "title": "Linkage of rapid estrogen action to MAPK activation by ERalpha-Shc association and Shc pathway activation.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2002", "authors": "Song RX, McPherson RA, Adam L, Bao Y, Shupnik M, Kumar R, Santen RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "11773443", "url": "https://glygen.org/publication/PubMed/11773443" } ] }, { "title": "Rac1 and RhoG promote cell survival by the activation of PI3K and Akt, independently of their ability to stimulate JNK and NF-kappaB.", "journal": "Oncogene", "date": "2002", "authors": "Murga C, Zohar M, Teramoto H, Gutkind JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "11803464", "url": "https://glygen.org/publication/PubMed/11803464" } ] }, { "title": "A mutant EGF-receptor defective in ubiquitylation and endocytosis unveils a role for Grb2 in negative signaling.", "journal": "The EMBO journal", "date": "2002", "authors": "Waterman H, Katz M, Rubin C, Shtiegman K, Lavi S, Elson A, Jovin T, Yarden Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "11823423", "url": "https://glygen.org/publication/PubMed/11823423" } ] }, { "title": "CD44 anchors the assembly of matrilysin/MMP-7 with heparin-binding epidermal growth factor precursor and ErbB4 and regulates female reproductive organ remodeling.", "journal": "Genes & development", "date": "2002", "authors": "Yu WH, Woessner JF Jr, McNeish JD, Stamenkovic I", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "11825873", "url": "https://glygen.org/publication/PubMed/11825873" } ] }, { "title": "Expression of FKHR, FKHRL1, and AFX genes in the rodent ovary: evidence for regulation by IGF-I, estrogen, and the gonadotropins.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2002", "authors": "Richards JS, Sharma SC, Falender AE, Lo YH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "11875118", "url": "https://glygen.org/publication/PubMed/11875118" } ] }, { "title": "Phosphorylation of the AP2 mu subunit by AAK1 mediates high affinity binding to membrane protein sorting signals.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Ricotta D, Conner SD, Schmid SL, von Figura K, Honing S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11877457", "url": "https://glygen.org/publication/PubMed/11877457" } ] }, { "title": "Identification of an adaptor-associated kinase, AAK1, as a regulator of clathrin-mediated endocytosis.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Conner SD, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11877461", "url": "https://glygen.org/publication/PubMed/11877461" } ] }, { "title": "Phosphorylation of p27Kip1 on serine 10 is required for its binding to CRM1 and nuclear export.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Ishida N, Hara T, Kamura T, Yoshida M, Nakayama K, Nakayama KI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "11889117", "url": "https://glygen.org/publication/PubMed/11889117" } ] }, { "title": "HIP1 and HIP12 display differential binding to F-actin, AP2, and clathrin. Identification of a novel interaction with clathrin light chain.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Legendre-Guillemin V, Metzler M, Charbonneau M, Gan L, Chopra V, Philie J, Hayden MR, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11889126", "url": "https://glygen.org/publication/PubMed/11889126" } ] }, { "title": "Cbl-CIN85-endophilin complex mediates ligand-induced downregulation of EGF receptors.", "journal": "Nature", "date": "2002", "authors": "Soubeyran P, Kowanetz K, Szymkiewicz I, Langdon WY, Dikic I", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "11894095", "url": "https://glygen.org/publication/PubMed/11894095" } ] }, { "title": "A single motif responsible for ubiquitin recognition and monoubiquitination in endocytic proteins.", "journal": "Nature", "date": "2002", "authors": "Polo S, Sigismund S, Faretta M, Guidi M, Capua MR, Bossi G, Chen H, De Camilli P, Di Fiore PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11919637", "url": "https://glygen.org/publication/PubMed/11919637" } ] }, { "title": "Dual roles for the Dab2 adaptor protein in embryonic development and kidney transport.", "journal": "The EMBO journal", "date": "2002", "authors": "Morris SM, Tallquist MD, Rock CO, Cooper JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11927540", "url": "https://glygen.org/publication/PubMed/11927540" } ] }, { "title": "Sequential tethering of Golgins and catalysis of SNAREpin assembly by the vesicle-tethering protein p115.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Shorter J, Beard MB, Seemann J, Dirac-Svejstrup AB, Warren G", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "11927603", "url": "https://glygen.org/publication/PubMed/11927603" } ] }, { "title": "ERbeta has nongenomic action in caveolae.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2002", "authors": "Chambliss KL, Yuhanna IS, Anderson RG, Mendelsohn ME, Shaul PW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "11981029", "url": "https://glygen.org/publication/PubMed/11981029" } ] }, { "title": "Epsins and Vps27p/Hrs contain ubiquitin-binding domains that function in receptor endocytosis.", "journal": "Nature cell biology", "date": "2002", "authors": "Shih SC, Katzmann DJ, Schnell JD, Sutanto M, Emr SD, Hicke L", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11988742", "url": "https://glygen.org/publication/PubMed/11988742" } ] }, { "title": "AP-1 as a regulator of cell life and death.", "journal": "Nature cell biology", "date": "2002", "authors": "Shaulian E, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "11988758", "url": "https://glygen.org/publication/PubMed/11988758" } ] }, { "title": "ERK2 enters the nucleus by a carrier-independent mechanism.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Whitehurst AW, Wilsbacher JL, You Y, Luby-Phelps K, Moore MS, Cobb MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "12032311", "url": "https://glygen.org/publication/PubMed/12032311" } ] }, { "title": "Adaptor protein Shc is an isoform-specific direct activator of the tyrosine kinase c-Src.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Sato K, Nagao T, Kakumoto M, Kimoto M, Otsuki T, Iwasaki T, Tokmakov AA, Owada K, Fukami Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "12048194", "url": "https://glygen.org/publication/PubMed/12048194" } ] }, { "title": "Accessory protein recruitment motifs in clathrin-mediated endocytosis.", "journal": "Structure (London, England : 1993)", "date": "2002", "authors": "Brett TJ, Traub LM, Fremont DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "12057195", "url": "https://glygen.org/publication/PubMed/12057195" } ] }, { "title": "Sequential SNARE disassembly and GATE-16-GOS-28 complex assembly mediated by distinct NSF activities drives Golgi membrane fusion.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Muller JM, Shorter J, Newman R, Deinhardt K, Sagiv Y, Elazar Z, Warren G, Shima DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "12070132", "url": "https://glygen.org/publication/PubMed/12070132" } ] }, { "title": "Estrogen alters thresholds for B cell apoptosis and activation.", "journal": "The Journal of clinical investigation", "date": "2002", "authors": "Grimaldi CM, Cleary J, Dagtas AS, Moussai D, Diamond B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "12070310", "url": "https://glygen.org/publication/PubMed/12070310" } ] }, { "title": "A ubiquitin-interacting motif (UIM) is essential for Eps15 and Eps15R ubiquitination.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Klapisz E, Sorokina I, Lemeer S, Pijnenburg M, Verkleij AJ, van Bergen en Henegouwen PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "12072436", "url": "https://glygen.org/publication/PubMed/12072436" } ] }, { "title": "Molecular architecture and functional model of the endocytic AP2 complex.", "journal": "Cell", "date": "2002", "authors": "Collins BM, McCoy AJ, Kent HM, Evans PR, Owen DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12086608", "url": "https://glygen.org/publication/PubMed/12086608" } ] }, { "title": "A growth factor-dependent nuclear kinase phosphorylates p27(Kip1) and regulates cell cycle progression.", "journal": "The EMBO journal", "date": "2002", "authors": "Boehm M, Yoshimoto T, Crook MF, Nallamshetty S, True A, Nabel GJ, Nabel EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "12093740", "url": "https://glygen.org/publication/PubMed/12093740" } ] }, { "title": "The phosphatidylinositol 3-Kinase AKT pathway in human cancer.", "journal": "Nature reviews. Cancer", "date": "2002", "authors": "Vivanco I, Sawyers CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "12094235", "url": "https://glygen.org/publication/PubMed/12094235" } ] }, { "title": "Activation of phosphoinositide 3-kinase gamma by Ras.", "journal": "Current biology : CB", "date": "2002", "authors": "Suire S, Hawkins P, Stephens L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "12121613", "url": "https://glygen.org/publication/PubMed/12121613" } ] }, { "title": "Multiple phosphoinositide 3-kinase-dependent steps in activation of protein kinase B.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Scheid MP, Marignani PA, Woodgett JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "12167717", "url": "https://glygen.org/publication/PubMed/12167717" } ] }, { "title": "Enthoprotin: a novel clathrin-associated protein identified through subcellular proteomics.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Wasiak S, Legendre-Guillemin V, Puertollano R, Blondeau F, Girard M, de Heuvel E, Boismenu D, Bell AW, Bonifacino JS, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "12213833", "url": "https://glygen.org/publication/PubMed/12213833" } ] }, { "title": "Cbl-directed monoubiquitination of CIN85 is involved in regulation of ligand-induced degradation of EGF receptors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Haglund K, Shimokawa N, Szymkiewicz I, Dikic I", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "12218189", "url": "https://glygen.org/publication/PubMed/12218189" } ] }, { "title": "ARH is a modular adaptor protein that interacts with the LDL receptor, clathrin, and AP-2.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "He G, Gupta S, Yi M, Michaely P, Hobbs HH, Cohen JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12221107", "url": "https://glygen.org/publication/PubMed/12221107" } ] }, { "title": "Sprouty2 attenuates epidermal growth factor receptor ubiquitylation and endocytosis, and consequently enhances Ras/ERK signalling.", "journal": "The EMBO journal", "date": "2002", "authors": "Wong ES, Fong CW, Lim J, Yusoff P, Low BC, Langdon WY, Guy GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "12234920", "url": "https://glygen.org/publication/PubMed/12234920" } ] }, { "title": "Disabled-2 exhibits the properties of a cargo-selective endocytic clathrin adaptor.", "journal": "The EMBO journal", "date": "2002", "authors": "Mishra SK, Keyel PA, Hawryluk MJ, Agostinelli NR, Watkins SC, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12234931", "url": "https://glygen.org/publication/PubMed/12234931" } ] }, { "title": "Sec16p potentiates the action of COPII proteins to bud transport vesicles.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Supek F, Madden DT, Hamamoto S, Orci L, Schekman R", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "12235121", "url": "https://glygen.org/publication/PubMed/12235121" } ] }, { "title": "Oligomeric state and stoichiometry of p24 proteins in the early secretory pathway.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Jenne N, Frey K, Brugger B, Wieland FT", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "12237308", "url": "https://glygen.org/publication/PubMed/12237308" } ] }, { "title": "Distinct nongenomic signal transduction pathways controlled by 17beta-estradiol regulate DNA synthesis and cyclin D(1) gene transcription in HepG2 cells.", "journal": "Molecular biology of the cell", "date": "2002", "authors": "Marino M, Acconcia F, Bresciani F, Weisz A, Trentalance A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "12388769", "url": "https://glygen.org/publication/PubMed/12388769" } ] }, { "title": "Proximal events in signaling by plasma membrane estrogen receptors.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Razandi M, Pedram A, Park ST, Levin ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "12421825", "url": "https://glygen.org/publication/PubMed/12421825" } ] }, { "title": "Transforming growth factor-beta receptors interact with AP2 by direct binding to beta2 subunit.", "journal": "Molecular biology of the cell", "date": "2002", "authors": "Yao D, Ehrlich M, Henis YI, Leof EB", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12429842", "url": "https://glygen.org/publication/PubMed/12429842" } ] }, { "title": "Src kinase mediates phosphatidylinositol 3-kinase/Akt-dependent rapid endothelial nitric-oxide synthase activation by estrogen.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Haynes MP, Li L, Sinha D, Russell KS, Hisamoto K, Baron R, Collinge M, Sessa WC, Bender JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "12431978", "url": "https://glygen.org/publication/PubMed/12431978" } ] }, { "title": "ARF6-GTP recruits Nm23-H1 to facilitate dynamin-mediated endocytosis during adherens junctions disassembly.", "journal": "Nature cell biology", "date": "2002", "authors": "Palacios F, Schweitzer JK, Boshans RL, D'Souza-Schorey C", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "12447393", "url": "https://glygen.org/publication/PubMed/12447393" } ] }, { "title": "The autosomal recessive hypercholesterolemia (ARH) protein interfaces directly with the clathrin-coat machinery.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Mishra SK, Watkins SC, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12451172", "url": "https://glygen.org/publication/PubMed/12451172" } ] }, { "title": "Phosphorylation of key serine residues is required for internalization of the complement 5a (C5a) anaphylatoxin receptor via a beta-arrestin, dynamin, and clathrin-dependent pathway.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Braun L, Christophe T, Boulay F", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12464600", "url": "https://glygen.org/publication/PubMed/12464600" } ] }, { "title": "Crosstalk between CARM1 methylation and CBP acetylation on histone H3.", "journal": "Current biology : CB", "date": "2002", "authors": "Daujat S, Bauer UM, Shah V, Turner B, Berger S, Kouzarides T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "12498683", "url": "https://glygen.org/publication/PubMed/12498683" } ] }, { "title": "Nongenomic actions of steroid hormones.", "journal": "Nature reviews. Molecular cell biology", "date": "2003", "authors": "Losel R, Wehling M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "12511868", "url": "https://glygen.org/publication/PubMed/12511868" } ] }, { "title": "Identification of a structural determinant necessary for the localization and function of estrogen receptor alpha at the plasma membrane.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Razandi M, Alton G, Pedram A, Ghonshani S, Webb P, Levin ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "12588983", "url": "https://glygen.org/publication/PubMed/12588983" } ] }, { "title": "Sprouty fine-tunes EGF signaling through interlinked positive and negative feedback loops.", "journal": "Current biology : CB", "date": "2003", "authors": "Rubin C, Litvak V, Medvedovsky H, Zwang Y, Lev S, Yarden Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "12593795", "url": "https://glygen.org/publication/PubMed/12593795" } ] }, { "title": "hSpry2 is targeted to the ubiquitin-dependent proteasome pathway by c-Cbl.", "journal": "Current biology : CB", "date": "2003", "authors": "Hall AB, Jura N, DaSilva J, Jang YJ, Gong D, Bar-Sagi D", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "12593796", "url": "https://glygen.org/publication/PubMed/12593796" } ] }, { "title": "Two domains of the progesterone receptor interact with the estrogen receptor and are required for progesterone activation of the c-Src/Erk pathway in mammalian cells.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Ballare C, Uhrig M, Bechtold T, Sancho E, Di Domenico M, Migliaccio A, Auricchio F, Beato M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "12612073", "url": "https://glygen.org/publication/PubMed/12612073" } ] }, { "title": "Plasma membrane localization and function of the estrogen receptor alpha variant (ER46) in human endothelial cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Li L, Haynes MP, Bender JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "12682286", "url": "https://glygen.org/publication/PubMed/12682286" } ] }, { "title": "Multiple monoubiquitination of RTKs is sufficient for their endocytosis and degradation.", "journal": "Nature cell biology", "date": "2003", "authors": "Haglund K, Sigismund S, Polo S, Szymkiewicz I, Di Fiore PP, Dikic I", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12717448", "url": "https://glygen.org/publication/PubMed/12717448" } ] }, { "title": "Grb2-independent recruitment of Gab1 requires the C-terminal lobe and structural integrity of the Met receptor kinase domain.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Lock LS, Frigault MM, Saucier C, Park M", "evidence": [ { "database": "Reactome", "id": "R-HSA-180292", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180292" } ], "reference": [ { "type": "PubMed", "id": "12766170", "url": "https://glygen.org/publication/PubMed/12766170" } ] }, { "title": "Threonine 308 phosphorylated form of Akt translocates to the nucleus of PC12 cells under nerve growth factor stimulation and associates with the nuclear matrix protein nucleolin.", "journal": "Journal of cellular physiology", "date": "2003", "authors": "Borgatti P, Martelli AM, Tabellini G, Bellacosa A, Capitani S, Neri LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "12767043", "url": "https://glygen.org/publication/PubMed/12767043" } ] }, { "title": "Biphasic estradiol-induced AKT phosphorylation is modulated by PTEN via MAP kinase in HepG2 cells.", "journal": "Molecular biology of the cell", "date": "2003", "authors": "Marino M, Acconcia F, Trentalance A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "12808053", "url": "https://glygen.org/publication/PubMed/12808053" } ] }, { "title": "The cell cycle: a review of regulation, deregulation and therapeutic targets in cancer.", "journal": "Cell proliferation", "date": "2003", "authors": "Vermeulen K, Van Bockstaele DR, Berneman ZN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "12814430", "url": "https://glygen.org/publication/PubMed/12814430" } ] }, { "title": "ARF6 stimulates clathrin/AP-2 recruitment to synaptic membranes by activating phosphatidylinositol phosphate kinase type Igamma.", "journal": "The Journal of cell biology", "date": "2003", "authors": "Krauss M, Kinuta M, Wenk MR, De Camilli P, Takei K, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "12847086", "url": "https://glygen.org/publication/PubMed/12847086" } ] }, { "title": "Sphingosine kinase transmits estrogen signaling in human breast cancer cells.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2003", "authors": "Sukocheva OA, Wang L, Albanese N, Pitson SM, Vadas MA, Xia P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "12881510", "url": "https://glygen.org/publication/PubMed/12881510" } ] }, { "title": "Estrogens down-regulate p27Kip1 in breast cancer cells through Skp2 and through nuclear export mediated by the ERK pathway.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Foster JS, Fernando RI, Ishida N, Nakayama KI, Wimalasena J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "12904306", "url": "https://glygen.org/publication/PubMed/12904306" } ] }, { "title": "Xenopus autosomal recessive hypercholesterolemia protein couples lipoprotein receptors with the AP-2 complex in oocytes and embryos and is required for vitellogenesis.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Zhou Y, Zhang J, King ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12944396", "url": "https://glygen.org/publication/PubMed/12944396" } ] }, { "title": "Sorting nexin 9 participates in clathrin-mediated endocytosis through interactions with the core components.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Lundmark R, Carlsson SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "12952949", "url": "https://glygen.org/publication/PubMed/12952949" } ] }, { "title": "Dishevelled 2 recruits beta-arrestin 2 to mediate Wnt5A-stimulated endocytosis of Frizzled 4.", "journal": "Science (New York, N.Y.)", "date": "2003", "authors": "Chen W, ten Berge D, Brown J, Ahn S, Hu LA, Miller WE, Caron MG, Barak LS, Nusse R, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12958364", "url": "https://glygen.org/publication/PubMed/12958364" } ] }, { "title": "Profiling of estrogen up- and down-regulated gene expression in human breast cancer cells: insights into gene networks and pathways underlying estrogenic control of proliferation and cell phenotype.", "journal": "Endocrinology", "date": "2003", "authors": "Frasor J, Danes JM, Komm B, Chang KC, Lyttle CR, Katzenellenbogen BS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "12959972", "url": "https://glygen.org/publication/PubMed/12959972" } ] }, { "title": "Characterization of the signal for rapid internalization of the bovine mannose 6-phosphate/insulin-like growth factor-II receptor.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Jadot M, Canfield WM, Gregory W, Kornfeld S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "1317852", "url": "https://glygen.org/publication/PubMed/1317852" } ] }, { "title": "Regulation of protein serine-threonine phosphatase type-2A by tyrosine phosphorylation.", "journal": "Science (New York, N.Y.)", "date": "1992", "authors": "Chen J, Martin BL, Brautigan DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811558", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811558" } ], "reference": [ { "type": "PubMed", "id": "1325671", "url": "https://glygen.org/publication/PubMed/1325671" } ] }, { "title": "Activated Cdc42 sequesters c-Cbl and prevents EGF receptor degradation.", "journal": "Cell", "date": "2003", "authors": "Wu WJ, Tu S, Cerione RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "14505571", "url": "https://glygen.org/publication/PubMed/14505571" } ] }, { "title": "PEA-15 binding to ERK1/2 MAPKs is required for its modulation of integrin activation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Chou FL, Hill JM, Hsieh JC, Pouyssegur J, Brunet A, Glading A, Uberall F, Ramos JW, Werner MH, Ginsberg MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "14506247", "url": "https://glygen.org/publication/PubMed/14506247" } ] }, { "title": "Identification of a family of endocytic proteins that define a new alpha-adaptin ear-binding motif.", "journal": "EMBO reports", "date": "2003", "authors": "Ritter B, Philie J, Girard M, Tung EC, Blondeau F, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "14555962", "url": "https://glygen.org/publication/PubMed/14555962" } ] }, { "title": "Molecular mechanism for a role of SHP2 in epidermal growth factor receptor signaling.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Agazie YM, Hayman MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-180292", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180292" } ], "reference": [ { "type": "PubMed", "id": "14560030", "url": "https://glygen.org/publication/PubMed/14560030" } ] }, { "title": "Clathrin promotes incorporation of cargo into coated pits by activation of the AP2 adaptor micro2 kinase.", "journal": "The Journal of cell biology", "date": "2003", "authors": "Jackson AP, Flett A, Smythe C, Hufton L, Wettey FR, Smythe E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "14581451", "url": "https://glygen.org/publication/PubMed/14581451" } ] }, { "title": "AAK1-mediated micro2 phosphorylation is stimulated by assembled clathrin.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2003", "authors": "Conner SD, Schroter T, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "14617351", "url": "https://glygen.org/publication/PubMed/14617351" } ] }, { "title": "Synaptojanin is recruited by endophilin to promote synaptic vesicle uncoating.", "journal": "Neuron", "date": "2003", "authors": "Verstreken P, Koh TW, Schulze KL, Zhai RG, Hiesinger PR, Zhou Y, Mehta SQ, Cao Y, Roos J, Bellen HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "14622578", "url": "https://glygen.org/publication/PubMed/14622578" } ] }, { "title": "Endophilin is required for synaptic vesicle endocytosis by localizing synaptojanin.", "journal": "Neuron", "date": "2003", "authors": "Schuske KR, Richmond JE, Matthies DS, Davis WS, Runz S, Rube DA, van der Bliek AM, Jorgensen EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "14622579", "url": "https://glygen.org/publication/PubMed/14622579" } ] }, { "title": "Acetylation and methylation in nuclear receptor gene activation.", "journal": "Methods in enzymology", "date": "2003", "authors": "Xu W, Cho H, Evans RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "14631847", "url": "https://glygen.org/publication/PubMed/14631847" } ] }, { "title": "The ubiquitin-related protein PLIC-1 regulates heterotrimeric G protein function through association with Gbetagamma.", "journal": "The Journal of cell biology", "date": "2003", "authors": "N'Diaye EN, Brown EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "14662753", "url": "https://glygen.org/publication/PubMed/14662753" } ] }, { "title": "Roles of Gab1 and SHP2 in paxillin tyrosine dephosphorylation and Src activation in response to epidermal growth factor.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Ren Y, Meng S, Mei L, Zhao ZJ, Jove R, Wu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-180292", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180292" } ], "reference": [ { "type": "PubMed", "id": "14665621", "url": "https://glygen.org/publication/PubMed/14665621" } ] }, { "title": "17beta-estradiol inhibits oxidative stress-induced apoptosis in keratinocytes by promoting Bcl-2 expression.", "journal": "The Journal of investigative dermatology", "date": "2003", "authors": "Kanda N, Watanabe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "14675202", "url": "https://glygen.org/publication/PubMed/14675202" } ] }, { "title": "Estrogen receptor-alpha directs ordered, cyclical, and combinatorial recruitment of cofactors on a natural target promoter.", "journal": "Cell", "date": "2003", "authors": "Metivier R, Penot G, Hubner MR, Reid G, Brand H, Kos M, Gannon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "14675539", "url": "https://glygen.org/publication/PubMed/14675539" } ] }, { "title": "Distinct domains in the SHP-2 phosphatase differentially regulate epidermal growth factor receptor/NF-kappaB activation through Gab1 in glioblastoma cells.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Kapoor GS, Zhan Y, Johnson GR, O'Rourke DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-180292", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180292" } ], "reference": [ { "type": "PubMed", "id": "14701753", "url": "https://glygen.org/publication/PubMed/14701753" } ] }, { "title": "The death effector domain protein PEA-15 prevents nuclear entry of ERK2 by inhibiting required interactions.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Whitehurst AW, Robinson FL, Moore MS, Cobb MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "14707138", "url": "https://glygen.org/publication/PubMed/14707138" } ] }, { "title": "Functional dissection of the interactions of stonin 2 with the adaptor complex AP-2 and synaptotagmin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Walther K, Diril MK, Jung N, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "14726597", "url": "https://glygen.org/publication/PubMed/14726597" } ] }, { "title": "Activator protein 2alpha inhibits tumorigenicity and represses vascular endothelial growth factor transcription in prostate cancer cells.", "journal": "Cancer research", "date": "2004", "authors": "Ruiz M, Pettaway C, Song R, Stoeltzing O, Ellis L, Bar-Eli M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "14744778", "url": "https://glygen.org/publication/PubMed/14744778" } ] }, { "title": "The role of Shc and insulin-like growth factor 1 receptor in mediating the translocation of estrogen receptor alpha to the plasma membrane.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Song RX, Barnes CJ, Zhang Z, Bao Y, Kumar R, Santen RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "14764897", "url": "https://glygen.org/publication/PubMed/14764897" } ] }, { "title": "Shp2 regulates SRC family kinase activity and Ras/Erk activation by controlling Csk recruitment.", "journal": "Molecular cell", "date": "2004", "authors": "Zhang SQ, Yang W, Kontaridis MI, Bivona TG, Wen G, Araki T, Luo J, Thompson JA, Schraven BL, Philips MR, Neel BG", "evidence": [ { "database": "Reactome", "id": "R-HSA-180292", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180292" } ], "reference": [ { "type": "PubMed", "id": "14967142", "url": "https://glygen.org/publication/PubMed/14967142" } ] }, { "title": "Analysis of clathrin-mediated endocytosis of epidermal growth factor receptor by RNA interference.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Huang F, Khvorova A, Marshall W, Sorkin A", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "14985334", "url": "https://glygen.org/publication/PubMed/14985334" } ] }, { "title": "Genome-wide identification of high-affinity estrogen response elements in human and mouse.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2004", "authors": "Bourdeau V, Deschenes J, Metivier R, Nagai Y, Nguyen D, Bretschneider N, Gannon F, White JH, Mader S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15001666", "url": "https://glygen.org/publication/PubMed/15001666" } ] }, { "title": "Role of protein ubiquitylation in regulating endocytosis of receptor tyrosine kinases.", "journal": "Oncogene", "date": "2004", "authors": "Marmor MD, Yarden Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "15021893", "url": "https://glygen.org/publication/PubMed/15021893" } ] }, { "title": "S-palmitoylation modulates human estrogen receptor-alpha functions.", "journal": "Biochemical and biophysical research communications", "date": "2004", "authors": "Acconcia F, Ascenzi P, Fabozzi G, Visca P, Marino M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "15033483", "url": "https://glygen.org/publication/PubMed/15033483" } ] }, { "title": "Multiple binding proteins suggest diverse functions for the N-ethylmaleimide sensitive factor.", "journal": "Journal of structural biology", "date": "2004", "authors": "Whiteheart SW, Matveeva EA", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "15037235", "url": "https://glygen.org/publication/PubMed/15037235" } ] }, { "title": "Sphingosine 1-phosphate transactivates the platelet-derived growth factor beta receptor and epidermal growth factor receptor in vascular smooth muscle cells.", "journal": "Circulation research", "date": "2004", "authors": "Tanimoto T, Lungu AO, Berk BC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "15044318", "url": "https://glygen.org/publication/PubMed/15044318" } ] }, { "title": "The G protein-coupled receptor GPR30 mediates c-fos up-regulation by 17beta-estradiol and phytoestrogens in breast cancer cells.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Maggiolini M, Vivacqua A, Fasanella G, Recchia AG, Sisci D, Pezzi V, Montanaro D, Musti AM, Picard D, Ando S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "15090535", "url": "https://glygen.org/publication/PubMed/15090535" } ] }, { "title": "Regulation of ubiquitin protein ligase activity in c-Cbl by phosphorylation-induced conformational change and constitutive activation by tyrosine to glutamate point mutations.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Kassenbrock CK, Anderson SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "15117950", "url": "https://glygen.org/publication/PubMed/15117950" } ] }, { "title": "The adaptor disabled-2 binds to the third psi xNPxY sequence on the cytoplasmic tail of megalin.", "journal": "Biochimie", "date": "2004", "authors": "Gallagher H, Oleinikov AV, Fenske C, Newman DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "15134832", "url": "https://glygen.org/publication/PubMed/15134832" } ] }, { "title": "Ligand regulates epidermal growth factor receptor kinase specificity: activation increases preference for GAB1 and SHC versus autophosphorylation sites.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Fan YX, Wong L, Deb TB, Johnson GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-180292", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180292" } ], "reference": [ { "type": "PubMed", "id": "15231819", "url": "https://glygen.org/publication/PubMed/15231819" } ] }, { "title": "Plasma membrane estrogen receptors exist and functions as dimers.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2004", "authors": "Razandi M, Pedram A, Merchenthaler I, Greene GL, Levin ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "15231873", "url": "https://glygen.org/publication/PubMed/15231873" } ] }, { "title": "17beta-estradiol stimulates the growth of human keratinocytes by inducing cyclin D2 expression.", "journal": "The Journal of investigative dermatology", "date": "2004", "authors": "Kanda N, Watanabe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "15245432", "url": "https://glygen.org/publication/PubMed/15245432" } ] }, { "title": "A novel dynamin-associating molecule, formin-binding protein 17, induces tubular membrane invaginations and participates in endocytosis.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Kamioka Y, Fukuhara S, Sawa H, Nagashima K, Masuda M, Matsuda M, Mochizuki N", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15252009", "url": "https://glygen.org/publication/PubMed/15252009" } ] }, { "title": "Dap160/intersectin scaffolds the periactive zone to achieve high-fidelity endocytosis and normal synaptic growth.", "journal": "Neuron", "date": "2004", "authors": "Marie B, Sweeney ST, Poskanzer KE, Roos J, Kelly RB, Davis GW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15260957", "url": "https://glygen.org/publication/PubMed/15260957" } ] }, { "title": "Cetuximab monotherapy and cetuximab plus irinotecan in irinotecan-refractory metastatic colorectal cancer.", "journal": "The New England journal of medicine", "date": "2004", "authors": "Cunningham D, Humblet Y, Siena S, Khayat D, Bleiberg H, Santoro A, Bets D, Mueser M, Harstrick A, Verslype C, Chau I, Van Cutsem E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5638303", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5638303" } ], "reference": [ { "type": "PubMed", "id": "15269313", "url": "https://glygen.org/publication/PubMed/15269313" } ] }, { "title": "Cellular control of gene expression by T-type cyclin/CDK9 complexes.", "journal": "Gene", "date": "2004", "authors": "Garriga J, Grana X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15276198", "url": "https://glygen.org/publication/PubMed/15276198" } ] }, { "title": "Estrogens and progesterone promote persistent CCND1 gene activation during G1 by inducing transcriptional derepression via c-Jun/c-Fos/estrogen receptor (progesterone receptor) complex assembly to a distal regulatory element and recruitment of cyclin D1 to its own gene promoter.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Cicatiello L, Addeo R, Sasso A, Altucci L, Petrizzi VB, Borgo R, Cancemi M, Caporali S, Caristi S, Scafoglio C, Teti D, Bresciani F, Perillo B, Weisz A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15282324", "url": "https://glygen.org/publication/PubMed/15282324" } ] }, { "title": "Role of atypical protein kinase C in estradiol-triggered G1/S progression of MCF-7 cells.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Castoria G, Migliaccio A, Di Domenico M, Lombardi M, de Falco A, Varricchio L, Bilancio A, Barone MV, Auricchio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "15314172", "url": "https://glygen.org/publication/PubMed/15314172" } ] }, { "title": "The stimulatory action of amphiphysin on dynamin function is dependent on lipid bilayer curvature.", "journal": "The EMBO journal", "date": "2004", "authors": "Yoshida Y, Kinuta M, Abe T, Liang S, Araki K, Cremona O, Di Paolo G, Moriyama Y, Yasuda T, De Camilli P, Takei K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15318165", "url": "https://glygen.org/publication/PubMed/15318165" } ] }, { "title": "Endocytosis by random initiation and stabilization of clathrin-coated pits.", "journal": "Cell", "date": "2004", "authors": "Ehrlich M, Boll W, Van Oijen A, Hariharan R, Chandran K, Nibert ML, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15339664", "url": "https://glygen.org/publication/PubMed/15339664" } ] }, { "title": "Transcriptional complexes engaged by apo-estrogen receptor-alpha isoforms have divergent outcomes.", "journal": "The EMBO journal", "date": "2004", "authors": "Metivier R, Penot G, Carmouche RP, Hubner MR, Reid G, Denger S, Manu D, Brand H, Kos M, Benes V, Gannon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15343269", "url": "https://glygen.org/publication/PubMed/15343269" } ] }, { "title": "Discovery of estrogen receptor alpha target genes and response elements in breast tumor cells.", "journal": "Genome biology", "date": "2004", "authors": "Lin CY, Strom A, Vega VB, Kong SL, Yeo AL, Thomsen JS, Chan WC, Doray B, Bangarusamy DK, Ramasamy A, Vergara LA, Tang S, Chong A, Bajic VB, Miller LD, Gustafsson JA, Liu ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15345050", "url": "https://glygen.org/publication/PubMed/15345050" } ] }, { "title": "A novel di-leucine motif and a tyrosine-based motif independently mediate lysosomal targeting and endocytosis of CD3 chains.", "journal": "Cell", "date": "1992", "authors": "Letourneur F, Klausner RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "1535555", "url": "https://glygen.org/publication/PubMed/1535555" } ] }, { "title": "Phosphorylation of Grb2-associated binder 2 on serine 623 by ERK MAPK regulates its association with the phosphatase SHP-2 and decreases STAT5 activation.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2004", "authors": "Arnaud M, Crouin C, Deon C, Loyaux D, Bertoglio J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "15356145", "url": "https://glygen.org/publication/PubMed/15356145" } ] }, { "title": "Nuclear localization and regulation of erk- and rsk-encoded protein kinases.", "journal": "Molecular and cellular biology", "date": "1992", "authors": "Chen RH, Sarnecki C, Blenis J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "1545823", "url": "https://glygen.org/publication/PubMed/1545823" } ] }, { "title": "Ubiquitin ligase activity of c-Cbl guides the epidermal growth factor receptor into clathrin-coated pits by two distinct modes of Eps15 recruitment.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "de Melker AA, van der Horst G, Borst J", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "15465819", "url": "https://glygen.org/publication/PubMed/15465819" } ] }, { "title": "Nitric Oxide as a Unique Bioactive Signaling Messenger in Physiology and Pathophysiology.", "journal": "Journal of biomedicine & biotechnology", "date": "2004", "authors": "Tuteja N, Chandra M, Tuteja R, Misra MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "15467163", "url": "https://glygen.org/publication/PubMed/15467163" } ] }, { "title": "Adaptors for clathrin coats: structure and function.", "journal": "Annual review of cell and developmental biology", "date": "2004", "authors": "Owen DJ, Collins BM, Evans PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "15473838", "url": "https://glygen.org/publication/PubMed/15473838" } ] }, { "title": "Direct interaction of Cbl with pTyr 1045 of the EGF receptor (EGFR) is required to sort the EGFR to lysosomes for degradation.", "journal": "Experimental cell research", "date": "2004", "authors": "Grovdal LM, Stang E, Sorkin A, Madshus IH", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "15475003", "url": "https://glygen.org/publication/PubMed/15475003" } ] }, { "title": "Palmitoylation-dependent estrogen receptor alpha membrane localization: regulation by 17beta-estradiol.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Acconcia F, Ascenzi P, Bocedi A, Spisni E, Tomasi V, Trentalance A, Visca P, Marino M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "15496458", "url": "https://glygen.org/publication/PubMed/15496458" } ] }, { "title": "Molecular model for a complete clathrin lattice from electron cryomicroscopy.", "journal": "Nature", "date": "2004", "authors": "Fotin A, Cheng Y, Sliz P, Grigorieff N, Harrison SC, Kirchhausen T, Walz T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15502812", "url": "https://glygen.org/publication/PubMed/15502812" } ] }, { "title": "Structure of an auxilin-bound clathrin coat and its implications for the mechanism of uncoating.", "journal": "Nature", "date": "2004", "authors": "Fotin A, Cheng Y, Grigorieff N, Walz T, Harrison SC, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15502813", "url": "https://glygen.org/publication/PubMed/15502813" } ] }, { "title": "Global gene expression analysis of estrogen receptor transcription factor cross talk in breast cancer: identification of estrogen-induced/activator protein-1-dependent genes.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2005", "authors": "DeNardo DG, Kim HT, Hilsenbeck S, Cuba V, Tsimelzon A, Brown PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15514030", "url": "https://glygen.org/publication/PubMed/15514030" } ] }, { "title": "Live Cell Imaging of ERK and MEK: simple binding equilibrium explains the regulated nucleocytoplasmic distribution of ERK.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Burack WR, Shaw AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "15546878", "url": "https://glygen.org/publication/PubMed/15546878" } ] }, { "title": "AP-1 subunits: quarrel and harmony among siblings.", "journal": "Journal of cell science", "date": "2004", "authors": "Hess J, Angel P, Schorpp-Kistner M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "15564374", "url": "https://glygen.org/publication/PubMed/15564374" } ] }, { "title": "Striatin assembles a membrane signaling complex necessary for rapid, nongenomic activation of endothelial NO synthase by estrogen receptor alpha.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Lu Q, Pallas DC, Surks HK, Baur WE, Mendelsohn ME, Karas RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "15569929", "url": "https://glygen.org/publication/PubMed/15569929" } ] }, { "title": "A novel role for Gab1 and SHP2 in epidermal growth factor-induced Ras activation.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Montagner A, Yart A, Dance M, Perret B, Salles JP, Raynal P", "evidence": [ { "database": "Reactome", "id": "R-HSA-180292", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180292" } ], "reference": [ { "type": "PubMed", "id": "15574420", "url": "https://glygen.org/publication/PubMed/15574420" } ] }, { "title": "BAR domains and membrane curvature: bringing your curves to the BAR.", "journal": "Biochemical Society symposium", "date": "2005", "authors": "Gallop JL, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15649145", "url": "https://glygen.org/publication/PubMed/15649145" } ] }, { "title": "Phosphotyrosine signaling networks in epidermal growth factor receptor overexpressing squamous carcinoma cells.", "journal": "Molecular & cellular proteomics : MCP", "date": "2005", "authors": "Thelemann A, Petti F, Griffin G, Iwata K, Hunt T, Settinari T, Fenyo D, Gibson N, Haley JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "15657067", "url": "https://glygen.org/publication/PubMed/15657067" } ] }, { "title": "Different G protein-coupled receptor kinases govern G protein and beta-arrestin-mediated signaling of V2 vasopressin receptor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Ren XR, Reiter E, Ahn S, Kim J, Chen W, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "15671180", "url": "https://glygen.org/publication/PubMed/15671180" } ] }, { "title": "Clathrin-independent endocytosis of ubiquitinated cargos.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Sigismund S, Woelk T, Puri C, Maspero E, Tacchetti C, Transidico P, Di Fiore PP, Polo S", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "15701692", "url": "https://glygen.org/publication/PubMed/15701692" } ] }, { "title": "SNX9 regulates dynamin assembly and is required for efficient clathrin-mediated endocytosis.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Soulet F, Yarar D, Leonard M, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15703209", "url": "https://glygen.org/publication/PubMed/15703209" } ] }, { "title": "Integration of the extranuclear and nuclear actions of estrogen.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2005", "authors": "Levin ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "15705661", "url": "https://glygen.org/publication/PubMed/15705661" } ] }, { "title": "Phosphorylation and regulation of Akt/PKB by the rictor-mTOR complex.", "journal": "Science (New York, N.Y.)", "date": "2005", "authors": "Sarbassov DD, Guertin DA, Ali SM, Sabatini DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "15718470", "url": "https://glygen.org/publication/PubMed/15718470" } ] }, { "title": "Functional dissection of an AP-2 beta2 appendage-binding sequence within the autosomal recessive hypercholesterolemia protein.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Mishra SK, Keyel PA, Edeling MA, Dupin AL, Owen DJ, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "15728179", "url": "https://glygen.org/publication/PubMed/15728179" } ] }, { "title": "The small G-protein Arf6GTP recruits the AP-2 adaptor complex to membranes.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Paleotti O, Macia E, Luton F, Klein S, Partisani M, Chardin P, Kirchhausen T, Franco M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15802264", "url": "https://glygen.org/publication/PubMed/15802264" } ] }, { "title": "PI 3-kinase p110beta: a new target for antithrombotic therapy.", "journal": "Nature medicine", "date": "2005", "authors": "Jackson SP, Schoenwaelder SM, Goncalves I, Nesbitt WS, Yap CL, Wright CE, Kenche V, Anderson KE, Dopheide SM, Yuan Y, Sturgeon SA, Prabaharan H, Thompson PE, Smith GD, Shepherd PR, Daniele N, Kulkarni S, Abbott B, Saylik D, Jones C, Lu L, Giuliano S, Hughan SC, Angus JA, Robertson AD, Salem HH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "15834429", "url": "https://glygen.org/publication/PubMed/15834429" } ] }, { "title": "Structural basis for inhibition of the epidermal growth factor receptor by cetuximab.", "journal": "Cancer cell", "date": "2005", "authors": "Li S, Schmitz KR, Jeffrey PD, Wiltzius JJ, Kussie P, Ferguson KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5638303", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5638303" } ], "reference": [ { "type": "PubMed", "id": "15837620", "url": "https://glygen.org/publication/PubMed/15837620" } ] }, { "title": "Yin Yang 1 cooperates with activator protein 2 to stimulate ERBB2 gene expression in mammary cancer cells.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Begon DY, Delacroix L, Vernimmen D, Jackers P, Winkler R", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "15870067", "url": "https://glygen.org/publication/PubMed/15870067" } ] }, { "title": "Caenorhabditis elegans RME-6 is a novel regulator of RAB-5 at the clathrin-coated pit.", "journal": "Nature cell biology", "date": "2005", "authors": "Sato M, Sato K, Fonarev P, Huang CJ, Liou W, Grant BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15895077", "url": "https://glygen.org/publication/PubMed/15895077" } ] }, { "title": "Estrogen-induced G1/S transition of G0-arrested estrogen-dependent breast cancer cells is regulated by mitochondrial oxidant signaling.", "journal": "Oncogene", "date": "2005", "authors": "Felty Q, Singh KP, Roy D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "15897899", "url": "https://glygen.org/publication/PubMed/15897899" } ] }, { "title": "Phosphatidylinositol-(4,5)-bisphosphate regulates sorting signal recognition by the clathrin-associated adaptor complex AP2.", "journal": "Molecular cell", "date": "2005", "authors": "Honing S, Ricotta D, Krauss M, Spate K, Spolaore B, Motley A, Robinson M, Robinson C, Haucke V, Owen DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15916959", "url": "https://glygen.org/publication/PubMed/15916959" } ] }, { "title": "Rapid, estrogen receptor-mediated signaling: why is the endothelium so special?", "journal": "Science's STKE : signal transduction knowledge environment", "date": "2005", "authors": "Kim KH, Bender JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "15956360", "url": "https://glygen.org/publication/PubMed/15956360" } ] }, { "title": "Sprouty2 acts at the Cbl/CIN85 interface to inhibit epidermal growth factor receptor downregulation.", "journal": "EMBO reports", "date": "2005", "authors": "Haglund K, Schmidt MHH, Wong ES, Guy GR, Dikic I", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "15962011", "url": "https://glygen.org/publication/PubMed/15962011" } ] }, { "title": "GREB 1 is a critical regulator of hormone dependent breast cancer growth.", "journal": "Breast cancer research and treatment", "date": "2005", "authors": "Rae JM, Johnson MD, Scheys JO, Cordero KE, Larios JM, Lippman ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15986123", "url": "https://glygen.org/publication/PubMed/15986123" } ] }, { "title": "Chromosome-wide mapping of estrogen receptor binding reveals long-range regulation requiring the forkhead protein FoxA1.", "journal": "Cell", "date": "2005", "authors": "Carroll JS, Liu XS, Brodsky AS, Li W, Meyer CA, Szary AJ, Eeckhoute J, Shao W, Hestermann EV, Geistlinger TR, Fox EA, Silver PA, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16009131", "url": "https://glygen.org/publication/PubMed/16009131" } ] }, { "title": "Cathepsin D: newly discovered functions of a long-standing aspartic protease in cancer and apoptosis.", "journal": "Cancer letters", "date": "2006", "authors": "Liaudet-Coopman E, Beaujouin M, Derocq D, Garcia M, Glondu-Lassis M, Laurent-Matha V, Prebois C, Rochefort H, Vignon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16046058", "url": "https://glygen.org/publication/PubMed/16046058" } ] }, { "title": "From the Cover: Location analysis of estrogen receptor alpha target promoters reveals that FOXA1 defines a domain of the estrogen response.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Laganiere J, Deblois G, Lefebvre C, Bataille AR, Robert F, Giguere V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16087863", "url": "https://glygen.org/publication/PubMed/16087863" } ] }, { "title": "An enzymatic cascade of Rab5 effectors regulates phosphoinositide turnover in the endocytic pathway.", "journal": "The Journal of cell biology", "date": "2005", "authors": "Shin HW, Hayashi M, Christoforidis S, Lacas-Gervais S, Hoepfner S, Wenk MR, Modregger J, Uttenweiler-Joseph S, Wilm M, Nystuen A, Frankel WN, Solimena M, De Camilli P, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16103228", "url": "https://glygen.org/publication/PubMed/16103228" } ] }, { "title": "Downstream targets of growth factor and oestrogen signalling and endocrine resistance: the potential roles of c-Myc, cyclin D1 and cyclin E.", "journal": "Endocrine-related cancer", "date": "2005", "authors": "Butt AJ, McNeil CM, Musgrove EA, Sutherland RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16113099", "url": "https://glygen.org/publication/PubMed/16113099" } ] }, { "title": "Sugar-binding properties of VIP36, an intracellular animal lectin operating as a cargo receptor.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Kamiya Y, Yamaguchi Y, Takahashi N, Arata Y, Kasai K, Ihara Y, Matsuo I, Ito Y, Yamamoto K, Kato K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "16129679", "url": "https://glygen.org/publication/PubMed/16129679" } ] }, { "title": "Ubiquilin recruits Eps15 into ubiquitin-rich cytoplasmic aggregates via a UIM-UBL interaction.", "journal": "Journal of cell science", "date": "2005", "authors": "Regan-Klapisz E, Sorokina I, Voortman J, de Keizer P, Roovers RC, Verheesen P, Urbe S, Fallon L, Fon EA, Verkleij A, Benmerah A, van Bergen en Henegouwen PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "16159959", "url": "https://glygen.org/publication/PubMed/16159959" } ] }, { "title": "The Fos family of transcription factors and their role in tumourigenesis.", "journal": "European journal of cancer (Oxford, England : 1990)", "date": "2005", "authors": "Milde-Langosch K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "16199154", "url": "https://glygen.org/publication/PubMed/16199154" } ] }, { "title": "Individual phosphoinositide 3-kinase C2alpha domain activities independently regulate clathrin function.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Gaidarov I, Zhao Y, Keen JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16215232", "url": "https://glygen.org/publication/PubMed/16215232" } ] }, { "title": "The G protein-coupled receptor GPR30 mediates the proliferative effects induced by 17beta-estradiol and hydroxytamoxifen in endometrial cancer cells.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2006", "authors": "Vivacqua A, Bonofiglio D, Recchia AG, Musti AM, Picard D, Ando S, Maggiolini M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "16239258", "url": "https://glygen.org/publication/PubMed/16239258" } ] }, { "title": "S-palmitoylation modulates estrogen receptor alpha localization and functions.", "journal": "Steroids", "date": "2006", "authors": "Marino M, Ascenzi P, Acconcia F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "16274718", "url": "https://glygen.org/publication/PubMed/16274718" } ] }, { "title": "Cysteine-disulfide cross-linking to monitor SNARE complex assembly during endoplasmic reticulum-Golgi transport.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Flanagan JJ, Barlowe C", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "16303754", "url": "https://glygen.org/publication/PubMed/16303754" } ] }, { "title": "Mechanism of estrogen activation of c-myc oncogene expression.", "journal": "Oncogene", "date": "1992", "authors": "Dubik D, Shiu RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "1630819", "url": "https://glygen.org/publication/PubMed/1630819" } ] }, { "title": "Phase III randomized trial of cisplatin plus placebo compared with cisplatin plus cetuximab in metastatic/recurrent head and neck cancer: an Eastern Cooperative Oncology Group study.", "journal": "Journal of clinical oncology : official journal of the American Society of Clinical Oncology", "date": "2005", "authors": "Burtness B, Goldwasser MA, Flood W, Mattar B, Forastiere AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5638303", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5638303" } ], "reference": [ { "type": "PubMed", "id": "16314626", "url": "https://glygen.org/publication/PubMed/16314626" } ] }, { "title": "Characterization of disulfide bond position in proteins and sequence analysis of cystine-bridged peptides by tandem mass spectrometry.", "journal": "Anal. Biochem.", "date": "1992", "authors": "Bean M F, Carr S A", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "reference": [ { "type": "PubMed", "id": "1632509", "url": "https://glygen.org/publication/PubMed/1632509" } ] }, { "title": "Dynamin and the actin cytoskeleton cooperatively regulate plasma membrane invagination by BAR and F-BAR proteins.", "journal": "Developmental cell", "date": "2005", "authors": "Itoh T, Erdmann KS, Roux A, Habermann B, Werner H, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16326391", "url": "https://glygen.org/publication/PubMed/16326391" } ] }, { "title": "The oncogenic properties of mutant p110alpha and p110beta phosphatidylinositol 3-kinases in human mammary epithelial cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Zhao JJ, Liu Z, Wang L, Shin E, Loda MF, Roberts TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "16339315", "url": "https://glygen.org/publication/PubMed/16339315" } ] }, { "title": "Cbl escapes Cdc42-mediated inhibition by downregulation of the adaptor molecule betaPix.", "journal": "Oncogene", "date": "2006", "authors": "Schmidt MHH, Husnjak K, Szymkiewicz I, Haglund K, Dikic I", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "16407834", "url": "https://glygen.org/publication/PubMed/16407834" } ] }, { "title": "Rab5-activating protein 6, a novel endosomal protein with a role in endocytosis.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Hunker CM, Galvis A, Kruk I, Giambini H, Veisaga ML, Barbieri MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16410077", "url": "https://glygen.org/publication/PubMed/16410077" } ] }, { "title": "B56-containing PP2A dephosphorylate ERK and their activity is controlled by the early gene IEX-1 and ERK.", "journal": "The EMBO journal", "date": "2006", "authors": "Letourneux C, Rocher G, Porteu F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811558", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811558" } ], "reference": [ { "type": "PubMed", "id": "16456541", "url": "https://glygen.org/publication/PubMed/16456541" } ] }, { "title": "Stonin 2 is an AP-2-dependent endocytic sorting adaptor for synaptotagmin internalization and recycling.", "journal": "Developmental cell", "date": "2006", "authors": "Diril MK, Wienisch M, Jung N, Klingauf J, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "16459302", "url": "https://glygen.org/publication/PubMed/16459302" } ] }, { "title": "The structural basis of arrestin-mediated regulation of G-protein-coupled receptors.", "journal": "Pharmacology & therapeutics", "date": "2006", "authors": "Gurevich VV, Gurevich EV", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "16460808", "url": "https://glygen.org/publication/PubMed/16460808" } ] }, { "title": "Molecular switches involving the AP-2 beta2 appendage regulate endocytic cargo selection and clathrin coat assembly.", "journal": "Developmental cell", "date": "2006", "authors": "Edeling MA, Mishra SK, Keyel PA, Steinhauser AL, Collins BM, Roth R, Heuser JE, Owen DJ, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "16516836", "url": "https://glygen.org/publication/PubMed/16516836" } ] }, { "title": "On and off membrane dynamics of the endoplasmic reticulum-golgi tethering factor p115 in vivo.", "journal": "Molecular biology of the cell", "date": "2006", "authors": "Brandon E, Szul T, Alvarez C, Grabski R, Benjamin R, Kawai R, Sztul E", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "16624868", "url": "https://glygen.org/publication/PubMed/16624868" } ] }, { "title": "Roles of tyrosine 589 and 591 in STAT5 activation and transformation mediated by FLT3-ITD.", "journal": "Blood", "date": "2006", "authors": "Rocnik JL, Okabe R, Yu JC, Lee BH, Giese N, Schenkein DP, Gilliland DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "16627759", "url": "https://glygen.org/publication/PubMed/16627759" } ] }, { "title": "Estrogen transactivates EGFR via the sphingosine 1-phosphate receptor Edg-3: the role of sphingosine kinase-1.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Sukocheva O, Wadham C, Holmes A, Albanese N, Verrier E, Feng F, Bernal A, Derian CK, Ullrich A, Vadas MA, Xia P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "16636149", "url": "https://glygen.org/publication/PubMed/16636149" } ] }, { "title": "Nature of functional estrogen receptors at the plasma membrane.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2006", "authors": "Pedram A, Razandi M, Levin ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "16645038", "url": "https://glygen.org/publication/PubMed/16645038" } ] }, { "title": "A pharmacological map of the PI3-K family defines a role for p110alpha in insulin signaling.", "journal": "Cell", "date": "2006", "authors": "Knight ZA, Gonzalez B, Feldman ME, Zunder ER, Goldenberg DD, Williams O, Loewith R, Stokoe D, Balla A, Toth B, Balla T, Weiss WA, Williams RL, Shokat KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "16647110", "url": "https://glygen.org/publication/PubMed/16647110" } ] }, { "title": "Identification of Y589 and Y599 in the juxtamembrane domain of Flt3 as ligand-induced autophosphorylation sites involved in binding of Src family kinases and the protein tyrosine phosphatase SHP2.", "journal": "Blood", "date": "2006", "authors": "Heiss E, Masson K, Sundberg C, Pedersen M, Sun J, Bengtsson S, Ronnstrand L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "16684964", "url": "https://glygen.org/publication/PubMed/16684964" } ] }, { "title": "Type Igamma661 phosphatidylinositol phosphate kinase directly interacts with AP2 and regulates endocytosis.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Bairstow SF, Ling K, Su X, Firestone AJ, Carbonara C, Anderson RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16707488", "url": "https://glygen.org/publication/PubMed/16707488" } ] }, { "title": "Endocytosis of the glucose transporter GLUT8 is mediated by interaction of a dileucine motif with the beta2-adaptin subunit of the AP-2 adaptor complex.", "journal": "Journal of cell science", "date": "2006", "authors": "Schmidt U, Briese S, Leicht K, Schurmann A, Joost HG, Al-Hasani H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "16723738", "url": "https://glygen.org/publication/PubMed/16723738" } ] }, { "title": "A burst of auxilin recruitment determines the onset of clathrin-coated vesicle uncoating.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Massol RH, Boll W, Griffin AM, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16798879", "url": "https://glygen.org/publication/PubMed/16798879" } ] }, { "title": "17beta-estradiol, genistein, and 4-hydroxytamoxifen induce the proliferation of thyroid cancer cells through the g protein-coupled receptor GPR30.", "journal": "Molecular pharmacology", "date": "2006", "authors": "Vivacqua A, Bonofiglio D, Albanito L, Madeo A, Rago V, Carpino A, Musti AM, Picard D, Ando S, Maggiolini M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "16835357", "url": "https://glygen.org/publication/PubMed/16835357" } ] }, { "title": "Stimulation of phosphatidylinositol kinase type I-mediated phosphatidylinositol (4,5)-bisphosphate synthesis by AP-2mu-cargo complexes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Krauss M, Kukhtina V, Pechstein A, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16880396", "url": "https://glygen.org/publication/PubMed/16880396" } ] }, { "title": "Analysis of deletions of the carboxyl terminus of the epidermal growth factor receptor reveals self-phosphorylation at tyrosine 992 and enhanced in vivo tyrosine phosphorylation of cell substrates.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Walton GM, Chen WS, Rosenfeld MG, Gill GN", "evidence": [ { "database": "Reactome", "id": "R-HSA-177929", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-177929" } ], "reference": [ { "type": "PubMed", "id": "1688559", "url": "https://glygen.org/publication/PubMed/1688559" } ] }, { "title": "Identification of two epidermal growth factor-sensitive tyrosine phosphorylation sites of phospholipase C-gamma in intact HSC-1 cells.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Wahl MI, Nishibe S, Kim JW, Kim H, Rhee SG, Carpenter G", "evidence": [ { "database": "Reactome", "id": "R-HSA-212718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212718" } ], "reference": [ { "type": "PubMed", "id": "1689311", "url": "https://glygen.org/publication/PubMed/1689311" } ] }, { "title": "Role of the AP2 beta-appendage hub in recruiting partners for clathrin-coated vesicle assembly.", "journal": "PLoS biology", "date": "2006", "authors": "Schmid EM, Ford MG, Burtey A, Praefcke GJ, Peak-Chew SY, Mills IG, Benmerah A, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16903783", "url": "https://glygen.org/publication/PubMed/16903783" } ] }, { "title": "SNAREs--engines for membrane fusion.", "journal": "Nature reviews. Molecular cell biology", "date": "2006", "authors": "Jahn R, Scheller RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "16912714", "url": "https://glygen.org/publication/PubMed/16912714" } ] }, { "title": "A cell-type-specific transcriptional network required for estrogen regulation of cyclin D1 and cell cycle progression in breast cancer.", "journal": "Genes & development", "date": "2006", "authors": "Eeckhoute J, Carroll JS, Geistlinger TR, Torres-Arzayus MI, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16980581", "url": "https://glygen.org/publication/PubMed/16980581" } ] }, { "title": "Sec16 defines endoplasmic reticulum exit sites and is required for secretory cargo export in mammalian cells.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2006", "authors": "Watson P, Townley AK, Koka P, Palmer KJ, Stephens DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "17005010", "url": "https://glygen.org/publication/PubMed/17005010" } ] }, { "title": "Cargo selectivity of the ERGIC-53/MCFD2 transport receptor complex.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2006", "authors": "Nyfeler B, Zhang B, Ginsburg D, Kaufman RJ, Hauri HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "17010120", "url": "https://glygen.org/publication/PubMed/17010120" } ] }, { "title": "Genome-wide analysis of estrogen receptor binding sites.", "journal": "Nature genetics", "date": "2006", "authors": "Carroll JS, Meyer CA, Song J, Li W, Geistlinger TR, Eeckhoute J, Brodsky AS, Keeton EK, Fertuck KC, Hall GF, Wang Q, Bekiranov S, Sementchenko V, Fox EA, Silver PA, Gingeras TR, Liu XS, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17013392", "url": "https://glygen.org/publication/PubMed/17013392" } ] }, { "title": "Cargo regulates clathrin-coated pit dynamics.", "journal": "Cell", "date": "2006", "authors": "Puthenveedu MA, von Zastrow M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17018281", "url": "https://glygen.org/publication/PubMed/17018281" } ] }, { "title": "Phosphoinositides in cell regulation and membrane dynamics.", "journal": "Nature", "date": "2006", "authors": "Di Paolo G, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17035995", "url": "https://glygen.org/publication/PubMed/17035995" } ] }, { "title": "Integration of rapid signaling events with steroid hormone receptor action in breast and prostate cancer.", "journal": "Annual review of physiology", "date": "2007", "authors": "Lange CA, Gioeli D, Hammes SR, Marker PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "17037979", "url": "https://glygen.org/publication/PubMed/17037979" } ] }, { "title": "SNARE status regulates tether recruitment and function in homotypic COPII vesicle fusion.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Bentley M, Liang Y, Mullen K, Xu D, Sztul E, Hay JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "17038314", "url": "https://glygen.org/publication/PubMed/17038314" } ] }, { "title": "Two synaptojanin 1 isoforms are recruited to clathrin-coated pits at different stages.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Perera RM, Zoncu R, Lucast L, De Camilli P, Toomre D", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17158794", "url": "https://glygen.org/publication/PubMed/17158794" } ] }, { "title": "Association of p21ras with phosphatidylinositol 3-kinase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1991", "authors": "Sjolander A, Yamamoto K, Huber BE, Lapetina EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "1716764", "url": "https://glygen.org/publication/PubMed/1716764" } ] }, { "title": "Two mammalian Sec16 homologues have nonredundant functions in endoplasmic reticulum (ER) export and transitional ER organization.", "journal": "Molecular biology of the cell", "date": "2007", "authors": "Bhattacharyya D, Glick BS", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "17192411", "url": "https://glygen.org/publication/PubMed/17192411" } ] }, { "title": "Inhibition of B56-containing protein phosphatase 2As by the early response gene IEX-1 leads to control of Akt activity.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Rocher G, Letourneux C, Lenormand P, Porteu F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811558", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811558" } ], "reference": [ { "type": "PubMed", "id": "17200115", "url": "https://glygen.org/publication/PubMed/17200115" } ] }, { "title": "Downregulation of CD4 by human immunodeficiency virus type 1 Nef is dependent on clathrin and involves direct interaction of Nef with the AP2 clathrin adaptor.", "journal": "Journal of virology", "date": "2007", "authors": "Chaudhuri R, Lindwasser OW, Smith WJ, Hurley JH, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "17267500", "url": "https://glygen.org/publication/PubMed/17267500" } ] }, { "title": "Cooperative demethylation by JMJD2C and LSD1 promotes androgen receptor-dependent gene expression.", "journal": "Nature cell biology", "date": "2007", "authors": "Wissmann M, Yin N, Muller JM, Greschik H, Fodor BD, Jenuwein T, Vogler C, Schneider R, Gunther T, Buettner R, Metzger E, Schule R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17277772", "url": "https://glygen.org/publication/PubMed/17277772" } ] }, { "title": "TRAPPI tethers COPII vesicles by binding the coat subunit Sec23.", "journal": "Nature", "date": "2007", "authors": "Cai H, Yu S, Menon S, Cai Y, Lazarova D, Fu C, Reinisch K, Hay JC, Ferro-Novick S", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "17287728", "url": "https://glygen.org/publication/PubMed/17287728" } ] }, { "title": "G protein-coupled receptor 30 (GPR30) mediates gene expression changes and growth response to 17beta-estradiol and selective GPR30 ligand G-1 in ovarian cancer cells.", "journal": "Cancer research", "date": "2007", "authors": "Albanito L, Madeo A, Lappano R, Vivacqua A, Rago V, Carpino A, Oprea TI, Prossnitz ER, Musti AM, Ando S, Maggiolini M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "17308128", "url": "https://glygen.org/publication/PubMed/17308128" } ] }, { "title": "Mechanisms of COPII vesicle formation and protein sorting.", "journal": "FEBS letters", "date": "2007", "authors": "Sato K, Nakano A", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "17316621", "url": "https://glygen.org/publication/PubMed/17316621" } ] }, { "title": "The gamma/sigma1 and alpha/sigma2 hemicomplexes of clathrin adaptors AP-1 and AP-2 harbor the dileucine recognition site.", "journal": "Molecular biology of the cell", "date": "2007", "authors": "Doray B, Lee I, Knisely J, Bu G, Kornfeld S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "17360967", "url": "https://glygen.org/publication/PubMed/17360967" } ] }, { "title": "Steroid hormone rapid signaling: the pivotal role of S-palmitoylation.", "journal": "IUBMB life", "date": "2006", "authors": "Marino M, Ascenzi P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "17424910", "url": "https://glygen.org/publication/PubMed/17424910" } ] }, { "title": "Src-dependent phosphorylation of beta2-adaptin dissociates the beta-arrestin-AP-2 complex.", "journal": "Journal of cell science", "date": "2007", "authors": "Fessart D, Simaan M, Zimmerman B, Comeau J, Hamdan FF, Wiseman PW, Bouvier M, Laporte SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "17456551", "url": "https://glygen.org/publication/PubMed/17456551" } ] }, { "title": "Regulation of GREB1 transcription by estrogen receptor alpha through a multipartite enhancer spread over 20 kb of upstream flanking sequences.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Deschenes J, Bourdeau V, White JH, Mader S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17463000", "url": "https://glygen.org/publication/PubMed/17463000" } ] }, { "title": "A novel AAK1 splice variant functions at multiple steps of the endocytic pathway.", "journal": "Molecular biology of the cell", "date": "2007", "authors": "Henderson DM, Conner SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17494869", "url": "https://glygen.org/publication/PubMed/17494869" } ] }, { "title": "The DEAD-box p68/p72 proteins and the noncoding RNA steroid receptor activator SRA: eclectic regulators of disparate biological functions.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2007", "authors": "Caretti G, Lei EP, Sartorelli V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17495528", "url": "https://glygen.org/publication/PubMed/17495528" } ] }, { "title": "The transport signal on Sec22 for packaging into COPII-coated vesicles is a conformational epitope.", "journal": "Molecular cell", "date": "2007", "authors": "Mancias JD, Goldberg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "17499046", "url": "https://glygen.org/publication/PubMed/17499046" } ] }, { "title": "Novel estrogen receptor-alpha binding sites and estradiol target genes identified by chromatin immunoprecipitation cloning in breast cancer.", "journal": "Cancer research", "date": "2007", "authors": "Lin Z, Reierstad S, Huang CC, Bulun SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17510434", "url": "https://glygen.org/publication/PubMed/17510434" } ] }, { "title": "Curved EFC/F-BAR-domain dimers are joined end to end into a filament for membrane invagination in endocytosis.", "journal": "Cell", "date": "2007", "authors": "Shimada A, Niwa H, Tsujita K, Suetsugu S, Nitta K, Hanawa-Suetsugu K, Akasaka R, Nishino Y, Toyama M, Chen L, Liu ZJ, Wang BC, Yamamoto M, Terada T, Miyazawa A, Tanaka A, Sugano S, Shirouzu M, Nagayama K, Takenawa T, Yokoyama S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17512409", "url": "https://glygen.org/publication/PubMed/17512409" } ] }, { "title": "Clathrin-dependent entry of severe acute respiratory syndrome coronavirus into target cells expressing ACE2 with the cytoplasmic tail deleted.", "journal": "Journal of virology", "date": "2007", "authors": "Inoue Y, Tanaka N, Tanaka Y, Inoue S, Morita K, Zhuang M, Hattori T, Sugamura K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "17522231", "url": "https://glygen.org/publication/PubMed/17522231" } ] }, { "title": "Estrogen signaling via a linear pathway involving insulin-like growth factor I receptor, matrix metalloproteinases, and epidermal growth factor receptor to activate mitogen-activated protein kinase in MCF-7 breast cancer cells.", "journal": "Endocrinology", "date": "2007", "authors": "Song RX, Zhang Z, Chen Y, Bao Y, Santen RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "17525128", "url": "https://glygen.org/publication/PubMed/17525128" } ] }, { "title": "A conserved mechanism for steroid receptor translocation to the plasma membrane.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Pedram A, Razandi M, Sainson RC, Kim JK, Hughes CC, Levin ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "17535799", "url": "https://glygen.org/publication/PubMed/17535799" } ] }, { "title": "Structure and analysis of FCHo2 F-BAR domain: a dimerizing and membrane recruitment module that effects membrane curvature.", "journal": "Structure (London, England : 1993)", "date": "2007", "authors": "Henne WM, Kent HM, Ford MG, Hegde BG, Daumke O, Butler PJ, Mittal R, Langen R, Evans PR, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17540576", "url": "https://glygen.org/publication/PubMed/17540576" } ] }, { "title": "Specific Rab GTPase-activating proteins define the Shiga toxin and epidermal growth factor uptake pathways.", "journal": "The Journal of cell biology", "date": "2007", "authors": "Fuchs E, Haas AK, Spooner RA, Yoshimura S, Lord JM, Barr FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "17562788", "url": "https://glygen.org/publication/PubMed/17562788" } ] }, { "title": "Cornichon regulates transport and secretion of TGFalpha-related proteins in metazoan cells.", "journal": "J. Cell Sci.", "date": "2007", "authors": "Castro CP, Piscopo D, Nakagawa T, Derynck R", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" }, { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "17607000", "url": "https://glygen.org/publication/PubMed/17607000" } ] }, { "title": "SNX9 couples actin assembly to phosphoinositide signals and is required for membrane remodeling during endocytosis.", "journal": "Developmental cell", "date": "2007", "authors": "Yarar D, Waterman-Storer CM, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17609109", "url": "https://glygen.org/publication/PubMed/17609109" } ] }, { "title": "Mechanism of two classes of cancer mutations in the phosphoinositide 3-kinase catalytic subunit.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Miled N, Yan Y, Hon WC, Perisic O, Zvelebil M, Inbar Y, Schneidman-Duhovny D, Wolfson HJ, Backer JM, Williams RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "17626883", "url": "https://glygen.org/publication/PubMed/17626883" } ] }, { "title": "The AP-1 transcription factor regulates breast cancer cell growth via cyclins and E2F factors.", "journal": "Oncogene", "date": "2008", "authors": "Shen Q, Uray IP, Li Y, Krisko TI, Strecker TE, Kim HT, Brown PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17637753", "url": "https://glygen.org/publication/PubMed/17637753" } ] }, { "title": "Long-range activation of GREB1 by estrogen receptor via three distal consensus estrogen-responsive elements in breast cancer cells.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2007", "authors": "Sun J, Nawaz Z, Slingerland JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17666587", "url": "https://glygen.org/publication/PubMed/17666587" } ] }, { "title": "Sorting nexin 9 interacts with dynamin 1 and N-WASP and coordinates synaptic vesicle endocytosis.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Shin N, Lee S, Ahn N, Kim SA, Ahn SG, YongPark Z, Chang S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17681954", "url": "https://glygen.org/publication/PubMed/17681954" } ] }, { "title": "Analysis of GTPase-activating proteins: Rab1 and Rab43 are key Rabs required to maintain a functional Golgi complex in human cells.", "journal": "Journal of cell science", "date": "2007", "authors": "Haas AK, Yoshimura S, Stephens DJ, Preisinger C, Fuchs E, Barr FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "17684057", "url": "https://glygen.org/publication/PubMed/17684057" } ] }, { "title": "Mechanism of and requirement for estrogen-regulated MYB expression in estrogen-receptor-positive breast cancer cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Drabsch Y, Hugo H, Zhang R, Dowhan DH, Miao YR, Gewirtz AM, Barry SC, Ramsay RG, Gonda TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17690249", "url": "https://glygen.org/publication/PubMed/17690249" } ] }, { "title": "Integrating molecular and network biology to decode endocytosis.", "journal": "Nature", "date": "2007", "authors": "Schmid EM, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "17713526", "url": "https://glygen.org/publication/PubMed/17713526" } ] }, { "title": "The NECAP PHear domain increases clathrin accessory protein binding potential.", "journal": "The EMBO journal", "date": "2007", "authors": "Ritter B, Denisov AY, Philie J, Allaire PD, Legendre-Guillemin V, Zylbergold P, Gehring K, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17762867", "url": "https://glygen.org/publication/PubMed/17762867" } ] }, { "title": "A role of the Lowe syndrome protein OCRL in early steps of the endocytic pathway.", "journal": "Developmental cell", "date": "2007", "authors": "Erdmann KS, Mao Y, McCrea HJ, Zoncu R, Lee S, Paradise S, Modregger J, Biemesderfer D, Toomre D, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17765681", "url": "https://glygen.org/publication/PubMed/17765681" } ] }, { "title": "Extranuclear steroid receptors: nature and actions.", "journal": "Endocrine reviews", "date": "2007", "authors": "Hammes SR, Levin ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "17916740", "url": "https://glygen.org/publication/PubMed/17916740" } ] }, { "title": "Variant estrogen receptor-c-Src molecular interdependence and c-Src structural requirements for endothelial NO synthase activation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Li L, Hisamoto K, Kim KH, Haynes MP, Bauer PM, Sanjay A, Collinge M, Baron R, Sessa WC, Bender JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "17921256", "url": "https://glygen.org/publication/PubMed/17921256" } ] }, { "title": "A motif in the clathrin heavy chain required for the Hsc70/auxilin uncoating reaction.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "Rapoport I, Boll W, Yu A, Bocking T, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17978091", "url": "https://glygen.org/publication/PubMed/17978091" } ] }, { "title": "ANCCA, an estrogen-regulated AAA+ ATPase coactivator for ERalpha, is required for coregulator occupancy and chromatin modification.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Zou JX, Revenko AS, Li LB, Gemo AT, Chen HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "17998543", "url": "https://glygen.org/publication/PubMed/17998543" } ] }, { "title": "Oncogenic signaling of class I PI3K isoforms.", "journal": "Oncogene", "date": "2008", "authors": "Denley A, Kang S, Karst U, Vogt PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "17998941", "url": "https://glygen.org/publication/PubMed/17998941" } ] }, { "title": "Molecular basis of sugar recognition by the human L-type lectins ERGIC-53, VIPL, and VIP36.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Kamiya Y, Kamiya D, Yamamoto K, Nyfeler B, Hauri HP, Kato K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "18025080", "url": "https://glygen.org/publication/PubMed/18025080" } ] }, { "title": "A diacidic motif in human immunodeficiency virus type 1 Nef is a novel determinant of binding to AP-2.", "journal": "Journal of virology", "date": "2008", "authors": "Lindwasser OW, Smith WJ, Chaudhuri R, Yang P, Hurley JH, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "18032517", "url": "https://glygen.org/publication/PubMed/18032517" } ] }, { "title": "The structure of a human p110alpha/p85alpha complex elucidates the effects of oncogenic PI3Kalpha mutations.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Huang CH, Mandelker D, Schmidt-Kittler O, Samuels Y, Velculescu VE, Kinzler KW, Vogelstein B, Gabelli SB, Amzel LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "18079394", "url": "https://glygen.org/publication/PubMed/18079394" } ] }, { "title": "The dual phosphatase activity of synaptojanin1 is required for both efficient synaptic vesicle endocytosis and reavailability at nerve terminals.", "journal": "Neuron", "date": "2007", "authors": "Mani M, Lee SY, Lucast L, Cremona O, Di Paolo G, De Camilli P, Ryan TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "18093523", "url": "https://glygen.org/publication/PubMed/18093523" } ] }, { "title": "Molecular basis of synaptic vesicle cargo recognition by the endocytic sorting adaptor stonin 2.", "journal": "The Journal of cell biology", "date": "2007", "authors": "Jung N, Wienisch M, Gu M, Rand JB, Muller SL, Krause G, Jorgensen EM, Klingauf J, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "18166656", "url": "https://glygen.org/publication/PubMed/18166656" } ] }, { "title": "DNA oxidation as triggered by H3K9me2 demethylation drives estrogen-induced gene expression.", "journal": "Science (New York, N.Y.)", "date": "2008", "authors": "Perillo B, Ombra MN, Bertoni A, Cuozzo C, Sacchetti S, Sasso A, Chiariotti L, Malorni A, Abbondanza C, Avvedimento EV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18187655", "url": "https://glygen.org/publication/PubMed/18187655" } ] }, { "title": "The ubiquitin-like protein PLIC-2 is a negative regulator of G protein-coupled receptor endocytosis.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "N'Diaye EN, Hanyaloglu AC, Kajihara KK, Puthenveedu MA, Wu P, von Zastrow M, Brown EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "18199683", "url": "https://glygen.org/publication/PubMed/18199683" } ] }, { "title": "Membrane association of estrogen receptor alpha and beta influences 17beta-estradiol-mediated cancer cell proliferation.", "journal": "Steroids", "date": "2008", "authors": "Marino M, Ascenzi P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "18206197", "url": "https://glygen.org/publication/PubMed/18206197" } ] }, { "title": "Cohesins localize with CTCF at the KSHV latency control region and at cellular c-myc and H19/Igf2 insulators.", "journal": "The EMBO journal", "date": "2008", "authors": "Stedman W, Kang H, Lin S, Kissil JL, Bartolomei MS, Lieberman PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18219272", "url": "https://glygen.org/publication/PubMed/18219272" } ] }, { "title": "Genome-wide mapping and characterization of hypomethylated sites in human tissues and breast cancer cell lines.", "journal": "Genome research", "date": "2008", "authors": "Shann YJ, Cheng C, Chiao CH, Chen DT, Li PH, Hsu MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18256232", "url": "https://glygen.org/publication/PubMed/18256232" } ] }, { "title": "Identification of ERGIC-53 as an intracellular transport receptor of alpha1-antitrypsin.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Nyfeler B, Reiterer V, Wendeler MW, Stefan E, Zhang B, Michnick SW, Hauri HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "18283111", "url": "https://glygen.org/publication/PubMed/18283111" } ] }, { "title": "The cargo receptors Surf4, endoplasmic reticulum-Golgi intermediate compartment (ERGIC)-53, and p25 are required to maintain the architecture of ERGIC and Golgi.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "Mitrovic S, Ben-Tekaya H, Koegler E, Gruenberg J, Hauri HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "18287528", "url": "https://glygen.org/publication/PubMed/18287528" } ] }, { "title": "Mutations in the catalytic subunit of class IA PI3K confer leukemogenic potential to hematopoietic cells.", "journal": "Oncogene", "date": "2008", "authors": "Horn S, Bergholz U, Jucker M, McCubrey JA, Trumper L, Stocking C, Basecke J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "18317450", "url": "https://glygen.org/publication/PubMed/18317450" } ] }, { "title": "Transient cyclical methylation of promoter DNA.", "journal": "Nature", "date": "2008", "authors": "Kangaspeska S, Stride B, Metivier R, Polycarpou-Schwarz M, Ibberson D, Carmouche RP, Benes V, Gannon F, Reid G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18322535", "url": "https://glygen.org/publication/PubMed/18322535" } ] }, { "title": "FoxA1 translates epigenetic signatures into enhancer-driven lineage-specific transcription.", "journal": "Cell", "date": "2008", "authors": "Lupien M, Eeckhoute J, Meyer CA, Wang Q, Zhang Y, Li W, Carroll JS, Liu XS, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18358809", "url": "https://glygen.org/publication/PubMed/18358809" } ] }, { "title": "SNX9 regulates tubular invagination of the plasma membrane through interaction with actin cytoskeleton and dynamin 2.", "journal": "Journal of cell science", "date": "2008", "authors": "Shin N, Ahn N, Chang-Ileto B, Park J, Takei K, Ahn SG, Kim SA, Di Paolo G, Chang S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "18388313", "url": "https://glygen.org/publication/PubMed/18388313" } ] }, { "title": "A brief introduction to FOXOlogy.", "journal": "Oncogene", "date": "2008", "authors": "Burgering BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "18391968", "url": "https://glygen.org/publication/PubMed/18391968" } ] }, { "title": "Epidermal growth factor induces G protein-coupled receptor 30 expression in estrogen receptor-negative breast cancer cells.", "journal": "Endocrinology", "date": "2008", "authors": "Albanito L, Sisci D, Aquila S, Brunelli E, Vivacqua A, Madeo A, Lappano R, Pandey DP, Picard D, Mauro L, Ando S, Maggiolini M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "18467441", "url": "https://glygen.org/publication/PubMed/18467441" } ] }, { "title": "Estrogen and MYB in breast cancer: potential for new therapies.", "journal": "Expert opinion on biological therapy", "date": "2008", "authors": "Gonda TJ, Leo P, Ramsay RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18476782", "url": "https://glygen.org/publication/PubMed/18476782" } ] }, { "title": "Interaction of phosphoinositide cycle intermediates with the plasma membrane-associated clathrin assembly protein AP-2.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Beck KA, Keen JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "1847920", "url": "https://glygen.org/publication/PubMed/1847920" } ] }, { "title": "Meta-analysis of human cancer microarrays reveals GATA3 is integral to the estrogen receptor alpha pathway.", "journal": "Molecular cancer", "date": "2008", "authors": "Wilson BJ, Giguere V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18533032", "url": "https://glygen.org/publication/PubMed/18533032" } ] }, { "title": "Essential roles of PI(3)K-p110beta in cell growth, metabolism and tumorigenesis.", "journal": "Nature", "date": "2008", "authors": "Jia S, Liu Z, Zhang S, Liu P, Zhang L, Lee SH, Zhang J, Signoretti S, Loda M, Roberts TM, Zhao JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "18594509", "url": "https://glygen.org/publication/PubMed/18594509" } ] }, { "title": "Identification and characterization of NVP-BEZ235, a new orally available dual phosphatidylinositol 3-kinase/mammalian target of rapamycin inhibitor with potent in vivo antitumor activity.", "journal": "Molecular cancer therapeutics", "date": "2008", "authors": "Maira SM, Stauffer F, Brueggen J, Furet P, Schnell C, Fritsch C, Brachmann S, Chene P, De Pover A, Schoemaker K, Fabbro D, Gabriel D, Simonen M, Murphy L, Finan P, Sellers W, Garcia-Echeverria C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "18606717", "url": "https://glygen.org/publication/PubMed/18606717" } ] }, { "title": "Regulation of estrogen rapid signaling through arginine methylation by PRMT1.", "journal": "Molecular cell", "date": "2008", "authors": "Le Romancer M, Treilleux I, Leconte N, Robin-Lespinasse Y, Sentis S, Bouchekioua-Bouzaghou K, Goddard S, Gobert-Gosse S, Corbo L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "18657504", "url": "https://glygen.org/publication/PubMed/18657504" } ] }, { "title": "The identification of 2-(1H-indazol-4-yl)-6-(4-methanesulfonyl-piperazin-1-ylmethyl)-4-morpholin-4-yl-t hieno[3,2-d]pyrimidine (GDC-0941) as a potent, selective, orally bioavailable inhibitor of class I PI3 kinase for the treatment of cancer .", "journal": "Journal of medicinal chemistry", "date": "2008", "authors": "Folkes AJ, Ahmadi K, Alderton WK, Alix S, Baker SJ, Box G, Chuckowree IS, Clarke PA, Depledge P, Eccles SA, Friedman LS, Hayes A, Hancox TC, Kugendradas A, Lensun L, Moore P, Olivero AG, Pang J, Patel S, Pergl-Wilson GH, Raynaud FI, Robson A, Saghir N, Salphati L, Sohal S, Ultsch MH, Valenti M, Wallweber HJ, Wan NC, Wiesmann C, Workman P, Zhyvoloup A, Zvelebil MJ, Shuttleworth SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "18754654", "url": "https://glygen.org/publication/PubMed/18754654" } ] }, { "title": "PTEN-deficient cancers depend on PIK3CB.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Wee S, Wiederschain D, Maira SM, Loo A, Miller C, deBeaumont R, Stegmeier F, Yao YM, Lengauer C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "18755892", "url": "https://glygen.org/publication/PubMed/18755892" } ] }, { "title": "EGF receptor-independent action of TGF-alpha protects Naked2 from AO7-mediated ubiquitylation and proteasomal degradation.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2008", "authors": "Ding W, Li C, Hu T, Graves-Deal R, Fotia AB, Weissman AM, Coffey RJ", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "reference": [ { "type": "PubMed", "id": "18757723", "url": "https://glygen.org/publication/PubMed/18757723" } ] }, { "title": "Cathepsin D: a cellular roadmap.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Zaidi N, Maurer A, Nieke S, Kalbacher H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18762174", "url": "https://glygen.org/publication/PubMed/18762174" } ] }, { "title": "Molecular basis for the sorting of the SNARE VAMP7 into endocytic clathrin-coated vesicles by the ArfGAP Hrb.", "journal": "Cell", "date": "2008", "authors": "Pryor PR, Jackson L, Gray SR, Edeling MA, Thompson A, Sanderson CM, Evans PR, Owen DJ, Luzio JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "18775314", "url": "https://glygen.org/publication/PubMed/18775314" } ] }, { "title": "Essential role of ERK dimers in the activation of cytoplasmic but not nuclear substrates by ERK-scaffold complexes.", "journal": "Molecular cell", "date": "2008", "authors": "Casar B, Pinto A, Crespo P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "18775330", "url": "https://glygen.org/publication/PubMed/18775330" } ] }, { "title": "Estrogen-induced Bcl-2 expression after spinal cord injury is mediated through phosphoinositide-3-kinase/Akt-dependent CREB activation.", "journal": "Journal of neurotrauma", "date": "2008", "authors": "Yune TY, Park HG, Lee JY, Oh TH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "18785877", "url": "https://glygen.org/publication/PubMed/18785877" } ] }, { "title": "Actin binding by Hip1 (huntingtin-interacting protein 1) and Hip1R (Hip1-related protein) is regulated by clathrin light chain.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Wilbur JD, Chen CY, Manalo V, Hwang PK, Fletterick RJ, Brodsky FM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "18790740", "url": "https://glygen.org/publication/PubMed/18790740" } ] }, { "title": "Marking time: the dynamic role of chromatin and covalent modification in transcription.", "journal": "The international journal of biochemistry & cell biology", "date": "2009", "authors": "Reid G, Gallais R, Metivier R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18805503", "url": "https://glygen.org/publication/PubMed/18805503" } ] }, { "title": "Role of HRB in clathrin-dependent endocytosis.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Chaineau M, Danglot L, Proux-Gillardeaux V, Galli T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "18819912", "url": "https://glygen.org/publication/PubMed/18819912" } ] }, { "title": "NVP-BEZ235, a dual PI3K/mTOR inhibitor, prevents PI3K signaling and inhibits the growth of cancer cells with activating PI3K mutations.", "journal": "Cancer research", "date": "2008", "authors": "Serra V, Markman B, Scaltriti M, Eichhorn PJ, Valero V, Guzman M, Botero ML, Llonch E, Atzori F, Di Cosimo S, Maira M, Garcia-Echeverria C, Parra JL, Arribas J, Baselga J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "18829560", "url": "https://glygen.org/publication/PubMed/18829560" } ] }, { "title": "Structural basis of cargo membrane protein discrimination by the human COPII coat machinery.", "journal": "The EMBO journal", "date": "2008", "authors": "Mancias JD, Goldberg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "18843296", "url": "https://glygen.org/publication/PubMed/18843296" } ] }, { "title": "mTOR complex 2 (mTORC2) controls hydrophobic motif phosphorylation and activation of serum- and glucocorticoid-induced protein kinase 1 (SGK1).", "journal": "The Biochemical journal", "date": "2008", "authors": "Garcia-Martinez JM, Alessi DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "18925875", "url": "https://glygen.org/publication/PubMed/18925875" } ] }, { "title": "Coordinated regulation of AP2 uncoating from clathrin-coated vesicles by rab5 and hRME-6.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Semerdjieva S, Shortt B, Maxwell E, Singh S, Fonarev P, Hansen J, Schiavo G, Grant BD, Smythe E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "18981233", "url": "https://glygen.org/publication/PubMed/18981233" } ] }, { "title": "The GTPase superfamily: conserved structure and molecular mechanism.", "journal": "Nature", "date": "1991", "authors": "Bourne HR, Sanders DA, McCormick F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "1898771", "url": "https://glygen.org/publication/PubMed/1898771" } ] }, { "title": "CXXC5 is a novel BMP4-regulated modulator of Wnt signaling in neural stem cells.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Andersson T, Sodersten E, Duckworth JK, Cascante A, Fritz N, Sacchetti P, Cervenka I, Bryja V, Hermanson O", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19001364", "url": "https://glygen.org/publication/PubMed/19001364" } ] }, { "title": "Transcriptional regulation of the cyclin D1 gene at a glance.", "journal": "Journal of cell science", "date": "2008", "authors": "Klein EA, Assoian RK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19020303", "url": "https://glygen.org/publication/PubMed/19020303" } ] }, { "title": "Epsin 1 is involved in recruitment of ubiquitinated EGF receptors into clathrin-coated pits.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2009", "authors": "Kazazic M, Bertelsen V, Pedersen KW, Vuong TT, Grandal MV, Rodland MS, Traub LM, Stang E, Madshus IH", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "19054389", "url": "https://glygen.org/publication/PubMed/19054389" } ] }, { "title": "SNX9 - a prelude to vesicle release.", "journal": "Journal of cell science", "date": "2009", "authors": "Lundmark R, Carlsson SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19092055", "url": "https://glygen.org/publication/PubMed/19092055" } ] }, { "title": "The lysine demethylase LSD1 (KDM1) is required for maintenance of global DNA methylation.", "journal": "Nature genetics", "date": "2009", "authors": "Wang J, Hevi S, Kurash JK, Lei H, Gay F, Bajko J, Su H, Sun W, Chang H, Xu G, Gaudet F, Li E, Chen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19098913", "url": "https://glygen.org/publication/PubMed/19098913" } ] }, { "title": "Estrogen signals via an extra-nuclear pathway involving IGF-1R and EGFR in tamoxifen-sensitive and -resistant breast cancer cells.", "journal": "Steroids", "date": "2009", "authors": "Santen RJ, Fan P, Zhang Z, Bao Y, Song RX, Yue W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "19138696", "url": "https://glygen.org/publication/PubMed/19138696" } ] }, { "title": "A structural explanation for the binding of endocytic dileucine motifs by the AP2 complex.", "journal": "Nature", "date": "2008", "authors": "Kelly BT, McCoy AJ, Spate K, Miller SE, Evans PR, Honing S, Owen DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "19140243", "url": "https://glygen.org/publication/PubMed/19140243" } ] }, { "title": "Membrane fusion: grappling with SNARE and SM proteins.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Sudhof TC, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "19164740", "url": "https://glygen.org/publication/PubMed/19164740" } ] }, { "title": "PI 3-kinase and cancer: changing accents.", "journal": "Current opinion in genetics & development", "date": "2009", "authors": "Vogt PK, Gymnopoulos M, Hart JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "19185485", "url": "https://glygen.org/publication/PubMed/19185485" } ] }, { "title": "Functional proteomics identify cornichon proteins as auxiliary subunits of AMPA receptors.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Schwenk J, Harmel N, Zolles G, Bildl W, Kulik A, Heimrich B, Chisaka O, Jonas P, Schulte U, Fakler B, Klocker N", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "19265014", "url": "https://glygen.org/publication/PubMed/19265014" } ] }, { "title": "TANGO1 facilitates cargo loading at endoplasmic reticulum exit sites.", "journal": "Cell", "date": "2009", "authors": "Saito K, Chen M, Bard F, Chen S, Zhou H, Woodley D, Polischuk R, Schekman R, Malhotra V", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "19269366", "url": "https://glygen.org/publication/PubMed/19269366" } ] }, { "title": "Breast cancer, estrogen receptor and ligands.", "journal": "Archiv der Pharmazie", "date": "2009", "authors": "Bai Z, Gust R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19274700", "url": "https://glygen.org/publication/PubMed/19274700" } ] }, { "title": "ERK dimers and scaffold proteins: unexpected partners for a forgotten (cytoplasmic) task.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2009", "authors": "Casar B, Pinto A, Crespo P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "19279408", "url": "https://glygen.org/publication/PubMed/19279408" } ] }, { "title": "Clathrin regulates the association of PIPKIgamma661 with the AP-2 adaptor beta2 appendage.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Thieman JR, Mishra SK, Ling K, Doray B, Anderson RA, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19287005", "url": "https://glygen.org/publication/PubMed/19287005" } ] }, { "title": "Histone modifications at human enhancers reflect global cell-type-specific gene expression.", "journal": "Nature", "date": "2009", "authors": "Heintzman ND, Hon GC, Hawkins RD, Kheradpour P, Stark A, Harp LF, Ye Z, Lee LK, Stuart RK, Ching CW, Ching KA, Antosiewicz-Bourget JE, Liu H, Zhang X, Green RD, Lobanenkov VV, Stewart R, Thomson JA, Crawford GE, Kellis M, Ren B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19295514", "url": "https://glygen.org/publication/PubMed/19295514" } ] }, { "title": "Cargo and dynamin regulate clathrin-coated pit maturation.", "journal": "PLoS biology", "date": "2009", "authors": "Loerke D, Mettlen M, Yarar D, Jaqaman K, Jaqaman H, Danuser G, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19296720", "url": "https://glygen.org/publication/PubMed/19296720" } ] }, { "title": "Androgen-induced coactivator ANCCA mediates specific androgen receptor signaling in prostate cancer.", "journal": "Cancer research", "date": "2009", "authors": "Zou JX, Guo L, Revenko AS, Tepper CG, Gemo AT, Kung HJ, Chen HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "19318566", "url": "https://glygen.org/publication/PubMed/19318566" } ] }, { "title": "Genomic responses from the estrogen-responsive element-dependent signaling pathway mediated by estrogen receptor alpha are required to elicit cellular alterations.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Nott SL, Huang Y, Li X, Fluharty BR, Qiu X, Welshons WV, Yeh S, Muyan M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19321454", "url": "https://glygen.org/publication/PubMed/19321454" } ] }, { "title": "E2-mediated cathepsin D (CTSD) activation involves looping of distal enhancer elements.", "journal": "Molecular oncology", "date": "2008", "authors": "Bretschneider N, Kangaspeska S, Seifert M, Reid G, Gannon F, Denger S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19383337", "url": "https://glygen.org/publication/PubMed/19383337" } ] }, { "title": "Ligand-independent HER2/HER3/PI3K complex is disrupted by trastuzumab and is effectively inhibited by the PI3K inhibitor GDC-0941.", "journal": "Cancer cell", "date": "2009", "authors": "Junttila TT, Akita RW, Parsons K, Fields C, Lewis Phillips GD, Friedman LS, Sampath D, Sliwkowski MX", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "19411071", "url": "https://glygen.org/publication/PubMed/19411071" } ] }, { "title": "Endocytic accessory proteins are functionally distinguished by their differential effects on the maturation of clathrin-coated pits.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Mettlen M, Stoeber M, Loerke D, Antonescu CN, Danuser G, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19458185", "url": "https://glygen.org/publication/PubMed/19458185" } ] }, { "title": "A PH domain within OCRL bridges clathrin-mediated membrane trafficking to phosphoinositide metabolism.", "journal": "The EMBO journal", "date": "2009", "authors": "Mao Y, Balkin DM, Zoncu R, Erdmann KS, Tomasini L, Hu F, Jin MM, Hodsdon ME, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19536138", "url": "https://glygen.org/publication/PubMed/19536138" } ] }, { "title": "Stimulating the GPR30 estrogen receptor with a novel tamoxifen analogue activates SF-1 and promotes endometrial cell proliferation.", "journal": "Cancer research", "date": "2009", "authors": "Lin BC, Suzawa M, Blind RD, Tobias SC, Bulun SE, Scanlan TS, Ingraham HA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "19549922", "url": "https://glygen.org/publication/PubMed/19549922" } ] }, { "title": "The p24 family and selective transport processes at the ER-Golgi interface.", "journal": "Biology of the cell", "date": "2009", "authors": "Strating JR, Martens GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "19566487", "url": "https://glygen.org/publication/PubMed/19566487" } ] }, { "title": "Molecular circuitry of endocytosis at nerve terminals.", "journal": "Annual review of cell and developmental biology", "date": "2009", "authors": "Dittman J, Ryan TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19575674", "url": "https://glygen.org/publication/PubMed/19575674" } ] }, { "title": "PtdIns5P protects Akt from dephosphorylation through PP2A inhibition.", "journal": "Biochemical and biophysical research communications", "date": "2009", "authors": "Ramel D, Lagarrigue F, Dupuis-Coronas S, Chicanne G, Leslie N, Gaits-Iacovoni F, Payrastre B, Tronchere H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811558", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811558" } ], "reference": [ { "type": "PubMed", "id": "19576174", "url": "https://glygen.org/publication/PubMed/19576174" } ] }, { "title": "Rab GTPases as coordinators of vesicle traffic.", "journal": "Nature reviews. Molecular cell biology", "date": "2009", "authors": "Stenmark H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19603039", "url": "https://glygen.org/publication/PubMed/19603039" } ] }, { "title": "Organisation of human ER-exit sites: requirements for the localisation of Sec16 to transitional ER.", "journal": "Journal of cell science", "date": "2009", "authors": "Hughes H, Budnik A, Schmidt K, Palmer KJ, Mantell J, Noakes C, Johnson A, Carter DA, Verkade P, Watson P, Stephens DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "19638414", "url": "https://glygen.org/publication/PubMed/19638414" } ] }, { "title": "Targeting the phosphoinositide 3-kinase pathway in cancer.", "journal": "Nature reviews. Drug discovery", "date": "2009", "authors": "Liu P, Cheng H, Roberts TM, Zhao JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "19644473", "url": "https://glygen.org/publication/PubMed/19644473" } ] }, { "title": "mTrs130 is a component of a mammalian TRAPPII complex, a Rab1 GEF that binds to COPI-coated vesicles.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Yamasaki A, Menon S, Yu S, Barrowman J, Meerloo T, Oorschot V, Klumperman J, Satoh A, Ferro-Novick S", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "19656848", "url": "https://glygen.org/publication/PubMed/19656848" } ] }, { "title": "NPXY, a sequence often found in cytoplasmic tails, is required for coated pit-mediated internalization of the low density lipoprotein receptor.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Chen WJ, Goldstein JL, Brown MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "1968060", "url": "https://glygen.org/publication/PubMed/1968060" } ] }, { "title": "Tickets to ride: selecting cargo for clathrin-regulated internalization.", "journal": "Nature reviews. Molecular cell biology", "date": "2009", "authors": "Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19696796", "url": "https://glygen.org/publication/PubMed/19696796" } ] }, { "title": "Endocytosis and signalling: intertwining molecular networks.", "journal": "Nature reviews. Molecular cell biology", "date": "2009", "authors": "Sorkin A, von Zastrow M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "19696798", "url": "https://glygen.org/publication/PubMed/19696798" } ] }, { "title": "Syp1 is a conserved endocytic adaptor that contains domains involved in cargo selection and membrane tubulation.", "journal": "The EMBO journal", "date": "2009", "authors": "Reider A, Barker SL, Mishra SK, Im YJ, Maldonado-Baez L, Hurley JH, Traub LM, Wendland B", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19713939", "url": "https://glygen.org/publication/PubMed/19713939" } ] }, { "title": "The DEAD-box protein p72 regulates ERalpha-/oestrogen-dependent transcription and cell growth, and is associated with improved survival in ERalpha-positive breast cancer.", "journal": "Oncogene", "date": "2009", "authors": "Wortham NC, Ahamed E, Nicol SM, Thomas RS, Periyasamy M, Jiang J, Ochocka AM, Shousha S, Huson L, Bray SE, Coombes RC, Ali S, Fuller-Pace FV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19718048", "url": "https://glygen.org/publication/PubMed/19718048" } ] }, { "title": "Stonins--specialized adaptors for synaptic vesicle recycling and beyond?", "journal": "Traffic (Copenhagen, Denmark)", "date": "2010", "authors": "Maritzen T, Podufall J, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "19732400", "url": "https://glygen.org/publication/PubMed/19732400" } ] }, { "title": "Early-arriving Syp1p and Ede1p function in endocytic site placement and formation in budding yeast.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Stimpson HE, Toret CP, Cheng AT, Pauly BS, Drubin DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19776351", "url": "https://glygen.org/publication/PubMed/19776351" } ] }, { "title": "A frequent kinase domain mutation that changes the interaction between PI3Kalpha and the membrane.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Mandelker D, Gabelli SB, Schmidt-Kittler O, Zhu J, Cheong I, Huang CH, Kinzler KW, Vogelstein B, Amzel LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "19805105", "url": "https://glygen.org/publication/PubMed/19805105" } ] }, { "title": "Distinct dynamics of endocytic clathrin-coated pits and coated plaques.", "journal": "PLoS biology", "date": "2009", "authors": "Saffarian S, Cocucci E, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19809571", "url": "https://glygen.org/publication/PubMed/19809571" } ] }, { "title": "Eps15: a multifunctional adaptor protein regulating intracellular trafficking.", "journal": "Cell communication and signaling : CCS", "date": "2009", "authors": "van Bergen En Henegouwen PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "19814798", "url": "https://glygen.org/publication/PubMed/19814798" } ] }, { "title": "ATAD2 is a novel cofactor for MYC, overexpressed and amplified in aggressive tumors.", "journal": "Cancer research", "date": "2009", "authors": "Ciro M, Prosperini E, Quarto M, Grazini U, Walfridsson J, McBlane F, Nucifero P, Pacchiana G, Capra M, Christensen J, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "19843847", "url": "https://glygen.org/publication/PubMed/19843847" } ] }, { "title": "Arrestin development: emerging roles for beta-arrestins in developmental signaling pathways.", "journal": "Developmental cell", "date": "2009", "authors": "Kovacs JJ, Hara MR, Davenport CL, Kim J, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "19853559", "url": "https://glygen.org/publication/PubMed/19853559" } ] }, { "title": "Cell proliferation regulated by estradiol receptor: Therapeutic implications.", "journal": "Steroids", "date": "2010", "authors": "Castoria G, Migliaccio A, Giovannelli P, Auricchio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "19879889", "url": "https://glygen.org/publication/PubMed/19879889" } ] }, { "title": "ERK nuclear translocation is dimerization-independent but controlled by the rate of phosphorylation.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Lidke DS, Huang F, Post JN, Rieger B, Wilsbacher J, Thomas JL, Pouyssegur J, Jovin TM, Lenormand P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "19920141", "url": "https://glygen.org/publication/PubMed/19920141" } ] }, { "title": "Somatic mutations in p85alpha promote tumorigenesis through class IA PI3K activation.", "journal": "Cancer cell", "date": "2009", "authors": "Jaiswal BS, Janakiraman V, Kljavin NM, Chaudhuri S, Stern HM, Wang W, Kan Z, Dbouk HA, Peters BA, Waring P, Dela Vega T, Kenski DM, Bowman KK, Lorenzo M, Li H, Wu J, Modrusan Z, Stinson J, Eby M, Yue P, Kaminker JS, de Sauvage FJ, Backer JM, Seshagiri S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "19962665", "url": "https://glygen.org/publication/PubMed/19962665" } ] }, { "title": "Novel mutant-selective EGFR kinase inhibitors against EGFR T790M.", "journal": "Nature", "date": "2009", "authors": "Zhou W, Ercan D, Chen L, Yun CH, Li D, Capelletti M, Cortot AB, Chirieac L, Iacob RE, Padera R, Engen JR, Wong KK, Eck MJ, Gray NS, Janne PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5638303", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5638303" } ], "reference": [ { "type": "PubMed", "id": "20033049", "url": "https://glygen.org/publication/PubMed/20033049" } ] }, { "title": "Structure of clathrin coat with bound Hsc70 and auxilin: mechanism of Hsc70-facilitated disassembly.", "journal": "The EMBO journal", "date": "2010", "authors": "Xing Y, Bocking T, Wolf M, Grigorieff N, Kirchhausen T, Harrison SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20033059", "url": "https://glygen.org/publication/PubMed/20033059" } ] }, { "title": "Coordinated actions of actin and BAR proteins upstream of dynamin at endocytic clathrin-coated pits.", "journal": "Developmental cell", "date": "2009", "authors": "Ferguson SM, Raimondi A, Paradise S, Shen H, Mesaki K, Ferguson A, Destaing O, Ko G, Takasaki J, Cremona O, O' Toole E, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20059951", "url": "https://glygen.org/publication/PubMed/20059951" } ] }, { "title": "The G protein-coupled receptor GPR30 inhibits proliferation of estrogen receptor-positive breast cancer cells.", "journal": "Cancer research", "date": "2010", "authors": "Ariazi EA, Brailoiu E, Yerrum S, Shupp HA, Slifker MJ, Cunliffe HE, Black MA, Donato AL, Arterburn JB, Oprea TI, Prossnitz ER, Dun NJ, Jordan VC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "20086172", "url": "https://glygen.org/publication/PubMed/20086172" } ] }, { "title": "ArfGAP1 interacts with coat proteins through tryptophan-based motifs.", "journal": "Biochemical and biophysical research communications", "date": "2010", "authors": "Rawet M, Levi-Tal S, Szafer-Glusman E, Parnis A, Cassel D", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20211604", "url": "https://glygen.org/publication/PubMed/20211604" } ] }, { "title": "A CTCF-independent role for cohesin in tissue-specific transcription.", "journal": "Genome research", "date": "2010", "authors": "Schmidt D, Schwalie PC, Ross-Innes CS, Hurtado A, Brown GD, Carroll JS, Flicek P, Odom DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20219941", "url": "https://glygen.org/publication/PubMed/20219941" } ] }, { "title": "A novel Wilms tumor 1 (WT1) target gene negatively regulates the WNT signaling pathway.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Kim MS, Yoon SK, Bollig F, Kitagaki J, Hur W, Whye NJ, Wu YP, Rivera MN, Park JY, Kim HS, Malik K, Bell DW, Englert C, Perantoni AO, Lee SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20220130", "url": "https://glygen.org/publication/PubMed/20220130" } ] }, { "title": "Internalization and down-regulation of the human epidermal growth factor receptor are regulated by the carboxyl-terminal tyrosines.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Helin K, Beguinot L", "evidence": [ { "database": "Reactome", "id": "R-HSA-177929", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-177929" } ], "reference": [ { "type": "PubMed", "id": "2022652", "url": "https://glygen.org/publication/PubMed/2022652" } ] }, { "title": "Phosphoinositide 3-kinase pathway activation in phosphate and tensin homolog (PTEN)-deficient prostate cancer cells is independent of receptor tyrosine kinases and mediated by the p110beta and p110delta catalytic subunits.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Jiang X, Chen S, Asara JM, Balk SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "20231295", "url": "https://glygen.org/publication/PubMed/20231295" } ] }, { "title": "Cargo- and adaptor-specific mechanisms regulate clathrin-mediated endocytosis.", "journal": "The Journal of cell biology", "date": "2010", "authors": "Mettlen M, Loerke D, Yarar D, Danuser G, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "20231386", "url": "https://glygen.org/publication/PubMed/20231386" } ] }, { "title": "mTOR complex-2 activates ENaC by phosphorylating SGK1.", "journal": "Journal of the American Society of Nephrology : JASN", "date": "2010", "authors": "Lu M, Wang J, Jones KT, Ives HE, Feldman ME, Yao LJ, Shokat KM, Ashrafi K, Pearce D", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "20338997", "url": "https://glygen.org/publication/PubMed/20338997" } ] }, { "title": "Alpha-AP-2 directs myosin VI-dependent endocytosis of cystic fibrosis transmembrane conductance regulator chloride channels in the intestine.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Collaco A, Jakab R, Hegan P, Mooseker M, Ameen N", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "20351096", "url": "https://glygen.org/publication/PubMed/20351096" } ] }, { "title": "Selective export of human GPI-anchored proteins from the endoplasmic reticulum.", "journal": "Journal of cell science", "date": "2010", "authors": "Bonnon C, Wendeler MW, Paccaud JP, Hauri HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "20427317", "url": "https://glygen.org/publication/PubMed/20427317" } ] }, { "title": "G domain dimerization controls dynamin's assembly-stimulated GTPase activity.", "journal": "Nature", "date": "2010", "authors": "Chappie JS, Acharya S, Leonard M, Schmid SL, Dyda F", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20428113", "url": "https://glygen.org/publication/PubMed/20428113" } ] }, { "title": "Heat shock protein 27 is required for sex steroid receptor trafficking to and functioning at the plasma membrane.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Razandi M, Pedram A, Levin ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "20439495", "url": "https://glygen.org/publication/PubMed/20439495" } ] }, { "title": "FCHo proteins are nucleators of clathrin-mediated endocytosis.", "journal": "Science (New York, N.Y.)", "date": "2010", "authors": "Henne WM, Boucrot E, Meinecke M, Evergren E, Vallis Y, Mittal R, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20448150", "url": "https://glygen.org/publication/PubMed/20448150" } ] }, { "title": "Role of the lectin VIP36 in post-ER quality control of human alpha1-antitrypsin.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2010", "authors": "Reiterer V, Nyfeler B, Hauri HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "20477988", "url": "https://glygen.org/publication/PubMed/20477988" } ] }, { "title": "RalGDS family members couple Ras to Ral signalling and that's not all.", "journal": "Cellular signalling", "date": "2010", "authors": "Ferro E, Trabalzini L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "20478380", "url": "https://glygen.org/publication/PubMed/20478380" } ] }, { "title": "Novel trans-tail regulation of H2B ubiquitylation and H3K4 methylation by the N terminus of histone H2A.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Zheng S, Wyrick JJ, Reese JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20498280", "url": "https://glygen.org/publication/PubMed/20498280" } ] }, { "title": "The solution structure of human transforming growth factor alpha.", "journal": "Eur. J. Biochem.", "date": "1991", "authors": "Harvey T S, Wilkinson A J, Tappin M J, Cooke R M, Campbell I D", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "reference": [ { "type": "PubMed", "id": "2050136", "url": "https://glygen.org/publication/PubMed/2050136" } ] }, { "title": "Phosphatidylinositol 3-kinase-delta inhibitor CAL-101 shows promising preclinical activity in chronic lymphocytic leukemia by antagonizing intrinsic and extrinsic cellular survival signals.", "journal": "Blood", "date": "2010", "authors": "Herman SE, Gordon AL, Wagner AJ, Heerema NA, Zhao W, Flynn JM, Jones J, Andritsos L, Puri KD, Lannutti BJ, Giese NA, Zhang X, Wei L, Byrd JC, Johnson AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "20522708", "url": "https://glygen.org/publication/PubMed/20522708" } ] }, { "title": "Protein sorting receptors in the early secretory pathway.", "journal": "Annual review of biochemistry", "date": "2010", "authors": "Dancourt J, Barlowe C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "20533886", "url": "https://glygen.org/publication/PubMed/20533886" } ] }, { "title": "A targeted siRNA screen to identify SNAREs required for constitutive secretion in mammalian cells.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2010", "authors": "Gordon DE, Bond LM, Sahlender DA, Peden AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "20545907", "url": "https://glygen.org/publication/PubMed/20545907" } ] }, { "title": "Role of EBAG9 protein in coat protein complex I-dependent glycoprotein maturation and secretion processes in tumor cells.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2010", "authors": "Wolf J, Reimer TA, Schuck S, Ruder C, Gerlach K, Muller EC, Otto A, Dorken B, Rehm A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20570965", "url": "https://glygen.org/publication/PubMed/20570965" } ] }, { "title": "Functional characterization of ATAD2 as a new cancer/testis factor and a predictor of poor prognosis in breast and lung cancers.", "journal": "Oncogene", "date": "2010", "authors": "Caron C, Lestrat C, Marsal S, Escoffier E, Curtet S, Virolle V, Barbry P, Debernardi A, Brambilla C, Brambilla E, Rousseaux S, Khochbin S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "20581866", "url": "https://glygen.org/publication/PubMed/20581866" } ] }, { "title": "The effect of epidermal growth factor receptor variant III on glioma cell migration by stimulating ERK phosphorylation through the focal adhesion kinase signaling pathway.", "journal": "Archives of biochemistry and biophysics", "date": "2010", "authors": "Liu M, Yang Y, Wang C, Sun L, Mei C, Yao W, Liu Y, Shi Y, Qiu S, Fan J, Cai X, Zha X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "20650261", "url": "https://glygen.org/publication/PubMed/20650261" } ] }, { "title": "p125A exists as part of the mammalian Sec13/Sec31 COPII subcomplex to facilitate ER-Golgi transport.", "journal": "The Journal of cell biology", "date": "2010", "authors": "Ong YS, Tang BL, Loo LS, Hong W", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "20679433", "url": "https://glygen.org/publication/PubMed/20679433" } ] }, { "title": "The histone demethylase JMJD2B is regulated by estrogen receptor alpha and hypoxia, and is a key mediator of estrogen induced growth.", "journal": "Cancer research", "date": "2010", "authors": "Yang J, Jubb AM, Pike L, Buffa FM, Turley H, Baban D, Leek R, Gatter KC, Ragoussis J, Harris AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20682797", "url": "https://glygen.org/publication/PubMed/20682797" } ] }, { "title": "Cancer-derived mutations in the regulatory subunit p85alpha of phosphoinositide 3-kinase function through the catalytic subunit p110alpha.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Sun M, Hillmann P, Hofmann BT, Hart JR, Vogt PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "20713702", "url": "https://glygen.org/publication/PubMed/20713702" } ] }, { "title": "Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Shi Y, Suh YH, Milstein AD, Isozaki K, Schmid SM, Roche KW, Nicoll RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "20805473", "url": "https://glygen.org/publication/PubMed/20805473" } ] }, { "title": "Structure of the PTEN-like region of auxilin, a detector of clathrin-coated vesicle budding.", "journal": "Structure (London, England : 1993)", "date": "2010", "authors": "Guan R, Dai H, Harrison SC, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20826345", "url": "https://glygen.org/publication/PubMed/20826345" } ] }, { "title": "Minireview: Extranuclear steroid receptors: roles in modulation of cell functions.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2011", "authors": "Levin ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "20861220", "url": "https://glygen.org/publication/PubMed/20861220" } ] }, { "title": "Intersectin 1 forms complexes with SGIP1 and Reps1 in clathrin-coated pits.", "journal": "Biochemical and biophysical research communications", "date": "2010", "authors": "Dergai O, Novokhatska O, Dergai M, Skrypkina I, Tsyba L, Moreau J, Rynditch A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20946875", "url": "https://glygen.org/publication/PubMed/20946875" } ] }, { "title": "TRAPP complexes in membrane traffic: convergence through a common Rab.", "journal": "Nature reviews. Molecular cell biology", "date": "2010", "authors": "Barrowman J, Bhandari D, Reinisch K, Ferro-Novick S", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "20966969", "url": "https://glygen.org/publication/PubMed/20966969" } ] }, { "title": "CSN complex controls the stability of selected synaptic proteins via a torsinA-dependent process.", "journal": "The EMBO journal", "date": "2011", "authors": "Granata A, Koo SJ, Haucke V, Schiavo G, Warner TT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "21102408", "url": "https://glygen.org/publication/PubMed/21102408" } ] }, { "title": "Ras superfamily GEFs and GAPs: validated and tractable targets for cancer therapy?", "journal": "Nature reviews. Cancer", "date": "2010", "authors": "Vigil D, Cherfils J, Rossman KL, Der CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "21102635", "url": "https://glygen.org/publication/PubMed/21102635" } ] }, { "title": "Histone H3K27ac separates active from poised enhancers and predicts developmental state.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Creyghton MP, Cheng AW, Welstead GG, Kooistra T, Carey BW, Steine EJ, Hanna J, Lodato MA, Frampton GM, Sharp PA, Boyer LA, Young RA, Jaenisch R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21106759", "url": "https://glygen.org/publication/PubMed/21106759" } ] }, { "title": "FOXA1 is a key determinant of estrogen receptor function and endocrine response.", "journal": "Nature genetics", "date": "2011", "authors": "Hurtado A, Holmes KA, Ross-Innes CS, Schmidt D, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21151129", "url": "https://glygen.org/publication/PubMed/21151129" } ] }, { "title": "Localization of low molecular weight GTP binding proteins to exocytic and endocytic compartments.", "journal": "Cell", "date": "1990", "authors": "Chavrier P, Parton RG, Hauri HP, Simons K, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "2115402", "url": "https://glygen.org/publication/PubMed/2115402" } ] }, { "title": "Local clustering of transferrin receptors promotes clathrin-coated pit initiation.", "journal": "The Journal of cell biology", "date": "2010", "authors": "Liu AP, Aguet F, Danuser G, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21187331", "url": "https://glygen.org/publication/PubMed/21187331" } ] }, { "title": "PTEN restoration and PIK3CB knockdown synergistically suppress glioblastoma growth in vitro and in xenografts.", "journal": "Journal of neuro-oncology", "date": "2011", "authors": "Chen H, Mei L, Zhou L, Shen X, Guo C, Zheng Y, Zhu H, Zhu Y, Huang L", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "21188471", "url": "https://glygen.org/publication/PubMed/21188471" } ] }, { "title": "Single-molecule analysis of a molecular disassemblase reveals the mechanism of Hsc70-driven clathrin uncoating.", "journal": "Nature structural & molecular biology", "date": "2011", "authors": "Bocking T, Aguet F, Harrison SC, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21278753", "url": "https://glygen.org/publication/PubMed/21278753" } ] }, { "title": "Synaptojanin 1-mediated PI(4,5)P2 hydrolysis is modulated by membrane curvature and facilitates membrane fission.", "journal": "Developmental cell", "date": "2011", "authors": "Chang-Ileto B, Frere SG, Chan RB, Voronov SV, Roux A, Di Paolo G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21316588", "url": "https://glygen.org/publication/PubMed/21316588" } ] }, { "title": "Inhibition of PI3K/mTOR pathways in glioblastoma and implications for combination therapy with temozolomide.", "journal": "Neuro-oncology", "date": "2011", "authors": "Prasad G, Sottero T, Yang X, Mueller S, James CD, Weiss WA, Polley MY, Ozawa T, Berger MS, Aftab DT, Prados MD, Haas-Kogan DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "21317208", "url": "https://glygen.org/publication/PubMed/21317208" } ] }, { "title": "Feedback upregulation of HER3 (ErbB3) expression and activity attenuates antitumor effect of PI3K inhibitors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Chakrabarty A, Sanchez V, Kuba MG, Rinehart C, Arteaga CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "21368164", "url": "https://glygen.org/publication/PubMed/21368164" } ] }, { "title": "Activation and function of the MAPKs and their substrates, the MAPK-activated protein kinases.", "journal": "Microbiology and molecular biology reviews : MMBR", "date": "2011", "authors": "Cargnello M, Roux PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "21372320", "url": "https://glygen.org/publication/PubMed/21372320" } ] }, { "title": "Activation of multiple proto-oncogenic tyrosine kinases in breast cancer via loss of the PTPN12 phosphatase.", "journal": "Cell", "date": "2011", "authors": "Sun T, Aceto N, Meerbrey KL, Kessler JD, Zhou C, Migliaccio I, Nguyen DX, Pavlova NN, Botero M, Huang J, Bernardi RJ, Schmitt E, Hu G, Li MZ, Dephoure N, Gygi SP, Rao M, Creighton CJ, Hilsenbeck SG, Shaw CA, Muzny D, Gibbs RA, Wheeler DA, Osborne CK, Schiff R, Bentires-Alj M, Elledge SJ, Westbrook TF", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "21376233", "url": "https://glygen.org/publication/PubMed/21376233" } ] }, { "title": "Histone demethylase JMJD2B functions as a co-factor of estrogen receptor in breast cancer proliferation and mammary gland development.", "journal": "PloS one", "date": "2011", "authors": "Kawazu M, Saso K, Tong KI, McQuire T, Goto K, Son DO, Wakeham A, Miyagishi M, Mak TW, Okada H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21445275", "url": "https://glygen.org/publication/PubMed/21445275" } ] }, { "title": "A high precision survey of the molecular dynamics of mammalian clathrin-mediated endocytosis.", "journal": "PLoS biology", "date": "2011", "authors": "Taylor MJ, Perrais D, Merrifield CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21445324", "url": "https://glygen.org/publication/PubMed/21445324" } ] }, { "title": "PIK3R1 (p85alpha) is somatically mutated at high frequency in primary endometrial cancer.", "journal": "Cancer research", "date": "2011", "authors": "Urick ME, Rudd ML, Godwin AK, Sgroi D, Merino M, Bell DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "21478295", "url": "https://glygen.org/publication/PubMed/21478295" } ] }, { "title": "TFG-1 function in protein secretion and oncogenesis.", "journal": "Nature cell biology", "date": "2011", "authors": "Witte K, Schuh AL, Hegermann J, Sarkeshik A, Mayers JR, Schwarze K, Yates JR 3rd, Eimer S, Audhya A", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "21478858", "url": "https://glygen.org/publication/PubMed/21478858" } ] }, { "title": "A sequential mechanism for clathrin cage disassembly by 70-kDa heat-shock cognate protein (Hsc70) and auxilin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Rothnie A, Clarke AR, Kuzmic P, Cameron A, Smith CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21482805", "url": "https://glygen.org/publication/PubMed/21482805" } ] }, { "title": "ARFGAP1 promotes AP-2-dependent endocytosis.", "journal": "Nature cell biology", "date": "2011", "authors": "Bai M, Gad H, Turacchio G, Cocucci E, Yang JS, Li J, Beznoussenko GV, Nie Z, Luo R, Fu L, Collawn JF, Kirchhausen T, Luini A, Hsu VW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21499258", "url": "https://glygen.org/publication/PubMed/21499258" } ] }, { "title": "cTAGE5 mediates collagen secretion through interaction with TANGO1 at endoplasmic reticulum exit sites.", "journal": "Molecular biology of the cell", "date": "2011", "authors": "Saito K, Yamashiro K, Ichikawa Y, Erlmann P, Kontani K, Malhotra V, Katada T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "21525241", "url": "https://glygen.org/publication/PubMed/21525241" } ] }, { "title": "Sequential interactions with Sec23 control the direction of vesicle traffic.", "journal": "Nature", "date": "2011", "authors": "Lord C, Bhandari D, Menon S, Ghassemian M, Nycz D, Hay J, Ghosh P, Ferro-Novick S", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "21532587", "url": "https://glygen.org/publication/PubMed/21532587" } ] }, { "title": "Tyrosine kinase activity is essential for the association of phospholipase C-gamma with the epidermal growth factor receptor.", "journal": "Molecular and cellular biology", "date": "1990", "authors": "Margolis B, Bellot F, Honegger AM, Ullrich A, Schlessinger J, Zilberstein A", "evidence": [ { "database": "Reactome", "id": "R-HSA-212718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212718" } ], "reference": [ { "type": "PubMed", "id": "2153914", "url": "https://glygen.org/publication/PubMed/2153914" } ] }, { "title": "Intracellular estrogen receptor-binding fragment-associated antigen 9 exerts in vivo tumor-promoting effects via its coiled-coil region.", "journal": "International journal of oncology", "date": "2011", "authors": "Maeyama Y, Otsu M, Kubo S, Yamano T, Iimura Y, Onodera M, Kondo S, Sakiyama Y, Ariga T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21573489", "url": "https://glygen.org/publication/PubMed/21573489" } ] }, { "title": "Phosphatidylinositol-(4,5)-bisphosphate regulates clathrin-coated pit initiation, stabilization, and size.", "journal": "Molecular biology of the cell", "date": "2011", "authors": "Antonescu CN, Aguet F, Danuser G, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21613550", "url": "https://glygen.org/publication/PubMed/21613550" } ] }, { "title": "A drug targeting only p110alpha can block phosphoinositide 3-kinase signalling and tumour growth in certain cell types.", "journal": "The Biochemical journal", "date": "2011", "authors": "Jamieson S, Flanagan JU, Kolekar S, Buchanan C, Kendall JD, Lee WJ, Rewcastle GW, Denny WA, Singh R, Dickson J, Baguley BC, Shepherd PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "21668414", "url": "https://glygen.org/publication/PubMed/21668414" } ] }, { "title": "Cracking the estrogen receptor's posttranslational code in breast tumors.", "journal": "Endocrine reviews", "date": "2011", "authors": "Le Romancer M, Poulard C, Cohen P, Sentis S, Renoir JM, Corbo L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "21680538", "url": "https://glygen.org/publication/PubMed/21680538" } ] }, { "title": "Requirements for the catalytic cycle of the N-ethylmaleimide-Sensitive Factor (NSF).", "journal": "Biochimica et biophysica acta", "date": "2012", "authors": "Zhao C, Smith EC, Whiteheart SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "21689688", "url": "https://glygen.org/publication/PubMed/21689688" } ] }, { "title": "Molecular mechanism and physiological functions of clathrin-mediated endocytosis.", "journal": "Nature reviews. Molecular cell biology", "date": "2011", "authors": "McMahon HT, Boucrot E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21779028", "url": "https://glygen.org/publication/PubMed/21779028" } ] }, { "title": "RAS Interaction with PI3K: More Than Just Another Effector Pathway.", "journal": "Genes & cancer", "date": "2011", "authors": "Castellano E, Downward J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "21779497", "url": "https://glygen.org/publication/PubMed/21779497" } ] }, { "title": "Therapeutic strategies for targeting ras proteins.", "journal": "Genes & cancer", "date": "2011", "authors": "Gysin S, Salt M, Young A, McCormick F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "21779505", "url": "https://glygen.org/publication/PubMed/21779505" } ] }, { "title": "Strong association between c-myb and oestrogen-receptor expression in human breast cancer.", "journal": "Oncogene", "date": "1990", "authors": "Guerin M, Sheng ZM, Andrieu N, Riou G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "2181374", "url": "https://glygen.org/publication/PubMed/2181374" } ] }, { "title": "Dynamics of the phosphoinositide 3-kinase p110delta interaction with p85alpha and membranes reveals aspects of regulation distinct from p110alpha.", "journal": "Structure (London, England : 1993)", "date": "2011", "authors": "Burke JE, Vadas O, Berndt A, Finegan T, Perisic O, Williams RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "21827948", "url": "https://glygen.org/publication/PubMed/21827948" } ] }, { "title": "Estrogen induces c-myc gene expression via an upstream enhancer activated by the estrogen receptor and the AP-1 transcription factor.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2011", "authors": "Wang C, Mayer JA, Mazumdar A, Fertuck K, Kim H, Brown M, Brown PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21835891", "url": "https://glygen.org/publication/PubMed/21835891" } ] }, { "title": "Actin dynamics counteract membrane tension during clathrin-mediated endocytosis.", "journal": "Nature cell biology", "date": "2011", "authors": "Boulant S, Kural C, Zeeh JC, Ubelmann F, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21841790", "url": "https://glygen.org/publication/PubMed/21841790" } ] }, { "title": "Roles for oestrogen receptor beta in adult brain function.", "journal": "Journal of neuroendocrinology", "date": "2012", "authors": "Handa RJ, Ogawa S, Wang JM, Herbison AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "21851428", "url": "https://glygen.org/publication/PubMed/21851428" } ] }, { "title": "Cellular reprogramming by the conjoint action of ERalpha, FOXA1, and GATA3 to a ligand-inducible growth state.", "journal": "Molecular systems biology", "date": "2011", "authors": "Kong SL, Li G, Loh SL, Sung WK, Liu ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21878914", "url": "https://glygen.org/publication/PubMed/21878914" } ] }, { "title": "Protein export at the ER: loading big collagens into COPII carriers.", "journal": "The EMBO journal", "date": "2011", "authors": "Malhotra V, Erlmann P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "21878990", "url": "https://glygen.org/publication/PubMed/21878990" } ] }, { "title": "Hotspots organize clathrin-mediated endocytosis by efficient recruitment and retention of nucleating resources.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2011", "authors": "Nunez D, Antonescu C, Mettlen M, Liu A, Schmid SL, Loerke D, Danuser G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21883765", "url": "https://glygen.org/publication/PubMed/21883765" } ] }, { "title": "Crystal structure of nucleotide-free dynamin.", "journal": "Nature", "date": "2011", "authors": "Faelber K, Posor Y, Gao S, Held M, Roske Y, Schulze D, Haucke V, Noe F, Daumke O", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21927000", "url": "https://glygen.org/publication/PubMed/21927000" } ] }, { "title": "The crystal structure of dynamin.", "journal": "Nature", "date": "2011", "authors": "Ford MG, Jenni S, Nunnari J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21927001", "url": "https://glygen.org/publication/PubMed/21927001" } ] }, { "title": "FOXA1: master of steroid receptor function in cancer.", "journal": "The EMBO journal", "date": "2011", "authors": "Augello MA, Hickey TE, Knudsen KE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21934649", "url": "https://glygen.org/publication/PubMed/21934649" } ] }, { "title": "Gene regulation by cohesin in cancer: is the ring an unexpected party to proliferation?", "journal": "Molecular cancer research : MCR", "date": "2011", "authors": "Rhodes JM, McEwan M, Horsfield JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21940756", "url": "https://glygen.org/publication/PubMed/21940756" } ] }, { "title": "A pseudoatomic model of the dynamin polymer identifies a hydrolysis-dependent powerstroke.", "journal": "Cell", "date": "2011", "authors": "Chappie JS, Mears JA, Fang S, Leonard M, Schmid SL, Milligan RA, Hinshaw JE, Dyda F", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21962517", "url": "https://glygen.org/publication/PubMed/21962517" } ] }, { "title": "Novel phosphoinositide 3-kinase/mTOR dual inhibitor, NVP-BGT226, displays potent growth-inhibitory activity against human head and neck cancer cells in vitro and in vivo.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2011", "authors": "Chang KY, Tsai SY, Wu CM, Yen CJ, Chuang BF, Chang JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "21976531", "url": "https://glygen.org/publication/PubMed/21976531" } ] }, { "title": "High frequency of PIK3R1 and PIK3R2 mutations in endometrial cancer elucidates a novel mechanism for regulation of PTEN protein stability.", "journal": "Cancer discovery", "date": "2011", "authors": "Cheung LW, Hennessy BT, Li J, Yu S, Myers AP, Djordjevic B, Lu Y, Stemke-Hale K, Dyer MD, Zhang F, Ju Z, Cantley LC, Scherer SE, Liang H, Lu KH, Broaddus RR, Mills GB", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "21984976", "url": "https://glygen.org/publication/PubMed/21984976" } ] }, { "title": "RAS oncogenes: weaving a tumorigenic web.", "journal": "Nature reviews. Cancer", "date": "2011", "authors": "Pylayeva-Gupta Y, Grabocka E, Bar-Sagi D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "21993244", "url": "https://glygen.org/publication/PubMed/21993244" } ] }, { "title": "Dab2 is a key regulator of endocytosis and post-endocytic trafficking of the cystic fibrosis transmembrane conductance regulator.", "journal": "The Biochemical journal", "date": "2012", "authors": "Fu L, Rab A, Tang LP, Rowe SM, Bebok Z, Collawn JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "21995445", "url": "https://glygen.org/publication/PubMed/21995445" } ] }, { "title": "COPII and COPI traffic at the ER-Golgi interface.", "journal": "Physiology (Bethesda, Md.)", "date": "2011", "authors": "Szul T, Sztul E", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "22013193", "url": "https://glygen.org/publication/PubMed/22013193" } ] }, { "title": "Minireview: Recent advances in extranuclear steroid receptor actions.", "journal": "Endocrinology", "date": "2011", "authors": "Hammes SR, Levin ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "22028449", "url": "https://glygen.org/publication/PubMed/22028449" } ] }, { "title": "DHHC-7 and -21 are palmitoylacyltransferases for sex steroid receptors.", "journal": "Molecular biology of the cell", "date": "2012", "authors": "Pedram A, Razandi M, Deschenes RJ, Levin ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "22031296", "url": "https://glygen.org/publication/PubMed/22031296" } ] }, { "title": "Pioneer transcription factors: establishing competence for gene expression.", "journal": "Genes & development", "date": "2011", "authors": "Zaret KS, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22056668", "url": "https://glygen.org/publication/PubMed/22056668" } ] }, { "title": "Recruitment of endophilin to clathrin-coated pit necks is required for efficient vesicle uncoating after fission.", "journal": "Neuron", "date": "2011", "authors": "Milosevic I, Giovedi S, Lou X, Raimondi A, Collesi C, Shen H, Paradise S, O'Toole E, Ferguson S, Cremona O, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22099461", "url": "https://glygen.org/publication/PubMed/22099461" } ] }, { "title": "The molecular basis for the endocytosis of small R-SNAREs by the clathrin adaptor CALM.", "journal": "Cell", "date": "2011", "authors": "Miller SE, Sahlender DA, Graham SC, Honing S, Robinson MS, Peden AA, Owen DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "22118466", "url": "https://glygen.org/publication/PubMed/22118466" } ] }, { "title": "Regulation of lipid binding underlies the activation mechanism of class IA PI3-kinases.", "journal": "Oncogene", "date": "2012", "authors": "Hon WC, Berndt A, Williams RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "22120714", "url": "https://glygen.org/publication/PubMed/22120714" } ] }, { "title": "Sec24p and Sec16p cooperate to regulate the GTP cycle of the COPII coat.", "journal": "The EMBO journal", "date": "2012", "authors": "Kung LF, Pagant S, Futai E, D'Arcangelo JG, Buchanan R, Dittmar JC, Reid RJ, Rothstein R, Hamamoto S, Snapp EL, Schekman R, Miller EA", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "22157747", "url": "https://glygen.org/publication/PubMed/22157747" } ] }, { "title": "Identification and characterization of NVP-BKM120, an orally available pan-class I PI3-kinase inhibitor.", "journal": "Molecular cancer therapeutics", "date": "2012", "authors": "Maira SM, Pecchi S, Huang A, Burger M, Knapp M, Sterker D, Schnell C, Guthy D, Nagel T, Wiesmann M, Brachmann S, Fritsch C, Dorsch M, Chene P, Shoemaker K, De Pover A, Menezes D, Martiny-Baron G, Fabbro D, Wilson CJ, Schlegel R, Hofmann F, Garcia-Echeverria C, Sellers WR, Voliva CF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "22188813", "url": "https://glygen.org/publication/PubMed/22188813" } ] }, { "title": "Dynamin, a membrane-remodelling GTPase.", "journal": "Nature reviews. Molecular cell biology", "date": "2012", "authors": "Ferguson SM, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22233676", "url": "https://glygen.org/publication/PubMed/22233676" } ] }, { "title": "Extensive promoter-centered chromatin interactions provide a topological basis for transcription regulation.", "journal": "Cell", "date": "2012", "authors": "Li G, Ruan X, Auerbach RK, Sandhu KS, Zheng M, Wang P, Poh HM, Goh Y, Lim J, Zhang J, Sim HS, Peh SQ, Mulawadi FH, Ong CT, Orlov YL, Hong S, Zhang Z, Landt S, Raha D, Euskirchen G, Wei CL, Ge W, Wang H, Davis C, Fisher-Aylor KI, Mortazavi A, Gerstein M, Gingeras T, Wold B, Sun Y, Fullwood MJ, Cheung E, Liu E, Sung WK, Snyder M, Ruan Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22265404", "url": "https://glygen.org/publication/PubMed/22265404" } ] }, { "title": "Tyrosine phosphorylation of estradiol receptor by Src regulates its hormone-dependent nuclear export and cell cycle progression in breast cancer cells.", "journal": "Oncogene", "date": "2012", "authors": "Castoria G, Giovannelli P, Lombardi M, De Rosa C, Giraldi T, de Falco A, Barone MV, Abbondanza C, Migliaccio A, Auricchio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "22266855", "url": "https://glygen.org/publication/PubMed/22266855" } ] }, { "title": "The role of ubiquitylation in receptor endocytosis and endosomal sorting.", "journal": "Journal of cell science", "date": "2012", "authors": "Haglund K, Dikic I", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "22357968", "url": "https://glygen.org/publication/PubMed/22357968" } ] }, { "title": "Palmitoylation regulates 17beta-estradiol-induced estrogen receptor-alpha degradation and transcriptional activity.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2012", "authors": "La Rosa P, Pesiri V, Leclercq G, Marino M, Acconcia F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "22446104", "url": "https://glygen.org/publication/PubMed/22446104" } ] }, { "title": "Distinct and separable activities of the endocytic clathrin-coat components Fcho1/2 and AP-2 in developmental patterning.", "journal": "Nature cell biology", "date": "2012", "authors": "Umasankar PK, Sanker S, Thieman JR, Chakraborty S, Wendland B, Tsang M, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22484487", "url": "https://glygen.org/publication/PubMed/22484487" } ] }, { "title": "Estrogen receptor-alpha recruits P-TEFb to overcome transcriptional pausing in intron 1 of the MYB gene.", "journal": "Nucleic acids research", "date": "2012", "authors": "Mitra P, Pereira LA, Drabsch Y, Ramsay RG, Gonda TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22492511", "url": "https://glygen.org/publication/PubMed/22492511" } ] }, { "title": "A feedback loop between dynamin and actin recruitment during clathrin-mediated endocytosis.", "journal": "PLoS biology", "date": "2012", "authors": "Taylor MJ, Lampe M, Merrifield CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22505844", "url": "https://glygen.org/publication/PubMed/22505844" } ] }, { "title": "Non-overlapping progesterone receptor cistromes contribute to cell-specific transcriptional outcomes.", "journal": "PloS one", "date": "2012", "authors": "Clarke CL, Graham JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22545144", "url": "https://glygen.org/publication/PubMed/22545144" } ] }, { "title": "ERK1/2 MAP kinases: structure, function, and regulation.", "journal": "Pharmacological research", "date": "2012", "authors": "Roskoski R Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "22569528", "url": "https://glygen.org/publication/PubMed/22569528" } ] }, { "title": "Transferrin receptor internalization sequence YXRF implicates a tight turn as the structural recognition motif for endocytosis.", "journal": "Cell", "date": "1990", "authors": "Collawn JF, Stangel M, Kuhn LA, Esekogwu V, Jing SQ, Trowbridge IS, Tainer JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "2257624", "url": "https://glygen.org/publication/PubMed/2257624" } ] }, { "title": "Functional characterization of an isoform-selective inhibitor of PI3K-p110beta as a potential anticancer agent.", "journal": "Cancer discovery", "date": "2012", "authors": "Ni J, Liu Q, Xie S, Carlson C, Von T, Vogel K, Riddle S, Benes C, Eck M, Roberts T, Gray N, Zhao J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "22588880", "url": "https://glygen.org/publication/PubMed/22588880" } ] }, { "title": "A comprehensive survey of Ras mutations in cancer.", "journal": "Cancer research", "date": "2012", "authors": "Prior IA, Lewis PD, Mattos C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "22589270", "url": "https://glygen.org/publication/PubMed/22589270" } ] }, { "title": "Solution structures of human transforming growth factor alpha derived from 1H NMR data.", "journal": "Biochemistry", "date": "1990", "authors": "Kline T P, Brown F K, Brown S C, Jeffs P W, Kopple K D, Mueller L", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "reference": [ { "type": "PubMed", "id": "2261437", "url": "https://glygen.org/publication/PubMed/2261437" } ] }, { "title": "Insights into structural and regulatory roles of Sec16 in COPII vesicle formation at ER exit sites.", "journal": "Molecular biology of the cell", "date": "2012", "authors": "Yorimitsu T, Sato K", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "22675024", "url": "https://glygen.org/publication/PubMed/22675024" } ] }, { "title": "The elements of human cyclin D1 promoter and regulation involved.", "journal": "Clinical epigenetics", "date": "2011", "authors": "Guo ZY, Hao XH, Tan FF, Pei X, Shang LM, Jiang XL, Yang F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22704330", "url": "https://glygen.org/publication/PubMed/22704330" } ] }, { "title": "Probing the GTPase cycle with real-time NMR: GAP and GEF activities in cell extracts.", "journal": "Methods (San Diego, Calif.)", "date": "2012", "authors": "Marshall CB, Meiri D, Smith MJ, Mazhab-Jafari MT, Gasmi-Seabrook GM, Rottapel R, Stambolic V, Ikura M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "22750304", "url": "https://glygen.org/publication/PubMed/22750304" } ] }, { "title": "The p110alpha and p110beta isoforms of PI3K play divergent roles in mammary gland development and tumorigenesis.", "journal": "Genes & development", "date": "2012", "authors": "Utermark T, Rao T, Cheng H, Wang Q, Lee SH, Wang ZC, Iglehart JD, Roberts TM, Muller WJ, Zhao JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "22802530", "url": "https://glygen.org/publication/PubMed/22802530" } ] }, { "title": "BRAG2/GEP100/IQSec1 interacts with clathrin and regulates alpha5beta1 integrin endocytosis through activation of ADP ribosylation factor 5 (Arf5).", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Moravec R, Conger KK, D'Souza R, Allison AB, Casanova JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22815487", "url": "https://glygen.org/publication/PubMed/22815487" } ] }, { "title": "The first five seconds in the life of a clathrin-coated pit.", "journal": "Cell", "date": "2012", "authors": "Cocucci E, Aguet F, Boulant S, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22863004", "url": "https://glygen.org/publication/PubMed/22863004" } ] }, { "title": "The epsin protein family: coordinators of endocytosis and signaling.", "journal": "Biomolecular concepts", "date": "2012", "authors": "Sen A, Madhivanan K, Mukherjee D, Aguilar RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "22942912", "url": "https://glygen.org/publication/PubMed/22942912" } ] }, { "title": "The protein tyrosine phosphatase, Shp2, positively contributes to FLT3-ITD-induced hematopoietic progenitor hyperproliferation and malignant disease in vivo.", "journal": "Leukemia", "date": "2013", "authors": "Nabinger SC, Li XJ, Ramdas B, He Y, Zhang X, Zeng L, Richine B, Bowling JD, Fukuda S, Goenka S, Liu Z, Feng GS, Yu M, Sandusky GE, Boswell HS, Zhang ZY, Kapur R, Chan RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "23103841", "url": "https://glygen.org/publication/PubMed/23103841" } ] }, { "title": "Cohesin is required for activation of MYC by estradiol.", "journal": "PloS one", "date": "2012", "authors": "McEwan MV, Eccles MR, Horsfield JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23145106", "url": "https://glygen.org/publication/PubMed/23145106" } ] }, { "title": "GATA3 acts upstream of FOXA1 in mediating ESR1 binding by shaping enhancer accessibility.", "journal": "Genome research", "date": "2013", "authors": "Theodorou V, Stark R, Menon S, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23172872", "url": "https://glygen.org/publication/PubMed/23172872" } ] }, { "title": "Cooperating transcription factors mediate the function of estrogen receptor.", "journal": "Chromosoma", "date": "2013", "authors": "Fiorito E, Katika MR, Hurtado A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23192763", "url": "https://glygen.org/publication/PubMed/23192763" } ] }, { "title": "Cooperative recruitment of dynamin and BIN/amphiphysin/Rvs (BAR) domain-containing proteins leads to GTP-dependent membrane scission.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Meinecke M, Boucrot E, Camdere G, Hon WC, Mittal R, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "23297414", "url": "https://glygen.org/publication/PubMed/23297414" } ] }, { "title": "Oxygen-dependent expression of cytochrome c oxidase subunit 4-2 gene expression is mediated by transcription factors RBPJ, CXXC5 and CHCHD2.", "journal": "Nucleic acids research", "date": "2013", "authors": "Aras S, Pak O, Sommer N, Finley R Jr, Huttemann M, Weissmann N, Grossman LI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23303788", "url": "https://glygen.org/publication/PubMed/23303788" } ] }, { "title": "Regulation of small GTPases by GEFs, GAPs, and GDIs.", "journal": "Physiological reviews", "date": "2013", "authors": "Cherfils J, Zeghouf M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "23303910", "url": "https://glygen.org/publication/PubMed/23303910" } ] }, { "title": "The highly conserved COPII coat complex sorts cargo from the endoplasmic reticulum and targets it to the golgi.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2013", "authors": "Lord C, Ferro-Novick S, Miller EA", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "23378591", "url": "https://glygen.org/publication/PubMed/23378591" } ] }, { "title": "Endogenous purification reveals GREB1 as a key estrogen receptor regulatory factor.", "journal": "Cell reports", "date": "2013", "authors": "Mohammed H, D'Santos C, Serandour AA, Ali HR, Brown GD, Atkins A, Rueda OM, Holmes KA, Theodorou V, Robinson JL, Zwart W, Saadi A, Ross-Innes CS, Chin SF, Menon S, Stingl J, Palmieri C, Caldas C, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23403292", "url": "https://glygen.org/publication/PubMed/23403292" } ] }, { "title": "The lysine demethylase, KDM4B, is a key molecule in androgen receptor signalling and turnover.", "journal": "Nucleic acids research", "date": "2013", "authors": "Coffey K, Rogerson L, Ryan-Munden C, Alkharaif D, Stockley J, Heer R, Sahadevan K, O'Neill D, Jones D, Darby S, Staller P, Mantilla A, Gaughan L, Robson CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23435229", "url": "https://glygen.org/publication/PubMed/23435229" } ] }, { "title": "Nonredundant functions for Ras GTPase-activating proteins in tissue homeostasis.", "journal": "Science signaling", "date": "2013", "authors": "King PD, Lubeck BA, Lapinski PE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "23443682", "url": "https://glygen.org/publication/PubMed/23443682" } ] }, { "title": "Inhibition of TFG function causes hereditary axon degeneration by impairing endoplasmic reticulum structure.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Beetz C, Johnson A, Schuh AL, Thakur S, Varga RE, Fothergill T, Hertel N, Bomba-Warczak E, Thiele H, Nurnberg G, Altmuller J, Saxena R, Chapman ER, Dent EW, Nurnberg P, Audhya A", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "23479643", "url": "https://glygen.org/publication/PubMed/23479643" } ] }, { "title": "Divergent modes for cargo-mediated control of clathrin-coated pit dynamics.", "journal": "Molecular biology of the cell", "date": "2013", "authors": "Soohoo AL, Puthenveedu MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "23536704", "url": "https://glygen.org/publication/PubMed/23536704" } ] }, { "title": "Structure of ERK2 bound to PEA-15 reveals a mechanism for rapid release of activated MAPK.", "journal": "Nature communications", "date": "2013", "authors": "Mace PD, Wallez Y, Egger MF, Dobaczewska MK, Robinson H, Pasquale EB, Riedl SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "23575685", "url": "https://glygen.org/publication/PubMed/23575685" } ] }, { "title": "Chromatin and epigenetic determinants of estrogen receptor alpha (ESR1) signaling.", "journal": "Molecular and cellular endocrinology", "date": "2014", "authors": "Magnani L, Lupien M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "23684889", "url": "https://glygen.org/publication/PubMed/23684889" } ] }, { "title": "Organization of the ER-Golgi interface for membrane traffic control.", "journal": "Nature reviews. Molecular cell biology", "date": "2013", "authors": "Brandizzi F, Barlowe C", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "23698585", "url": "https://glygen.org/publication/PubMed/23698585" } ] }, { "title": "KDM4B is a master regulator of the estrogen receptor signalling cascade.", "journal": "Nucleic acids research", "date": "2013", "authors": "Gaughan L, Stockley J, Coffey K, O'Neill D, Jones DL, Wade M, Wright J, Moore M, Tse S, Rogerson L, Robson CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23723241", "url": "https://glygen.org/publication/PubMed/23723241" } ] }, { "title": "Spatiotemporal control of endocytosis by phosphatidylinositol-3,4-bisphosphate.", "journal": "Nature", "date": "2013", "authors": "Posor Y, Eichhorn-Gruenig M, Puchkov D, Schoneberg J, Ullrich A, Lampe A, Muller R, Zarbakhsh S, Gulluni F, Hirsch E, Krauss M, Schultz C, Schmoranzer J, Noe F, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "23823722", "url": "https://glygen.org/publication/PubMed/23823722" } ] }, { "title": "Combined deficiency of coagulation factors V and VIII: an update.", "journal": "Seminars in thrombosis and hemostasis", "date": "2013", "authors": "Zheng C, Zhang B", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "23852824", "url": "https://glygen.org/publication/PubMed/23852824" } ] }, { "title": "Dual role of BAR domain-containing proteins in regulating vesicle release catalyzed by the GTPase, dynamin-2.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Neumann S, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "23861397", "url": "https://glygen.org/publication/PubMed/23861397" } ] }, { "title": "Sit4p/PP6 regulates ER-to-Golgi traffic by controlling the dephosphorylation of COPII coat subunits.", "journal": "Molecular biology of the cell", "date": "2013", "authors": "Bhandari D, Zhang J, Menon S, Lord C, Chen S, Helm JR, Thorsen K, Corbett KD, Hay JC, Ferro-Novick S", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "23864707", "url": "https://glygen.org/publication/PubMed/23864707" } ] }, { "title": "Advances in analysis of low signal-to-noise images link dynamin and AP2 to the functions of an endocytic checkpoint.", "journal": "Developmental cell", "date": "2013", "authors": "Aguet F, Antonescu CN, Mettlen M, Schmid SL, Danuser G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "23891661", "url": "https://glygen.org/publication/PubMed/23891661" } ] }, { "title": "CXXC5 Associates with Smads to Mediate TNF-alpha Induced Apoptosis.", "journal": "Current molecular medicine", "date": "2013", "authors": "Wang X, Liao P, Fan X, Wan Y, Wang Y, Li Y, Jiang Z, Ye X, Mo X, Ocorr K, Deng Y, Wu X, Yuan W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23906331", "url": "https://glygen.org/publication/PubMed/23906331" } ] }, { "title": "Hyperactivation of EGFR and downstream effector phospholipase D1 by oncogenic FAM83B.", "journal": "Oncogene", "date": "2014", "authors": "Cipriano R, Bryson BL, Miskimen KL, Bartel CA, Hernandez-Sanchez W, Bruntz RC, Scott SA, Lindsley CW, Brown HA, Jackson MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-177929", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-177929" } ], "reference": [ { "type": "PubMed", "id": "23912460", "url": "https://glygen.org/publication/PubMed/23912460" } ] }, { "title": "Estradiol and tamoxifen induce cell migration through GPR30 and activation of focal adhesion kinase (FAK) in endometrial cancers with low or without nuclear estrogen receptor alpha (ERalpha).", "journal": "PloS one", "date": "2013", "authors": "Tsai CL, Wu HM, Lin CY, Lin YJ, Chao A, Wang TH, Hsueh S, Lai CH, Wang HS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "24039841", "url": "https://glygen.org/publication/PubMed/24039841" } ] }, { "title": "Tethering the assembly of SNARE complexes.", "journal": "Trends in cell biology", "date": "2014", "authors": "Hong W, Lev S", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "24119662", "url": "https://glygen.org/publication/PubMed/24119662" } ] }, { "title": "NECAP 1 regulates AP-2 interactions to control vesicle size, number, and cargo during clathrin-mediated endocytosis.", "journal": "PLoS biology", "date": "2013", "authors": "Ritter B, Murphy S, Dokainish H, Girard M, Gudheti MV, Kozlov G, Halin M, Philie J, Jorgensen EM, Gehring K, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "24130457", "url": "https://glygen.org/publication/PubMed/24130457" } ] }, { "title": "Increased RCAS1 expression is associated with advanced histopathological stage and poor prognosis in patients with gastric adenocarcinoma.", "journal": "Disease markers", "date": "2013", "authors": "Giaginis C, Efkarpidis T, Alexandrou P, Patsouris E, Kouraklis G, Theocharis S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24167369", "url": "https://glygen.org/publication/PubMed/24167369" } ] }, { "title": "Cargo recognition in clathrin-mediated endocytosis.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2013", "authors": "Traub LM, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "24186068", "url": "https://glygen.org/publication/PubMed/24186068" } ] }, { "title": "An H2A histone isotype regulates estrogen receptor target genes by mediating enhancer-promoter-3'-UTR interactions in breast cancer cells.", "journal": "Nucleic acids research", "date": "2014", "authors": "Su CH, Tzeng TY, Cheng C, Hsu MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24371278", "url": "https://glygen.org/publication/PubMed/24371278" } ] }, { "title": "Ubiquitin-dependent sorting in endocytosis.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2014", "authors": "Piper RC, Dikic I, Lukacs GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "24384571", "url": "https://glygen.org/publication/PubMed/24384571" } ] }, { "title": "Estrogen biology: new insights into GPER function and clinical opportunities.", "journal": "Molecular and cellular endocrinology", "date": "2014", "authors": "Prossnitz ER, Barton M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "24530924", "url": "https://glygen.org/publication/PubMed/24530924" } ] }, { "title": "BAR domain scaffolds in dynamin-mediated membrane fission.", "journal": "Cell", "date": "2014", "authors": "Daumke O, Roux A, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "24581490", "url": "https://glygen.org/publication/PubMed/24581490" } ] }, { "title": "A novel low molecular weight ribonucleic acid (RNA) related to transforming growth factor alpha messenger RNA.", "journal": "Mol. Endocrinol.", "date": "1988", "authors": "Jakowlew S B, Kondaiah P, Dillard P J, Sporn M B, Roberts A B", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "reference": [ { "type": "PubMed", "id": "2464748", "url": "https://glygen.org/publication/PubMed/2464748" } ] }, { "title": "Role of beta-arrestins and arrestin domain-containing proteins in G protein-coupled receptor trafficking.", "journal": "Current opinion in cell biology", "date": "2014", "authors": "Kang DS, Tian X, Benovic JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "24680432", "url": "https://glygen.org/publication/PubMed/24680432" } ] }, { "title": "Phospholipase C-gamma is a substrate for the PDGF and EGF receptor protein-tyrosine kinases in vivo and in vitro.", "journal": "Cell", "date": "1989", "authors": "Meisenhelder J, Suh PG, Rhee SG, Hunter T", "evidence": [ { "database": "Reactome", "id": "R-HSA-212718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212718" } ], "reference": [ { "type": "PubMed", "id": "2472219", "url": "https://glygen.org/publication/PubMed/2472219" } ] }, { "title": "Identification of miR-26 as a key mediator of estrogen stimulated cell proliferation by targeting CHD1, GREB1 and KPNA2.", "journal": "Breast cancer research : BCR", "date": "2014", "authors": "Tan S, Ding K, Li R, Zhang W, Li G, Kong X, Qian P, Lobie PE, Zhu T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24735615", "url": "https://glygen.org/publication/PubMed/24735615" } ] }, { "title": "Regulation of clathrin-mediated endocytosis by dynamic ubiquitination and deubiquitination.", "journal": "Current biology : CB", "date": "2014", "authors": "Weinberg JS, Drubin DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "24746795", "url": "https://glygen.org/publication/PubMed/24746795" } ] }, { "title": "Molecular structure, function, and dynamics of clathrin-mediated membrane traffic.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2014", "authors": "Kirchhausen T, Owen D, Harrison SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "24789820", "url": "https://glygen.org/publication/PubMed/24789820" } ] }, { "title": "Cohesin in cancer: chromosome segregation and beyond.", "journal": "Nature reviews. Cancer", "date": "2014", "authors": "Losada A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24854081", "url": "https://glygen.org/publication/PubMed/24854081" } ] }, { "title": "Apoptotic function of tumor-associated antigen RCAS1 in oral squamous cell carcinoma.", "journal": "Journal of translational medicine", "date": "2014", "authors": "Tanaka H, Toyoshima T, Sonoda K, Kitamura R, Sasaguri M, Kawano S, Matsubara R, Goto Y, Nakamura S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24885040", "url": "https://glygen.org/publication/PubMed/24885040" } ] }, { "title": "PI3K/AKT signaling pathway and cancer: an updated review.", "journal": "Annals of medicine", "date": "2014", "authors": "Martini M, De Santis MC, Braccini L, Gulluni F, Hirsch E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "24897931", "url": "https://glygen.org/publication/PubMed/24897931" } ] }, { "title": "In sickness and in health: the role of TRAPP and associated proteins in disease.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2014", "authors": "Brunet S, Sacher M", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "24917561", "url": "https://glygen.org/publication/PubMed/24917561" } ] }, { "title": "`RAF` neighborhood: protein-protein interaction in the Raf/Mek/Erk pathway.", "journal": "FEBS letters", "date": "2014", "authors": "Cseh B, Doma E, Baccarini M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "24937142", "url": "https://glygen.org/publication/PubMed/24937142" } ] }, { "title": "Inositol lipid phosphatases in membrane trafficking and human disease.", "journal": "The Biochemical journal", "date": "2014", "authors": "Billcliff PG, Lowe M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "24966051", "url": "https://glygen.org/publication/PubMed/24966051" } ] }, { "title": "A functional interplay between ZNF217 and estrogen receptor alpha exists in luminal breast cancers.", "journal": "Molecular oncology", "date": "2014", "authors": "Nguyen NT, Vendrell JA, Poulard C, Gyorffy B, Goddard-Leon S, Bieche I, Corbo L, Le Romancer M, Bachelot T, Treilleux I, Cohen PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24973012", "url": "https://glygen.org/publication/PubMed/24973012" } ] }, { "title": "Consideration of GREB1 as a potential therapeutic target for hormone-responsive or endocrine-resistant cancers.", "journal": "Expert opinion on therapeutic targets", "date": "2014", "authors": "Hodgkinson KM, Vanderhyden BC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24998469", "url": "https://glygen.org/publication/PubMed/24998469" } ] }, { "title": "A role of OCRL in clathrin-coated pit dynamics and uncoating revealed by studies of Lowe syndrome cells.", "journal": "eLife", "date": "2014", "authors": "Nandez R, Balkin DM, Messa M, Liang L, Paradise S, Czapla H, Hein MY, Duncan JS, Mann M, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "25107275", "url": "https://glygen.org/publication/PubMed/25107275" } ] }, { "title": "Concentration of Sec12 at ER exit sites via interaction with cTAGE5 is required for collagen export.", "journal": "The Journal of cell biology", "date": "2014", "authors": "Saito K, Yamashiro K, Shimazu N, Tanabe T, Kontani K, Katada T", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "25202031", "url": "https://glygen.org/publication/PubMed/25202031" } ] }, { "title": "Ral small GTPase signaling and oncogenesis: More than just 15minutes of fame.", "journal": "Biochimica et biophysica acta", "date": "2014", "authors": "Gentry LR, Martin TD, Reiner DJ, Der CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "25219551", "url": "https://glygen.org/publication/PubMed/25219551" } ] }, { "title": "Protein tyrosine phosphatase PTPN3 inhibits lung cancer cell proliferation and migration by promoting EGFR endocytic degradation.", "journal": "Oncogene", "date": "2015", "authors": "Li MY, Lai PL, Chou YT, Chi AP, Mi YZ, Khoo KH, Chang GD, Wu CW, Meng TC, Chen GC", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "25263444", "url": "https://glygen.org/publication/PubMed/25263444" } ] }, { "title": "Serum receptor-binding cancer antigen expressed on SiSo cells (RCAS1) as a diagnostic and prognostic marker for non-small cell lung cancer.", "journal": "Tumori", "date": "2014", "authors": "Xu C, Yu LK, Zhang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25296600", "url": "https://glygen.org/publication/PubMed/25296600" } ] }, { "title": "The membrane-associated proteins FCHo and SGIP are allosteric activators of the AP2 clathrin adaptor complex.", "journal": "eLife", "date": "2014", "authors": "Hollopeter G, Lange JJ, Zhang Y, Vu TN, Gu M, Ailion M, Lambie EJ, Slaughter BD, Unruh JR, Florens L, Jorgensen EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "25303366", "url": "https://glygen.org/publication/PubMed/25303366" } ] }, { "title": "Rab proteins and the compartmentalization of the endosomal system.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2014", "authors": "Wandinger-Ness A, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "25341920", "url": "https://glygen.org/publication/PubMed/25341920" } ] }, { "title": "EBAG9 modulates host immune defense against tumor formation and metastasis by regulating cytotoxic activity of T lymphocytes.", "journal": "Oncogenesis", "date": "2014", "authors": "Miyazaki T, Ikeda K, Horie-Inoue K, Kondo T, Takahashi S, Inoue S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25365482", "url": "https://glygen.org/publication/PubMed/25365482" } ] }, { "title": "p115-SNARE interactions: a dynamic cycle of p115 binding monomeric SNARE motifs and releasing assembled bundles.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2015", "authors": "Wang T, Grabski R, Sztul E, Hay JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "25406594", "url": "https://glygen.org/publication/PubMed/25406594" } ] }, { "title": "CXXC5 regulates differentiation of C2C12 myoblasts into myocytes.", "journal": "Journal of muscle research and cell motility", "date": "2014", "authors": "Li G, Ye X, Peng X, Deng Y, Yuan W, Li Y, Mo X, Wang X, Wan Y, Liu X, Chen T, Jiang Z, Fan X, Wu X, Wang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25433557", "url": "https://glygen.org/publication/PubMed/25433557" } ] }, { "title": "All autophosphorylation sites of epidermal growth factor (EGF) receptor and HER2/neu are located in their carboxyl-terminal tails. Identification of a novel site in EGF receptor.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Margolis BL, Lax I, Kris R, Dombalagian M, Honegger AM, Howk R, Givol D, Ullrich A, Schlessinger J", "evidence": [ { "database": "Reactome", "id": "R-HSA-177929", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-177929" } ], "reference": [ { "type": "PubMed", "id": "2543678", "url": "https://glygen.org/publication/PubMed/2543678" } ] }, { "title": "Three alphaSNAP and 10 ATP molecules are used in SNARE complex disassembly by N-ethylmaleimide-sensitive factor (NSF).", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Shah N, Colbert KN, Enos MD, Herschlag D, Weis WI", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "25492864", "url": "https://glygen.org/publication/PubMed/25492864" } ] }, { "title": "Cohesin modulates transcription of estrogen-responsive genes.", "journal": "Biochimica et biophysica acta", "date": "2015", "authors": "Antony J, Dasgupta T, Rhodes JM, McEwan MV, Print CG, O'Sullivan JM, Horsfield JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25542856", "url": "https://glygen.org/publication/PubMed/25542856" } ] }, { "title": "TFG clusters COPII-coated transport carriers and promotes early secretory pathway organization.", "journal": "The EMBO journal", "date": "2015", "authors": "Johnson A, Bhattacharya N, Hanna M, Pennington JG, Schuh AL, Wang L, Otegui MS, Stagg SM, Audhya A", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "25586378", "url": "https://glygen.org/publication/PubMed/25586378" } ] }, { "title": "Extranuclear steroid receptors are essential for steroid hormone actions.", "journal": "Annual review of medicine", "date": "2015", "authors": "Levin ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "25587652", "url": "https://glygen.org/publication/PubMed/25587652" } ] }, { "title": "SEC16 in COPII coat dynamics at ER exit sites.", "journal": "Biochemical Society transactions", "date": "2015", "authors": "Sprangers J, Rabouille C", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "25619252", "url": "https://glygen.org/publication/PubMed/25619252" } ] }, { "title": "Procollagen export from the endoplasmic reticulum.", "journal": "Biochemical Society transactions", "date": "2015", "authors": "Malhotra V, Erlmann P, Nogueira C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "25619253", "url": "https://glygen.org/publication/PubMed/25619253" } ] }, { "title": "CXXC5 is a negative-feedback regulator of the Wnt/beta-catenin pathway involved in osteoblast differentiation.", "journal": "Cell death and differentiation", "date": "2015", "authors": "Kim HY, Yoon JY, Yun JH, Cho KW, Lee SH, Rhee YM, Jung HS, Lim HJ, Lee H, Choi J, Heo JN, Lee W, No KT, Min D, Choi KY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25633194", "url": "https://glygen.org/publication/PubMed/25633194" } ] }, { "title": "Two Faces of Cathepsin D: Physiological Guardian Angel and Pathological Demon.", "journal": "Biology and medicine (Aligarh)", "date": "2014", "authors": "Khalkhali-Ellis Z, Hendrix MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25663755", "url": "https://glygen.org/publication/PubMed/25663755" } ] }, { "title": "Expression of RCAS1 correlates with urothelial bladder cancer malignancy.", "journal": "International journal of molecular sciences", "date": "2015", "authors": "Jozwicki W, Brozyna AA, Siekiera J, Slominski AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25674852", "url": "https://glygen.org/publication/PubMed/25674852" } ] }, { "title": "Structure of a biologically active estrogen receptor-coactivator complex on DNA.", "journal": "Molecular cell", "date": "2015", "authors": "Yi P, Wang Z, Feng Q, Pintilie GD, Foulds CE, Lanz RB, Ludtke SJ, Schmid MF, Chiu W, O'Malley BW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25728767", "url": "https://glygen.org/publication/PubMed/25728767" } ] }, { "title": "The role of Tcfap2c in tumorigenesis and cancer growth in an activated Neu model of mammary carcinogenesis.", "journal": "Oncogene", "date": "2015", "authors": "Park JM, Wu T, Cyr AR, Woodfield GW, De Andrade JP, Spanheimer PM, Li T, Sugg SL, Lal G, Domann FE, Zhang W, Weigel RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "25772240", "url": "https://glygen.org/publication/PubMed/25772240" } ] }, { "title": "Ras activation revisited: role of GEF and GAP systems.", "journal": "Biological chemistry", "date": "2015", "authors": "Hennig A, Markwart R, Esparza-Franco MA, Ladds G, Rubio I", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "25781681", "url": "https://glygen.org/publication/PubMed/25781681" } ] }, { "title": "The role of molecular chaperones in clathrin mediated vesicular trafficking.", "journal": "Frontiers in molecular biosciences", "date": "2015", "authors": "Sousa R, Lafer EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "26042225", "url": "https://glygen.org/publication/PubMed/26042225" } ] }, { "title": "The Dishevelled-binding protein CXXC5 negatively regulates cutaneous wound healing.", "journal": "The Journal of experimental medicine", "date": "2015", "authors": "Lee SH, Kim MY, Kim HY, Lee YM, Kim H, Nam KA, Roh MR, Min do S, Chung KY, Choi KY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26056233", "url": "https://glygen.org/publication/PubMed/26056233" } ] }, { "title": "The Key Role of Calmodulin in KRAS-Driven Adenocarcinomas.", "journal": "Molecular cancer research : MCR", "date": "2015", "authors": "Nussinov R, Muratcioglu S, Tsai CJ, Jang H, Gursoy A, Keskin O", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "26085527", "url": "https://glygen.org/publication/PubMed/26085527" } ] }, { "title": "Progesterone receptor modulates ERalpha action in breast cancer.", "journal": "Nature", "date": "2015", "authors": "Mohammed H, Russell IA, Stark R, Rueda OM, Hickey TE, Tarulli GA, Serandour AA, Birrell SN, Bruna A, Saadi A, Menon S, Hadfield J, Pugh M, Raj GV, Brown GD, D'Santos C, Robinson JL, Silva G, Launchbury R, Perou CM, Stingl J, Caldas C, Tilley WD, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26153859", "url": "https://glygen.org/publication/PubMed/26153859" } ] }, { "title": "MiR-26b/KPNA2 axis inhibits epithelial ovarian carcinoma proliferation and metastasis through downregulating OCT4.", "journal": "Oncotarget", "date": "2015", "authors": "Lin J, Zhang L, Huang H, Huang Y, Huang L, Wang J, Huang S, He L, Zhou Y, Jia W, Yun J, Luo R, Zheng M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26204489", "url": "https://glygen.org/publication/PubMed/26204489" } ] }, { "title": "p27(Kip1) signaling: Transcriptional and post-translational regulation.", "journal": "The international journal of biochemistry & cell biology", "date": "2015", "authors": "Hnit SS, Xie C, Yao M, Holst J, Bensoussan A, De Souza P, Li Z, Dong Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "26279144", "url": "https://glygen.org/publication/PubMed/26279144" } ] }, { "title": "ATAD2 overexpression links to enrichment of B-MYB-translational signatures and development of aggressive endometrial carcinoma.", "journal": "Oncotarget", "date": "2015", "authors": "Krakstad C, Tangen IL, Hoivik EA, Halle MK, Berg A, Werner HM, Raeder MB, Kusonmano K, Zou JX, Oyan AM, Stefansson I, Trovik J, Kalland KH, Chen HW, Salvesen HB", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "26308378", "url": "https://glygen.org/publication/PubMed/26308378" } ] }, { "title": "Forty Years of Clathrin-coated Vesicles.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2015", "authors": "Robinson MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "26403691", "url": "https://glygen.org/publication/PubMed/26403691" } ] }, { "title": "CXXC5 plays a role as a transcription activator for myelin genes on oligodendrocyte differentiation.", "journal": "Glia", "date": "2016", "authors": "Kim MY, Kim HY, Hong J, Kim D, Lee H, Cheong E, Lee Y, Roth J, Kim DG, Min do S, Choi KY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26462610", "url": "https://glygen.org/publication/PubMed/26462610" } ] }, { "title": "Trefoil factor family peptides--friends or foes?", "journal": "Biomolecular concepts", "date": "2015", "authors": "Busch M, Dunker N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26479350", "url": "https://glygen.org/publication/PubMed/26479350" } ] }, { "title": "beta-Arrestin drives MAP kinase signalling from clathrin-coated structures after GPCR dissociation.", "journal": "Nature cell biology", "date": "2016", "authors": "Eichel K, Jullie D, von Zastrow M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "26829388", "url": "https://glygen.org/publication/PubMed/26829388" } ] }, { "title": "EGFR Is Regulated by TFAP2C in Luminal Breast Cancer and Is a Target for Vandetanib.", "journal": "Molecular cancer therapeutics", "date": "2016", "authors": "De Andrade JP, Park JM, Gu VW, Woodfield GW, Kulak MV, Lorenzen AW, Wu VT, Van Dorin SE, Spanheimer PM, Weigel RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "26832794", "url": "https://glygen.org/publication/PubMed/26832794" } ] }, { "title": "Steroid Receptors Reprogram FoxA1 Occupancy through Dynamic Chromatin Transitions.", "journal": "Cell", "date": "2016", "authors": "Swinstead EE, Miranda TB, Paakinaho V, Baek S, Goldstein I, Hawkins M, Karpova TS, Ball D, Mazza D, Lavis LD, Grimm JB, Morisaki T, Grontved L, Presman DM, Hager GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "27062924", "url": "https://glygen.org/publication/PubMed/27062924" } ] }, { "title": "Rapid steroid hormone actions via membrane receptors.", "journal": "Biochimica et biophysica acta", "date": "2016", "authors": "Schwartz N, Verma A, Bivens CB, Schwartz Z, Boyan BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "27288742", "url": "https://glygen.org/publication/PubMed/27288742" } ] }, { "title": "The emerging role of estrogen in B cell malignancies.", "journal": "Leukemia & lymphoma", "date": "2017", "authors": "Ladikou EE, Kassi E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "27557932", "url": "https://glygen.org/publication/PubMed/27557932" } ] }, { "title": "Estradiol-Estrogen Receptor alpha Mediates the Expression of the CXXC5 Gene through the Estrogen Response Element-Dependent Signaling Pathway.", "journal": "Scientific reports", "date": "2016", "authors": "Yasar P, Ayaz G, Muyan M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "27886276", "url": "https://glygen.org/publication/PubMed/27886276" } ] }, { "title": "Resveratrol regulates gene transcription via activation of stimulus-responsive transcription factors.", "journal": "Pharmacological research", "date": "2017", "authors": "Thiel G, Rossler OG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "28012964", "url": "https://glygen.org/publication/PubMed/28012964" } ] }, { "title": "Membrane and Nuclear Estrogen Receptor Alpha Actions: From Tissue Specificity to Medical Implications.", "journal": "Physiological reviews", "date": "2017", "authors": "Arnal JF, Lenfant F, Metivier R, Flouriot G, Henrion D, Adlanmerini M, Fontaine C, Gourdy P, Chambon P, Katzenellenbogen B, Katzenellenbogen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "28539435", "url": "https://glygen.org/publication/PubMed/28539435" } ] }, { "title": "A role for G-protein coupled estrogen receptor (GPER) in estrogen-induced carcinogenesis: Dysregulated glandular homeostasis, survival and metastasis.", "journal": "The Journal of steroid biochemistry and molecular biology", "date": "2018", "authors": "Filardo EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "28595943", "url": "https://glygen.org/publication/PubMed/28595943" } ] }, { "title": "Targeting Ras with Macromolecules.", "journal": "Cold Spring Harbor perspectives in medicine", "date": "2018", "authors": "Pei D, Chen K, Liao H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "28778966", "url": "https://glygen.org/publication/PubMed/28778966" } ] }, { "title": "Clathrin assembly proteins: affinity purification and a model for coat assembly.", "journal": "The Journal of cell biology", "date": "1987", "authors": "Keen JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "2890644", "url": "https://glygen.org/publication/PubMed/2890644" } ] }, { "title": "The human transforming growth factor alpha promoter directs transcription initiation from a single site in the absence of a TATA sequence.", "journal": "Mol. Cell. Biol.", "date": "1988", "authors": "Jakobovits E B, Schlokat U, Vannice J L, Derynck R, Levinson A D", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "reference": [ { "type": "PubMed", "id": "2907605", "url": "https://glygen.org/publication/PubMed/2907605" } ] }, { "title": "Estrogen-responsive element of the human pS2 gene is an imperfectly palindromic sequence.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Berry M, Nunez AM, Chambon P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "2919170", "url": "https://glygen.org/publication/PubMed/2919170" } ] }, { "title": "Proline-Rich Protein Tyrosine Kinase 2 in Inflammation and Cancer.", "journal": "Cancers", "date": "2018", "authors": "Zhu X, Bao Y, Guo Y, Yang W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "29738483", "url": "https://glygen.org/publication/PubMed/29738483" } ] }, { "title": "Transcriptional regulation of c-myc oncogene expression by estrogen in hormone-responsive human breast cancer cells.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Dubik D, Shiu RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3045126", "url": "https://glygen.org/publication/PubMed/3045126" } ] }, { "title": "Angio-associated migratory cell protein interacts with epidermal growth factor receptor and enhances proliferation and drug resistance in human non-small cell lung cancer cells.", "journal": "Cellular signalling", "date": "2019", "authors": "Yao S, Shi F, Wang Y, Sun X, Sun W, Zhang Y, Liu X, Liu X, Su L", "evidence": [ { "database": "Reactome", "id": "R-HSA-177929", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-177929" } ], "reference": [ { "type": "PubMed", "id": "31075398", "url": "https://glygen.org/publication/PubMed/31075398" } ] }, { "title": "The structural basis for Ras activation of PI3Kalpha lipid kinase.", "journal": "Physical chemistry chemical physics : PCCP", "date": "2019", "authors": "Zhang M, Jang H, Nussinov R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "31135801", "url": "https://glygen.org/publication/PubMed/31135801" } ] }, { "title": "A transcriptional arrest mechanism involved in controlling constitutive levels of mouse c-myb mRNA.", "journal": "Oncogene", "date": "1988", "authors": "Watson RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3281094", "url": "https://glygen.org/publication/PubMed/3281094" } ] }, { "title": "Deep-etch visualization of proteins involved in clathrin assembly.", "journal": "The Journal of cell biology", "date": "1988", "authors": "Heuser JE, Keen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "3417785", "url": "https://glygen.org/publication/PubMed/3417785" } ] }, { "title": "Differential expression of c-myb mRNA in murine B lymphomas by a block to transcription elongation.", "journal": "Science (New York, N.Y.)", "date": "1987", "authors": "Bender TP, Thompson CB, Kuehl WM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3498214", "url": "https://glygen.org/publication/PubMed/3498214" } ] }, { "title": "Genetic markers for non-syndromic orofacial clefts in populations of European ancestry: a meta-analysis.", "journal": "Scientific reports", "date": "2022", "authors": "Slavec L, Karas Kuzelicki N, Locatelli I, Gersak K", "evidence": [ { "database": "RefSeq", "id": "NP_001093161", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093161" } ], "reference": [ { "type": "PubMed", "id": "35075162", "url": "https://glygen.org/publication/PubMed/35075162" } ] }, { "title": "CircRTN1 acts as a miR-431-5p sponge to promote thyroid cancer progression by upregulating TGFA.", "journal": "Hormones (Athens, Greece)", "date": "2022-12", "authors": "Gao Yu, Wang Yichun, Xu Lei, Xie Xiaoque, Zhu Liyang, Wang Fan", "evidence": [ { "database": "RefSeq", "id": "NP_001093161", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093161" } ], "reference": [ { "type": "PubMed", "id": "35804263", "url": "https://glygen.org/publication/PubMed/35804263" } ] }, { "title": "Autocrine TGF-alpha is associated with Benzo(a)pyrene-induced mucus production and MUC5AC expression during allergic asthma.", "journal": "Ecotoxicology and environmental safety", "date": "2022", "authors": "Sun Y, Miao X, Zhu L, Liu J, Lin Y, Xiang G, Wu X, Wang X, Ni Z, Li S", "evidence": [ { "database": "RefSeq", "id": "NP_001093161", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093161" } ], "reference": [ { "type": "PubMed", "id": "36068759", "url": "https://glygen.org/publication/PubMed/36068759" } ] }, { "title": "Stimulation of c-myc oncogene expression associated with estrogen-induced proliferation of human breast cancer cells.", "journal": "Cancer research", "date": "1987", "authors": "Dubik D, Dembinski TC, Shiu RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3677090", "url": "https://glygen.org/publication/PubMed/3677090" } ] }, { "title": "EGF, TGF-\u03b1 and Amphiregulin Differently Regulate Endometrium-Derived Mesenchymal Stromal/Stem Cells.", "journal": "International journal of molecular sciences", "date": "2023-08-29", "authors": "Kamentseva Rimma Sergeevna, Kharchenko Marianna Viktorovna, Gabdrahmanova Gulnara Vladikovna, Kotov Michael Alexandrovich, Kosheverova Vera Vladislavovna, Kornilova Elena Sergeevna", "evidence": [ { "database": "RefSeq", "id": "NP_001093161", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093161" } ], "reference": [ { "type": "PubMed", "id": "37686213", "url": "https://glygen.org/publication/PubMed/37686213" } ] }, { "title": "Human transforming growth factor-alpha: precursor structure and expression in E. coli.", "journal": "Cell", "date": "1984", "authors": "Derynck R, Roberts A B, Winkler M E, Chen E Y, Goeddel D V", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "reference": [ { "type": "PubMed", "id": "6088071", "url": "https://glygen.org/publication/PubMed/6088071" } ] }, { "title": "An enzyme that removes clathrin coats: purification of an uncoating ATPase.", "journal": "The Journal of cell biology", "date": "1984", "authors": "Schlossman DM, Schmid SL, Braell WA, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "6146630", "url": "https://glygen.org/publication/PubMed/6146630" } ] }, { "title": "Intrinsic GTPase activity distinguishes normal and oncogenic ras p21 molecules.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1984", "authors": "Gibbs JB, Sigal IS, Poe M, Scolnick EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "6148751", "url": "https://glygen.org/publication/PubMed/6148751" } ] }, { "title": "Hierarchy of binding sites for Grb2 and Shc on the epidermal growth factor receptor.", "journal": "Molecular and cellular biology", "date": "1994", "authors": "Batzer AG, Rotin D, Urena JM, Skolnik EY, Schlessinger J", "evidence": [ { "database": "Reactome", "id": "R-HSA-179812", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-179812" } ], "reference": [ { "type": "PubMed", "id": "7518560", "url": "https://glygen.org/publication/PubMed/7518560" } ] }, { "title": "Nitric oxide: a physiologic messenger molecule.", "journal": "Annual review of biochemistry", "date": "1994", "authors": "Bredt DS, Snyder SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "7526779", "url": "https://glygen.org/publication/PubMed/7526779" } ] }, { "title": "Grb2/Ash binds directly to tyrosines 1068 and 1086 and indirectly to tyrosine 1148 of activated human epidermal growth factor receptors in intact cells.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Okutani T, Okabayashi Y, Kido Y, Sugimoto Y, Sakaguchi K, Matuoka K, Takenawa T, Kasuga M", "evidence": [ { "database": "Reactome", "id": "R-HSA-179812", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-179812" } ], "reference": [ { "type": "PubMed", "id": "7527043", "url": "https://glygen.org/publication/PubMed/7527043" } ] }, { "title": "Growth hormone-promoted tyrosyl phosphorylation of SHC proteins and SHC association with Grb2.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "VanderKuur J, Allevato G, Billestrup N, Norstedt G, Carter-Su C", "evidence": [ { "database": "Reactome", "id": "R-HSA-180336", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180336" } ], "reference": [ { "type": "PubMed", "id": "7535773", "url": "https://glygen.org/publication/PubMed/7535773" } ] }, { "title": "The phosphotyrosine interaction domain of SHC recognizes tyrosine-phosphorylated NPXY motif.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Songyang Z, Margolis B, Chaudhuri M, Shoelson SE, Cantley LC", "evidence": [ { "database": "Reactome", "id": "R-HSA-180336", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180336" } ], "reference": [ { "type": "PubMed", "id": "7541030", "url": "https://glygen.org/publication/PubMed/7541030" } ] }, { "title": "The phosphotyrosine interaction domain of Shc binds an LXNPXY motif on the epidermal growth factor receptor.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "Batzer AG, Blaikie P, Nelson K, Schlessinger J, Margolis B", "evidence": [ { "database": "Reactome", "id": "R-HSA-180336", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180336" } ], "reference": [ { "type": "PubMed", "id": "7542744", "url": "https://glygen.org/publication/PubMed/7542744" } ] }, { "title": "Transforming p21ras mutants and c-Ets-2 activate the cyclin D1 promoter through distinguishable regions.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Albanese C, Johnson J, Watanabe G, Eklund N, Vu D, Arnold A, Pestell RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "7559524", "url": "https://glygen.org/publication/PubMed/7559524" } ] }, { "title": "Interaction of tyrosine-based sorting signals with clathrin-associated proteins.", "journal": "Science (New York, N.Y.)", "date": "1995", "authors": "Ohno H, Stewart J, Fournier MC, Bosshart H, Rhee I, Miyatake S, Saito T, Gallusser A, Kirchhausen T, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "7569928", "url": "https://glygen.org/publication/PubMed/7569928" } ] }, { "title": "Journey to the surface of the cell: Fos regulation and the SRE.", "journal": "The EMBO journal", "date": "1995", "authors": "Treisman R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "7588619", "url": "https://glygen.org/publication/PubMed/7588619" } ] }, { "title": "Protein kinase B (c-Akt) in phosphatidylinositol-3-OH kinase signal transduction.", "journal": "Nature", "date": "1995", "authors": "Burgering BM, Coffer PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "7637810", "url": "https://glygen.org/publication/PubMed/7637810" } ] }, { "title": "Tyrosine phosphorylation of the c-cbl proto-oncogene protein product and association with epidermal growth factor (EGF) receptor upon EGF stimulation.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Galisteo ML, Dikic I, Batzer AG, Langdon WY, Schlessinger J", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "7657591", "url": "https://glygen.org/publication/PubMed/7657591" } ] }, { "title": "Phosphoinositide 3-kinase inhibition spares actin assembly in activating platelets but reverses platelet aggregation.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Kovacsovics TJ, Bachelot C, Toker A, Vlahos CJ, Duckworth B, Cantley LC, Hartwig JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "7744773", "url": "https://glygen.org/publication/PubMed/7744773" } ] }, { "title": "Modulation of insulin-like growth factor I (IGF-I) receptors and membrane-associated IGF-binding proteins in endometrial cancer cells by estradiol.", "journal": "Endocrinology", "date": "1995", "authors": "Kleinman D, Karas M, Roberts CT Jr, LeRoith D, Phillip M, Segev Y, Levy J, Sharoni Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "7750475", "url": "https://glygen.org/publication/PubMed/7750475" } ] }, { "title": "Identification of the guanine nucleotide dissociation stimulator for Ral as a putative effector molecule of R-ras, H-ras, K-ras, and Rap.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Spaargaren M, Bischoff JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "7809086", "url": "https://glygen.org/publication/PubMed/7809086" } ] }, { "title": "Arrestin interactions with G protein-coupled receptors. Direct binding studies of wild type and mutant arrestins with rhodopsin, beta 2-adrenergic, and m2 muscarinic cholinergic receptors.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Gurevich VV, Dion SB, Onorato JJ, Ptasienski J, Kim CM, Sterne-Marr R, Hosey MM, Benovic JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "7822302", "url": "https://glygen.org/publication/PubMed/7822302" } ] }, { "title": "Dynamin self-assembles into rings suggesting a mechanism for coated vesicle budding.", "journal": "Nature", "date": "1995", "authors": "Hinshaw JE, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "7877694", "url": "https://glygen.org/publication/PubMed/7877694" } ] }, { "title": "ERK phosphorylation potentiates Elk-1-mediated ternary complex formation and transactivation.", "journal": "The EMBO journal", "date": "1995", "authors": "Gille H, Kortenjann M, Thomae O, Moomaw C, Slaughter C, Cobb MH, Shaw PE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "7889942", "url": "https://glygen.org/publication/PubMed/7889942" } ] }, { "title": "Transcriptional regulation of estrogen receptor in breast carcinomas.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "deConinck EC, McPherson LA, Weigel RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "7891714", "url": "https://glygen.org/publication/PubMed/7891714" } ] }, { "title": "ralGDS family members interact with the effector loop of ras p21.", "journal": "Molecular and cellular biology", "date": "1994", "authors": "Kikuchi A, Demo SD, Ye ZH, Chen YW, Williams LT", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "7935463", "url": "https://glygen.org/publication/PubMed/7935463" } ] }, { "title": "Characterization of the proximal estrogen-responsive element of human cathepsin D gene.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1994", "authors": "Augereau P, Miralles F, Cavailles V, Gaudelet C, Parker M, Rochefort H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "7935485", "url": "https://glygen.org/publication/PubMed/7935485" } ] }, { "title": "Interaction of proteins with transcriptionally active estrogen receptors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Cavailles V, Dauvois S, Danielian PS, Parker MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "7937828", "url": "https://glygen.org/publication/PubMed/7937828" } ] }, { "title": "Activated Ras interacts with the Ral guanine nucleotide dissociation stimulator.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Hofer F, Fields S, Schneider C, Martin GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "7972015", "url": "https://glygen.org/publication/PubMed/7972015" } ] }, { "title": "Potent SHC tyrosine phosphorylation by epidermal growth factor at low receptor density or in the absence of receptor autophosphorylation sites.", "journal": "Oncogene", "date": "1994", "authors": "Soler C, Alvarez CV, Beguinot L, Carpenter G", "evidence": [ { "database": "Reactome", "id": "R-HSA-180336", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180336" } ], "reference": [ { "type": "PubMed", "id": "8036006", "url": "https://glygen.org/publication/PubMed/8036006" } ] }, { "title": "Phosphatidylinositol-3-OH kinase as a direct target of Ras.", "journal": "Nature", "date": "1994", "authors": "Rodriguez-Viciana P, Warne PH, Dhand R, Vanhaesebroeck B, Gout I, Fry MJ, Waterfield MD, Downward J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "8052307", "url": "https://glygen.org/publication/PubMed/8052307" } ] }, { "title": "Transforming growth factor-alpha: characterization of the BamHI, RsaI, and TaqI polymorphic regions.", "journal": "Am. J. Hum. Genet.", "date": "1993", "authors": "Qian J F, Feingold J, Stoll C, May E", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "reference": [ { "type": "PubMed", "id": "8100397", "url": "https://glygen.org/publication/PubMed/8100397" } ] }, { "title": "Estrogen receptor-Sp1 complexes mediate estrogen-induced cathepsin D gene expression in MCF-7 human breast cancer cells.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Krishnan V, Wang X, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8195246", "url": "https://glygen.org/publication/PubMed/8195246" } ] }, { "title": "Estrogen receptor-associated proteins: possible mediators of hormone-induced transcription.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Halachmi S, Marden E, Martin G, MacKay H, Abbondanza C, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8197458", "url": "https://glygen.org/publication/PubMed/8197458" } ] }, { "title": "A protein assembly-disassembly pathway in vitro that may correspond to sequential steps of synaptic vesicle docking, activation, and fusion.", "journal": "Cell", "date": "1993", "authors": "Sollner T, Bennett MK, Whiteheart SW, Scheller RH, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "8221884", "url": "https://glygen.org/publication/PubMed/8221884" } ] }, { "title": "Human transforming growth factor alpha: sequence analysis of the 4.5-kb and 1.6-kb mRNA species.", "journal": "Gene", "date": "1993", "authors": "Qian J F, Lazar-Wesley E, Breugnot C, May E", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "reference": [ { "type": "PubMed", "id": "8224876", "url": "https://glygen.org/publication/PubMed/8224876" } ] }, { "title": "Solution structure of human type-alpha transforming growth factor determined by heteronuclear NMR spectroscopy and refined by energy minimization with restraints.", "journal": "Biochemistry", "date": "1993", "authors": "Moy F J, Li Y C, Rauenbuehler P, Winkler M E, Scheraga H A, Montelione G T", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "reference": [ { "type": "PubMed", "id": "8338831", "url": "https://glygen.org/publication/PubMed/8338831" } ] }, { "title": "The SRF accessory protein Elk-1 contains a growth factor-regulated transcriptional activation domain.", "journal": "Cell", "date": "1993", "authors": "Marais R, Wynne J, Treisman R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "8386592", "url": "https://glygen.org/publication/PubMed/8386592" } ] }, { "title": "Growth factors induce nuclear translocation of MAP kinases (p42mapk and p44mapk) but not of their activator MAP kinase kinase (p45mapkk) in fibroblasts.", "journal": "The Journal of cell biology", "date": "1993", "authors": "Lenormand P, Sardet C, Pages G, L'Allemain G, Brunet A, Pouyssegur J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "8394845", "url": "https://glygen.org/publication/PubMed/8394845" } ] }, { "title": "Cathepsin D gene is controlled by a mixed promoter, and estrogens stimulate only TATA-dependent transcription in breast cancer cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Cavailles V, Augereau P, Rochefort H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8419924", "url": "https://glygen.org/publication/PubMed/8419924" } ] }, { "title": "Guanine-nucleotide-releasing factor hSos1 binds to Grb2 and links receptor tyrosine kinases to Ras signalling.", "journal": "Nature", "date": "1993", "authors": "Li N, Batzer A, Daly R, Yajnik V, Skolnik E, Chardin P, Bar-Sagi D, Margolis B, Schlessinger J", "evidence": [ { "database": "Reactome", "id": "R-HSA-179812", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-179812" } ], "reference": [ { "type": "PubMed", "id": "8479541", "url": "https://glygen.org/publication/PubMed/8479541" } ] }, { "title": "Human Sos1: a guanine nucleotide exchange factor for Ras that binds to GRB2.", "journal": "Science (New York, N.Y.)", "date": "1993", "authors": "Chardin P, Camonis JH, Gale NW, van Aelst L, Schlessinger J, Wigler MH, Bar-Sagi D", "evidence": [ { "database": "Reactome", "id": "R-HSA-180336", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180336" } ], "reference": [ { "type": "PubMed", "id": "8493579", "url": "https://glygen.org/publication/PubMed/8493579" } ] }, { "title": "Role of auxilin in uncoating clathrin-coated vesicles.", "journal": "Nature", "date": "1995", "authors": "Ungewickell E, Ungewickell H, Holstein SE, Lindner R, Prasad K, Barouch W, Martin B, Greene LE, Eisenberg E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "8524399", "url": "https://glygen.org/publication/PubMed/8524399" } ] }, { "title": "A role of amphiphysin in synaptic vesicle endocytosis suggested by its binding to dynamin in nerve terminals.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "David C, McPherson PS, Mundigl O, de Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "8552632", "url": "https://glygen.org/publication/PubMed/8552632" } ] }, { "title": "Role of beta-arrestin in mediating agonist-promoted G protein-coupled receptor internalization.", "journal": "Science (New York, N.Y.)", "date": "1996", "authors": "Ferguson SS, Downey WE 3rd, Colapietro AM, Barak LS, Menard L, Caron MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "8553074", "url": "https://glygen.org/publication/PubMed/8553074" } ] }, { "title": "Sec18p (NSF)-driven release of Sec17p (alpha-SNAP) can precede docking and fusion of yeast vacuoles.", "journal": "Cell", "date": "1996", "authors": "Mayer A, Wickner W, Haas A", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "8620540", "url": "https://glygen.org/publication/PubMed/8620540" } ] }, { "title": "p120cbl is a major substrate of tyrosine phosphorylation upon B cell antigen receptor stimulation and interacts in vivo with Fyn and Syk tyrosine kinases, Grb2 and Shc adaptors, and the p85 subunit of phosphatidylinositol 3-kinase.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Panchamoorthy G, Fukazawa T, Miyake S, Soltoff S, Reedquist K, Druker B, Shoelson S, Cantley L, Band H", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "8621719", "url": "https://glygen.org/publication/PubMed/8621719" } ] }, { "title": "Tyrosine kinase/p21ras/MAP-kinase pathway activation by estradiol-receptor complex in MCF-7 cells.", "journal": "The EMBO journal", "date": "1996", "authors": "Migliaccio A, Di Domenico M, Castoria G, de Falco A, Bontempo P, Nola E, Auricchio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "8635462", "url": "https://glygen.org/publication/PubMed/8635462" } ] }, { "title": "Activation of epidermal growth factor receptor by epidermal growth factor.", "journal": "Biochemistry", "date": "1996", "authors": "Sherrill JM, Kyte J", "evidence": [ { "database": "Reactome", "id": "R-HSA-177929", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-177929" } ], "reference": [ { "type": "PubMed", "id": "8639530", "url": "https://glygen.org/publication/PubMed/8639530" } ] }, { "title": "Rac GTPase interacts specifically with phosphatidylinositol 3-kinase.", "journal": "The Biochemical journal", "date": "1996", "authors": "Bokoch GM, Vlahos CJ, Wang Y, Knaus UG, Traynor-Kaplan AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "8645157", "url": "https://glygen.org/publication/PubMed/8645157" } ] }, { "title": "Wortmannin inactivates phosphoinositide 3-kinase by covalent modification of Lys-802, a residue involved in the phosphate transfer reaction.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Wymann MP, Bulgarelli-Leva G, Zvelebil MJ, Pirola L, Vanhaesebroeck B, Waterfield MD, Panayotou G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "8657148", "url": "https://glygen.org/publication/PubMed/8657148" } ] }, { "title": "Mammalian Sly1 regulates syntaxin 5 function in endoplasmic reticulum to Golgi transport.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Dascher C, Balch WE", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "8663406", "url": "https://glygen.org/publication/PubMed/8663406" } ] }, { "title": "Activation of phosphoinositide 3-kinase by interaction with Ras and by point mutation.", "journal": "The EMBO journal", "date": "1996", "authors": "Rodriguez-Viciana P, Warne PH, Vanhaesebroeck B, Waterfield MD, Downward J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "8665852", "url": "https://glygen.org/publication/PubMed/8665852" } ] }, { "title": "RalGDS-like factor (Rlf) is a novel Ras and Rap 1A-associating protein.", "journal": "Oncogene", "date": "1996", "authors": "Wolthuis RM, Bauer B, van 't Veer LJ, de Vries-Smits AM, Cool RH, Spaargaren M, Wittinghofer A, Burgering BM, Bos JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "8710374", "url": "https://glygen.org/publication/PubMed/8710374" } ] }, { "title": "Determination of nitric oxide synthase cofactors: heme, FAD, FMN, and tetrahydrobiopterin.", "journal": "Methods in enzymology", "date": "1996", "authors": "Klatt P, Schmidt K, Werner ER, Mayer B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "8782602", "url": "https://glygen.org/publication/PubMed/8782602" } ] }, { "title": "Beta-arrestin acts as a clathrin adaptor in endocytosis of the beta2-adrenergic receptor.", "journal": "Nature", "date": "1996", "authors": "Goodman OB Jr, Krupnick JG, Santini F, Gurevich VV, Penn RB, Gagnon AW, Keen JH, Benovic JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "8837779", "url": "https://glygen.org/publication/PubMed/8837779" } ] }, { "title": "In vitro phosphorylation of the epidermal growth factor receptor autophosphorylation domain by c-src: identification of phosphorylation sites and c-src SH2 domain binding sites.", "journal": "Biochemistry", "date": "1995", "authors": "Lombardo CR, Consler TG, Kassel DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-177929", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-177929" } ], "reference": [ { "type": "PubMed", "id": "8845374", "url": "https://glygen.org/publication/PubMed/8845374" } ] }, { "title": "p300 is a component of an estrogen receptor coactivator complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Hanstein B, Eckner R, DiRenzo J, Halachmi S, Liu H, Searcy B, Kurokawa R, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8876171", "url": "https://glygen.org/publication/PubMed/8876171" } ] }, { "title": "Estradiol stimulates tyrosine phosphorylation of the insulin-like growth factor-1 receptor and insulin receptor substrate-1 in the uterus.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Richards RG, DiAugustine RP, Petrusz P, Clark GC, Sebastian J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "8876252", "url": "https://glygen.org/publication/PubMed/8876252" } ] }, { "title": "A family of AP-2 proteins regulates c-erbB-2 expression in mammary carcinoma.", "journal": "Oncogene", "date": "1996", "authors": "Bosher JM, Totty NF, Hsuan JJ, Williams T, Hurst HC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "8895516", "url": "https://glygen.org/publication/PubMed/8895516" } ] }, { "title": "Cysteines 153 and 154 of transmembrane transforming growth factor-alpha are palmitoylated and mediate cytoplasmic protein association.", "journal": "J. Biol. Chem.", "date": "1996", "authors": "Shum L, Turck C W, Derynck R", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "reference": [ { "type": "PubMed", "id": "8910478", "url": "https://glygen.org/publication/PubMed/8910478" } ] }, { "title": "Identification of a novel RalGDS-related protein as a candidate effector for Ras and Rap1.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Peterson SN, Trabalzini L, Brtva TR, Fischer T, Altschuler DL, Martelli P, Lapetina EG, Der CJ, White GC 2nd", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "8939933", "url": "https://glygen.org/publication/PubMed/8939933" } ] }, { "title": "The subcellular locations of p15(Ink4b) and p27(Kip1) coordinate their inhibitory interactions with cdk4 and cdk2.", "journal": "Genes & development", "date": "1997", "authors": "Reynisdottir I, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "9042862", "url": "https://glygen.org/publication/PubMed/9042862" } ] }, { "title": "Synaptic vesicle endocytosis impaired by disruption of dynamin-SH3 domain interactions.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Shupliakov O, Low P, Grabs D, Gad H, Chen H, David C, Takei K, De Camilli P, Brodin L", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9092476", "url": "https://glygen.org/publication/PubMed/9092476" } ] }, { "title": "Protein interactions regulating vesicle transport between the endoplasmic reticulum and Golgi apparatus in mammalian cells.", "journal": "Cell", "date": "1997", "authors": "Hay JC, Chao DS, Kuo CS, Scheller RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "9094723", "url": "https://glygen.org/publication/PubMed/9094723" } ] }, { "title": "Auxilin-induced interaction of the molecular chaperone Hsc70 with clathrin baskets.", "journal": "Biochemistry", "date": "1997", "authors": "Barouch W, Prasad K, Greene L, Eisenberg E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9100026", "url": "https://glygen.org/publication/PubMed/9100026" } ] }, { "title": "The vesicle docking protein p115 binds GM130, a cis-Golgi matrix protein, in a mitotically regulated manner.", "journal": "Cell", "date": "1997", "authors": "Nakamura N, Lowe M, Levine TP, Rabouille C, Warren G", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "9150144", "url": "https://glygen.org/publication/PubMed/9150144" } ] }, { "title": "Transcription factor AP-2 controls transcription of the human transforming growth factor-alpha gene.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Wang D, Shin TH, Kudlow JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "9162057", "url": "https://glygen.org/publication/PubMed/9162057" } ] }, { "title": "Arrestin/clathrin interaction. Localization of the arrestin binding locus to the clathrin terminal domain.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Goodman OB Jr, Krupnick JG, Gurevich VV, Benovic JL, Keen JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "9169477", "url": "https://glygen.org/publication/PubMed/9169477" } ] }, { "title": "Characterization of bovine endothelial nitric oxide synthase as a homodimer with down-regulated uncoupled NADPH oxidase activity: tetrahydrobiopterin binding kinetics and role of haem in dimerization.", "journal": "The Biochemical journal", "date": "1997", "authors": "List BM, Klosch B, Volker C, Gorren AC, Sessa WC, Werner ER, Kukovetz WR, Schmidt K, Mayer B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "9173876", "url": "https://glygen.org/publication/PubMed/9173876" } ] }, { "title": "Assembly and disassembly of a ternary complex of synaptobrevin, syntaxin, and SNAP-25 in the membrane of synaptic vesicles.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Otto H, Hanson PI, Jahn R", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "9177194", "url": "https://glygen.org/publication/PubMed/9177194" } ] }, { "title": "Regulation of the human chorionic gonadotropin alpha- and beta-subunit promoters by AP-2.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Johnson W, Albanese C, Handwerger S, Williams T, Pestell RG, Jameson JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "9182571", "url": "https://glygen.org/publication/PubMed/9182571" } ] }, { "title": "Ras links growth factor signaling to the cell cycle machinery via regulation of cyclin D1 and the Cdk inhibitor p27KIP1.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Aktas H, Cai H, Cooper GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "9199319", "url": "https://glygen.org/publication/PubMed/9199319" } ] }, { "title": "Identification of a functional imperfect estrogen-responsive element in the 5'-promoter region of the human cathepsin D gene.", "journal": "Biochemistry", "date": "1997", "authors": "Wang F, Porter W, Xing W, Archer TK, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9201922", "url": "https://glygen.org/publication/PubMed/9201922" } ] }, { "title": "Induction of p27Kip1 degradation and anchorage independence by Ras through the MAP kinase signaling pathway.", "journal": "Oncogene", "date": "1997", "authors": "Kawada M, Yamagoe S, Murakami Y, Suzuki K, Mizuno S, Uehara Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "9264403", "url": "https://glygen.org/publication/PubMed/9264403" } ] }, { "title": "Binding specificity and in vivo targets of the EH domain, a novel protein-protein interaction module.", "journal": "Genes & development", "date": "1997", "authors": "Salcini AE, Confalonieri S, Doria M, Santolini E, Tassi E, Minenkova O, Cesareni G, Pelicci PG, Di Fiore PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "9303539", "url": "https://glygen.org/publication/PubMed/9303539" } ] }, { "title": "An isoform of the Golgi t-SNARE, syntaxin 5, with an endoplasmic reticulum retrieval signal.", "journal": "Molecular biology of the cell", "date": "1997", "authors": "Hui N, Nakamura N, Sonnichsen B, Shima DT, Nilsson T, Warren G", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "9307973", "url": "https://glygen.org/publication/PubMed/9307973" } ] }, { "title": "Molecular basis of agonism and antagonism in the oestrogen receptor.", "journal": "Nature", "date": "1997", "authors": "Brzozowski AM, Pike AC, Dauter Z, Hubbard RE, Bonn T, Engstrom O, Ohman L, Greene GL, Gustafsson JA, Carlquist M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9338790", "url": "https://glygen.org/publication/PubMed/9338790" } ] }, { "title": "Grb2-associated binder-1 mediates phosphatidylinositol 3-kinase activation and the promotion of cell survival by nerve growth factor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Holgado-Madruga M, Moscatello DK, Emlet DR, Dieterich R, Wong AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-180292", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180292" } ], "reference": [ { "type": "PubMed", "id": "9356464", "url": "https://glygen.org/publication/PubMed/9356464" } ] }, { "title": "Nucleosome positioning and transcription-associated chromatin alterations on the human estrogen-responsive pS2 promoter.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Sewack GF, Hansen U", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9388265", "url": "https://glygen.org/publication/PubMed/9388265" } ] }, { "title": "Matrix metalloproteinase-3 releases active heparin-binding EGF-like growth factor by cleavage at a specific juxtamembrane site.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Suzuki M, Raab G, Moses MA, Fernandez CA, Klagsbrun M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "9395517", "url": "https://glygen.org/publication/PubMed/9395517" } ] }, { "title": "The recycling of ERGIC-53 in the early secretory pathway. ERGIC-53 carries a cytosolic endoplasmic reticulum-exit determinant interacting with COPII.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Kappeler F, Klopfenstein DR, Foguet M, Paccaud JP, Hauri HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "9395526", "url": "https://glygen.org/publication/PubMed/9395526" } ] }, { "title": "A novel role for Rab5-GDI in ligand sequestration into clathrin-coated pits.", "journal": "Current biology : CB", "date": "1998", "authors": "McLauchlan H, Newell J, Morrice N, Osborne A, West M, Smythe E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9427626", "url": "https://glygen.org/publication/PubMed/9427626" } ] }, { "title": "Synaptojanin 1: localization on coated endocytic intermediates in nerve terminals and interaction of its 170 kDa isoform with Eps15.", "journal": "FEBS letters", "date": "1997", "authors": "Haffner C, Takei K, Chen H, Ringstad N, Hudson A, Butler MH, Salcini AE, Di Fiore PP, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9428629", "url": "https://glygen.org/publication/PubMed/9428629" } ] }, { "title": "Assembly of cyclin D-dependent kinase and titration of p27Kip1 regulated by mitogen-activated protein kinase kinase (MEK1).", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Cheng M, Sexl V, Sherr CJ, Roussel MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "9448290", "url": "https://glygen.org/publication/PubMed/9448290" } ] }, { "title": "gp25L/emp24/p24 protein family members of the cis-Golgi network bind both COP I and II coatomer.", "journal": "The Journal of cell biology", "date": "1998", "authors": "Dominguez M, Dejgaard K, Fullekrug J, Dahan S, Fazel A, Paccaud JP, Thomas DY, Bergeron JJ, Nilsson T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "9472029", "url": "https://glygen.org/publication/PubMed/9472029" } ] }, { "title": "Shc phosphotyrosine-binding domain dominantly interacts with epidermal growth factor receptors and mediates Ras activation in intact cells.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1998", "authors": "Sakaguchi K, Okabayashi Y, Kido Y, Kimura S, Matsumura Y, Inushima K, Kasuga M", "evidence": [ { "database": "Reactome", "id": "R-HSA-180336", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180336" } ], "reference": [ { "type": "PubMed", "id": "9544989", "url": "https://glygen.org/publication/PubMed/9544989" } ] }, { "title": "Insulin-like growth factor-1 (IGF-1) receptor-insulin receptor substrate complexes in the uterus. Altered signaling response to estradiol in the IGF-1(m/m) mouse.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Richards RG, Walker MP, Sebastian J, DiAugustine RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "9565625", "url": "https://glygen.org/publication/PubMed/9565625" } ] }, { "title": "Phosphorylation of the MAP kinase ERK2 promotes its homodimerization and nuclear translocation.", "journal": "Cell", "date": "1998", "authors": "Khokhlatchev AV, Canagarajah B, Wilsbacher J, Robinson M, Atkinson M, Goldsmith E, Cobb MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "9604935", "url": "https://glygen.org/publication/PubMed/9604935" } ] }, { "title": "Functional and physical interactions between the estrogen receptor Sp1 and nuclear aryl hydrocarbon receptor complexes.", "journal": "Nucleic acids research", "date": "1998", "authors": "Wang F, Hoivik D, Pollenz R, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9611253", "url": "https://glygen.org/publication/PubMed/9611253" } ] }, { "title": "Inhibition of cell migration, spreading, and focal adhesions by tumor suppressor PTEN.", "journal": "Science (New York, N.Y.)", "date": "1998", "authors": "Tamura M, Gu J, Matsumoto K, Aota S, Parsons R, Yamada KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "9616126", "url": "https://glygen.org/publication/PubMed/9616126" } ] }, { "title": "Dynamin undergoes a GTP-dependent conformational change causing vesiculation.", "journal": "Cell", "date": "1998", "authors": "Sweitzer SM, Hinshaw JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9635431", "url": "https://glygen.org/publication/PubMed/9635431" } ] }, { "title": "Localization, dynamics, and protein interactions reveal distinct roles for ER and Golgi SNAREs.", "journal": "The Journal of cell biology", "date": "1998", "authors": "Hay JC, Klumperman J, Oorschot V, Steegmaier M, Kuo CS, Scheller RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "9647643", "url": "https://glygen.org/publication/PubMed/9647643" } ] }, { "title": "c-Myc or cyclin D1 mimics estrogen effects on cyclin E-Cdk2 activation and cell cycle reentry.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Prall OW, Rogan EM, Musgrove EA, Watts CK, Sutherland RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9671459", "url": "https://glygen.org/publication/PubMed/9671459" } ] }, { "title": "Loss of AP-2 results in downregulation of c-KIT and enhancement of melanoma tumorigenicity and metastasis.", "journal": "The EMBO journal", "date": "1998", "authors": "Huang S, Jean D, Luca M, Tainsky MA, Bar-Eli M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "9687504", "url": "https://glygen.org/publication/PubMed/9687504" } ] }, { "title": "Epsin is an EH-domain-binding protein implicated in clathrin-mediated endocytosis.", "journal": "Nature", "date": "1998", "authors": "Chen H, Fre S, Slepnev VI, Capua MR, Takei K, Butler MH, Di Fiore PP, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "9723620", "url": "https://glygen.org/publication/PubMed/9723620" } ] }, { "title": "Upstream stimulatory factors mediate estrogen receptor activation of the cathepsin D promoter.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1998", "authors": "Xing W, Archer TK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9731700", "url": "https://glygen.org/publication/PubMed/9731700" } ] }, { "title": "Crystal structure of the amphiphysin-2 SH3 domain and its role in the prevention of dynamin ring formation.", "journal": "The EMBO journal", "date": "1998", "authors": "Owen DJ, Wigge P, Vallis Y, Moore JD, Evans PR, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9736607", "url": "https://glygen.org/publication/PubMed/9736607" } ] }, { "title": "Phosphoinositide-3-OH kinase-dependent regulation of glycogen synthase kinase 3 and protein kinase B/AKT by the integrin-linked kinase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Delcommenne M, Tan C, Gray V, Rue L, Woodgett J, Dedhar S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "9736715", "url": "https://glygen.org/publication/PubMed/9736715" } ] }, { "title": "A structural explanation for the recognition of tyrosine-based endocytotic signals.", "journal": "Science (New York, N.Y.)", "date": "1998", "authors": "Owen DJ, Evans PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "9812899", "url": "https://glygen.org/publication/PubMed/9812899" } ] }, { "title": "Expression of AP-2 transcription factors in human breast cancer correlates with the regulation of multiple growth factor signalling pathways.", "journal": "Cancer research", "date": "1998", "authors": "Turner BC, Zhang J, Gumbs AA, Maher MG, Kaplan L, Carter D, Glazer PM, Hurst HC, Haffty BG, Williams T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "9850080", "url": "https://glygen.org/publication/PubMed/9850080" } ] }, { "title": "Identification of tyrosine phosphorylation sites in human Gab-1 protein by EGF receptor kinase in vitro.", "journal": "Biochemistry", "date": "1999", "authors": "Lehr S, Kotzka J, Herkner A, Klein E, Siethoff C, Knebel B, Noelle V, Bruning JC, Klein HW, Meyer HE, Krone W, Muller-Wieland D", "evidence": [ { "database": "Reactome", "id": "R-HSA-180292", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180292" } ], "reference": [ { "type": "PubMed", "id": "9890893", "url": "https://glygen.org/publication/PubMed/9890893" } ] }, { "title": "Role of phosphatidylinositol 3,4,5-trisphosphate in regulating the activity and localization of 3-phosphoinositide-dependent protein kinase-1.", "journal": "The Biochemical journal", "date": "1999", "authors": "Currie RA, Walker KS, Gray A, Deak M, Casamayor A, Downes CP, Cohen P, Alessi DR, Lucocq J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "9895304", "url": "https://glygen.org/publication/PubMed/9895304" } ] }, { "title": "Nuclear translocation of p42/p44 mitogen-activated protein kinase is required for growth factor-induced gene expression and cell cycle entry.", "journal": "The EMBO journal", "date": "1999", "authors": "Brunet A, Roux D, Lenormand P, Dowd S, Keyse S, Pouyssegur J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "9927426", "url": "https://glygen.org/publication/PubMed/9927426" } ] } ], "pathway": [ { "id": "hsa:7039", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7039", "resource": "KEGG Pathway" }, { "id": "R-HSA-1257604", "name": "PIP3 activates AKT signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604", "resource": "Reactome", "description": "PIP3 activates AKT signaling" }, { "id": "R-HSA-177929", "name": "Signaling by EGFR", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-177929", "resource": "Reactome", "description": "Signaling by EGFR" }, { "id": "R-HSA-179812", "name": "GRB2 events in EGFR signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-179812", "resource": "Reactome", "description": "GRB2 events in EGFR signaling" }, { "id": "R-HSA-180292", "name": "GAB1 signalosome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180292", "resource": "Reactome", "description": "GAB1 signalosome" }, { "id": "R-HSA-180336", "name": "SHC1 events in EGFR signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180336", "resource": "Reactome", "description": "SHC1 events in EGFR signaling" }, { "id": "R-HSA-182971", "name": "EGFR downregulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971", "resource": "Reactome", "description": "EGFR downregulation" }, { "id": "R-HSA-204005", "name": "COPII-mediated vesicle transport", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005", "resource": "Reactome", "description": "COPII-mediated vesicle transport" }, { "id": "R-HSA-212718", "name": "EGFR interacts with phospholipase C-gamma", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212718", "resource": "Reactome", "description": "EGFR interacts with phospholipase C-gamma" }, { "id": "R-HSA-2219530", "name": "Constitutive Signaling by Aberrant PI3K in Cancer", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530", "resource": "Reactome", "description": "Constitutive Signaling by Aberrant PI3K in Cancer" }, { "id": "R-HSA-5638303", "name": "Inhibition of Signaling by Overexpressed EGFR", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5638303", "resource": "Reactome", "description": "Inhibition of Signaling by Overexpressed EGFR" }, { "id": "R-HSA-5673001", "name": "RAF/MAP kinase cascade", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001", "resource": "Reactome", "description": "RAF/MAP kinase cascade" }, { "id": "R-HSA-5694530", "name": "Cargo concentration in the ER", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530", "resource": "Reactome", "description": "Cargo concentration in the ER" }, { "id": "R-HSA-6811558", "name": "PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811558", "resource": "Reactome", "description": "PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling" }, { "id": "R-HSA-8856825", "name": "Cargo recognition for clathrin-mediated endocytosis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825", "resource": "Reactome", "description": "Cargo recognition for clathrin-mediated endocytosis" }, { "id": "R-HSA-8856828", "name": "Clathrin-mediated endocytosis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828", "resource": "Reactome", "description": "Clathrin-mediated endocytosis" }, { "id": "R-HSA-8866910", "name": "TFAP2 (AP-2) family regulates transcription of growth factors and their receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910", "resource": "Reactome", "description": "TFAP2 (AP-2) family regulates transcription of growth factors and their receptors" }, { "id": "R-HSA-9009391", "name": "Extra-nuclear estrogen signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391", "resource": "Reactome", "description": "Extra-nuclear estrogen signaling" }, { "id": "R-HSA-9018519", "name": "Estrogen-dependent gene expression", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519", "resource": "Reactome", "description": "Estrogen-dependent gene expression" }, { "id": "R-HSA-9634638", "name": "Estrogen-dependent nuclear events downstream of ESR-membrane signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638", "resource": "Reactome", "description": "Estrogen-dependent nuclear events downstream of ESR-membrane signaling" } ], "orthologs": [ { "uniprot_canonical_ac": "P01134-1", "protein_name": "Protransforming growth factor alpha", "gene_name": "Tgfa", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MVPAAGQLALLALGILVAVCQALENSTSPLSDSPVAAAVVSHFNKCPDSHTQYCFHGTCRFLVQEEKPACVCHSGYVGVRCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALVCRHEKPSALLKGRTACCHSETVV", "length": 159 }, "evidence": [ { "id": "45920236", "url": "http://www.informatics.jax.org/homology/45920236", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P48030-1", "protein_name": "Protransforming growth factor alpha", "gene_name": "Tgfa", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MVPATGQLALLALGILLAVCQALENSTSPLSDSPVAAAVVSHFNKCPDSHTQYCFHGTCRFLVQEEKPACVCHSGYVGVRCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQLRKHCEWCRALVCRHEKPSALLKGRTACCHSETVV", "length": 159 }, "evidence": [ { "id": "45920236", "url": "http://www.informatics.jax.org/homology/45920236", "database": "MGI" }, { "id": "P01135", "url": "https://omabrowser.org/oma/group/P01135/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 12, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "pmid": "" }, { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "pmid": "" }, { "name": "basolateral plasma membrane", "id": "GO:0016323", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016323", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "pmid": "" }, { "name": "perinuclear region of cytoplasm", "id": "GO:0048471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "pmid": "" }, { "name": "clathrin-coated endocytic vesicle membrane", "id": "GO:0030669", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030669", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "pmid": "" }, { "name": "cytoplasmic vesicle", "id": "GO:0031410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031410", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "pmid": "" }, { "name": "ER to Golgi transport vesicle membrane", "id": "GO:0012507", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0012507", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "pmid": "" }, { "name": "endoplasmic reticulum-Golgi intermediate compartment membrane", "id": "GO:0033116", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033116", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 12, "go_terms": [ { "name": "hepatocyte proliferation", "id": "GO:0072574", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072574", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "pmid": "" }, { "name": "angiogenesis", "id": "GO:0001525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001525", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "pmid": "" }, { "name": "positive regulation of cell population proliferation", "id": "GO:0008284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008284", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "pmid": "" }, { "name": "intracellular signal transduction", "id": "GO:0035556", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035556", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "pmid": "" }, { "name": "positive regulation of MAPK cascade", "id": "GO:0043410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043410", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "pmid": "" }, { "name": "epidermal growth factor receptor signaling pathway", "id": "GO:0007173", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007173", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "pmid": "" }, { "name": "positive regulation of peptidyl-tyrosine phosphorylation", "id": "GO:0050731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050731", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "pmid": "" }, { "name": "positive regulation of cell division", "id": "GO:0051781", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051781", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "pmid": "" }, { "name": "mammary gland alveolus development", "id": "GO:0060749", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060749", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "pmid": "" }, { "name": "positive regulation of epithelial cell proliferation", "id": "GO:0050679", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050679", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "pmid": "" }, { "name": "positive regulation of mitotic nuclear division", "id": "GO:0045840", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045840", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "pmid": "" }, { "name": "ERBB2-EGFR signaling pathway", "id": "GO:0038134", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038134", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "epidermal growth factor receptor binding", "id": "GO:0005154", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005154", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "pmid": "" }, { "name": "growth factor activity", "id": "GO:0008083", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008083", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "pmid": "" }, { "name": "transmembrane receptor protein tyrosine kinase activator activity", "id": "GO:0030297", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030297", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "pmid": "" }, { "name": "receptor ligand activity", "id": "GO:0048018", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048018", "evidence": [ { "database": "UniProtKB", "id": "P01135", "url": "https://www.uniprot.org/uniprot/P01135" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 25, "end_pos": 27, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 25 ], "o_linked_sites": [], "snv_sites": [ 19, 25, 27 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 25, "end_pos": 27 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 715 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }