{ "uniprot_canonical_ac": "P01106-2", "uniprot_ac": "P01106", "uniprot_id": "MYC_HUMAN", "mass": { "chemical_mass": 50565.0, "monoisotopic_mass": 50565.0 }, "refseq": { "ac": "NP_002458", "name": "myc proto-oncogene protein isoform 1", "summary": "This gene is a proto-oncogene and encodes a nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. The encoded protein forms a heterodimer with the related transcription factor MAX. This complex binds to the E box DNA consensus sequence and regulates the transcription of specific target genes. Amplification of this gene is frequently observed in numerous human cancers. Translocations involving this gene are associated with Burkitt lymphoma and multiple myeloma in human patients. There is evidence to show that translation initiates both from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site, resulting in the production of two isoforms with distinct N-termini. [provided by RefSeq, Aug 2017].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002458" }, "gene_names": [ { "name": "MYC", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P01106", "id": "P01106" }, { "name": "BHLHE39", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P01106", "id": "P01106" }, { "name": "MYC", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002458", "id": "NP_002458" }, { "name": "bHLHe39; c-Myc; MRTL; MYCC", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002458", "id": "NP_002458" } ], "protein_names": [ { "name": "Myc proto-oncogene protein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P01106" }, { "name": "Class E basic helix-loop-helix protein 39", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01106" }, { "name": "Proto-oncogene c-Myc", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01106" }, { "name": "Transcription factor p64", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01106" }, { "name": "avian myelocytomatosis viral oncogene homolog; myc proto-oncogene protein; myc-related translation/localization regulatory factor; proto-oncogene c-Myc; transcription factor p64; class E basic helix-loop-helix protein 39; v-myc avian myelocytomatosis viral oncogene homolog; v-myc myelocytomatosis viral oncogene homolog", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002458", "id": "NP_002458" }, { "name": "bHLHe39", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01106" }, { "name": "myc proto-oncogene protein isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002458", "id": "NP_002458" } ], "function": [ { "annotation": "A recurrent de novo MAX p.Arg60Gln variant causes a syndromic overgrowth disorder through differential expression of c-Myc target genes.", "evidence": [ { "database": "RefSeq", "id": "NP_002458", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002458" }, { "database": "PubMed", "id": "38141607", "url": "https://glygen.org/publication/PubMed/38141607" } ] }, { "annotation": "Alternative translation initiation from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site results in the production of two isoforms with distinct N-termini.", "evidence": [ { "database": "RefSeq", "id": "NP_002458", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002458" }, { "database": "PubMed", "id": "3277717", "url": "https://glygen.org/publication/PubMed/3277717" } ] }, { "annotation": "Isoform-Directed Control of c-Myc Functions: Understanding the Balance from Proliferation to Growth Arrest. Review article Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_002458", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002458" }, { "database": "PubMed", "id": "38139353", "url": "https://glygen.org/publication/PubMed/38139353" } ] }, { "annotation": "Lysine demethylase 5C inhibits transcription of prefoldin subunit 5 to activate c-Myc signal transduction and colorectal cancer progression. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_002458", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002458" }, { "database": "PubMed", "id": "38216914", "url": "https://glygen.org/publication/PubMed/38216914" } ] }, { "annotation": "NCAPG2 promotes prostate cancer malignancy and stemness via STAT3/c-MYC signaling. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_002458", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002458" }, { "database": "PubMed", "id": "38166947", "url": "https://glygen.org/publication/PubMed/38166947" } ] }, { "annotation": "Ribogenesis boosts controlled by HEATR1-MYC interplay promote transition into brain tumour growth.", "evidence": [ { "database": "RefSeq", "id": "NP_002458", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002458" }, { "database": "PubMed", "id": "38225354", "url": "https://glygen.org/publication/PubMed/38225354" } ] }, { "annotation": "This gene is a proto-oncogene and encodes a nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. The encoded protein forms a heterodimer with the related transcription factor MAX. This complex binds to the E box DNA consensus sequence and regulates the transcription of specific target genes. Amplification of this gene is frequently observed in numerous human cancers. Translocations involving this gene are associated with Burkitt lymphoma and multiple myeloma in human patients. There is evidence to show that translation initiates both from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site, resulting in the production of two isoforms with distinct N-termini. [provided by RefSeq, Aug 2017].", "evidence": [ { "database": "RefSeq", "id": "NP_002458", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002458" } ] }, { "annotation": "Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3' (PubMed:24940000, PubMed:25956029). Activates the transcription of growth-related genes (PubMed:24940000, PubMed:25956029). Binds to the VEGFA promoter, promoting VEGFA production and subsequent sprouting angiogenesis (PubMed:24940000, PubMed:25956029). Regulator of somatic reprogramming, controls self-renewal of embryonic stem cells (By similarity). Functions with TAF6L to activate target gene expression through RNA polymerase II pause release (By similarity). Positively regulates transcription of HNRNPA1, HNRNPA2 and PTBP1 which in turn regulate splicing of pyruvate kinase PKM by binding repressively to sequences flanking PKM exon 9, inhibiting exon 9 inclusion and resulting in exon 10 inclusion and production of the PKM M2 isoform (PubMed:20010808).", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106#function" }, { "database": "UniProtKB", "id": "P01108", "url": "https://www.uniprot.org/uniprot/P01108#function" }, { "database": "PubMed", "id": "25956029", "url": "https://glygen.org/publication/PubMed/25956029" }, { "database": "PubMed", "id": "24940000", "url": "https://glygen.org/publication/PubMed/24940000" }, { "database": "PubMed", "id": "20010808", "url": "https://glygen.org/publication/PubMed/20010808" } ] } ], "disease": [ { "disease_id": "DOID:8584", "recommended_name": { "id": "DOID:8584", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8584", "name": "Burkitt lymphoma", "description": "A mature B-cell neoplasm of B-cells found in the germinal center." }, "synonyms": [ { "id": "DOID:8584", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8584", "name": "Burkitt lymphoma/leukaemia", "description": "" }, { "id": "DOID:8584", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8584", "name": "Burkitt's Lymphoma", "description": "" }, { "id": "DOID:8584", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8584", "name": "Burkitt's tumor", "description": "" }, { "id": "DOID:8584", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8584", "name": "Burkitt's tumor or lymphoma", "description": "" }, { "id": "DOID:8584", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8584", "name": "malignant lymphoma, Burkitt's type", "description": "" }, { "id": "DOID:8584", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8584", "name": "small Non-Cleaved cell Lymphoma, Burkitt's type", "description": "" }, { "id": "MONDO:0007243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007243", "name": "Burkitt lymphoma", "description": "Burkitt lymphoma is a rare form of malignant mature B-cell non-Hodgkin lymphoma." }, { "id": "MONDO:0007243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007243", "name": "Burkitt lymphoma", "description": "" }, { "id": "MONDO:0007243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007243", "name": "Burkitt lymphoma/leukemia", "description": "" }, { "id": "MONDO:0007243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007243", "name": "Burkitt's lymphoma", "description": "" }, { "id": "MONDO:0007243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007243", "name": "Burkitt's tumor", "description": "" }, { "id": "MONDO:0007243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007243", "name": "Burkitt's tumor or lymphoma", "description": "" }, { "id": "MONDO:0007243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007243", "name": "Burkitt's tumour", "description": "" }, { "id": "MONDO:0007243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007243", "name": "Burkitt's tumour or lymphoma", "description": "" }, { "id": "MONDO:0007243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007243", "name": "burkitt lymphoma, somatic", "description": "" }, { "id": "MONDO:0007243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007243", "name": "malignant lymphoma, Burkitt's type", "description": "" }, { "id": "MONDO:0007243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007243", "name": "small non-cleaved cell lymphoma", "description": "" }, { "id": "MONDO:0007243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007243", "name": "small non-cleaved cell lymphoma, Burkitt's type", "description": "" }, { "id": "MONDO:0007243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007243", "name": "BL", "description": "" }, { "id": "MIM:113970", "resource": "MIM", "url": "https://www.omim.org/entry/113970", "name": "Burkitt lymphoma", "description": "Burkitt lymphoma" } ], "evidence": [ { "id": "113970", "database": "MIM", "url": "https://www.omim.org/entry/113970" } ] } ], "snv": [ { "evidence": [ { "id": "rs1454889513", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1454889513" }, { "id": "rs1454889513", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1454889513#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 136, "end_pos": 136, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DET->NET).", "chr_id": "8", "chr_pos": "127738623", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D136", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs577698378", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs577698378" }, { "id": "rs577698378", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs577698378" }, { "id": "rs577698378", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs577698378" }, { "id": "rs577698378", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs577698378" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 216, "end_pos": 216, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DSS->NSS).", "chr_id": "8", "chr_pos": "127738863", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "D216", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs922203242", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs922203242" }, { "id": "rs922203242", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs922203242" }, { "id": "rs922203242", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs922203242#frequency_tab" }, { "id": "rs922203242", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs922203242" } ], "glycoeffect": [ "n-glyco-sequon-gain", "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 217, "end_pos": 217, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SSS->NSS).", "chr_id": "8", "chr_pos": "127738867", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S217", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1174543892", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1174543892" }, { "id": "rs1174543892", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1174543892" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 227, "end_pos": 227, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DSS->NSS).", "chr_id": "8", "chr_pos": "127738896", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D227", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs4645959", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs4645959" }, { "id": "rs4645959", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs4645959" }, { "id": "rs4645959", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs4645959" }, { "id": "rs4645959", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs4645959#frequency_tab" }, { "id": "rs4645959", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs4645959" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 26, "end_pos": 26, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NRN->NRS).", "chr_id": "8", "chr_pos": "127738294", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "0.01518", "site_lbl": "N26", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs4645959", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs4645959" }, { "id": "rs4645959", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs4645959" }, { "id": "rs4645959", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs4645959" }, { "id": "rs4645959", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs4645959#frequency_tab" }, { "id": "rs4645959", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs4645959" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 26, "end_pos": 26, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NRN->NRT).", "chr_id": "8", "chr_pos": "127738294", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "0.01518", "site_lbl": "N26", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs536396530", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs536396530" }, { "id": "rs536396530", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs536396530" }, { "id": "rs536396530", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs536396530" }, { "id": "rs536396530", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs536396530" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 453, "end_pos": 453, "sequence_org": "C", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSC->NSS).", "chr_id": "8", "chr_pos": "127740951", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "C453", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs750664148", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750664148" }, { "id": "rs750664148", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750664148" }, { "id": "rs750664148", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs750664148#frequency_tab" }, { "id": "rs750664148", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750664148" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 73, "end_pos": 73, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "8", "chr_pos": "127738434", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T73", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs756091827", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756091827" }, { "id": "rs756091827", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756091827" }, { "id": "rs756091827", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756091827" }, { "id": "rs756091827", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs756091827" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 73, "end_pos": 73, "sequence_org": "T", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "8", "chr_pos": "127738435", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T73", "keywords": [ "ebi", "somatic" ] }, { "evidence": [ { "id": "rs750664148", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750664148" }, { "id": "rs750664148", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750664148" }, { "id": "rs750664148", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs750664148#frequency_tab" }, { "id": "rs750664148", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750664148" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 73, "end_pos": 73, "sequence_org": "T", "sequence_mut": "P", "comment": "Somatic mutation passed 1 out of 1 filters: o-glyco-site-loss (T->P).", "chr_id": "8", "chr_pos": "127738434", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T73", "keywords": [ "ebi", "somatic" ] } ], "mutagenesis": [ { "start_pos": 450, "end_pos": 450, "sequence_org": "R", "sequence_mut": "K", "comment": "Abolished ubiquitination and degradation by the DCX(TRPC4AP) complex.", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" }, { "database": "PubMed", "id": "29779948", "url": "https://glygen.org/publication/PubMed/29779948" } ] }, { "start_pos": 73, "end_pos": 73, "sequence_org": "T", "sequence_mut": "A", "comment": "Impairs interaction with FBXW7 and subsequent degradation by the proteasome. Normal inhibition of Ras-induced senescence.", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" }, { "database": "PubMed", "id": "15103331", "url": "https://glygen.org/publication/PubMed/15103331" }, { "database": "PubMed", "id": "17558397", "url": "https://glygen.org/publication/PubMed/17558397" }, { "database": "PubMed", "id": "19966300", "url": "https://glygen.org/publication/PubMed/19966300" }, { "database": "PubMed", "id": "20713526", "url": "https://glygen.org/publication/PubMed/20713526" } ] }, { "start_pos": 77, "end_pos": 77, "sequence_org": "S", "sequence_mut": "A", "comment": "Impairs interaction with FBXW7 and subsequent degradation by the proteasome. Impaired inhibition of Ras-induced senescence. Abolishes phosphorylation by DYRK2, and subsequent phosphorylation by GSK3B at Thr-73.", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" }, { "database": "PubMed", "id": "15103331", "url": "https://glygen.org/publication/PubMed/15103331" }, { "database": "PubMed", "id": "17558397", "url": "https://glygen.org/publication/PubMed/17558397" }, { "database": "PubMed", "id": "19966300", "url": "https://glygen.org/publication/PubMed/19966300" }, { "database": "PubMed", "id": "20713526", "url": "https://glygen.org/publication/PubMed/20713526" }, { "database": "PubMed", "id": "22307329", "url": "https://glygen.org/publication/PubMed/22307329" } ] }, { "start_pos": 77, "end_pos": 77, "sequence_org": "S", "sequence_mut": "D", "comment": "Phospho-mimetic mutant; abolished regulation by AMBRA1.", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" }, { "database": "PubMed", "id": "25438055", "url": "https://glygen.org/publication/PubMed/25438055" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "76.94", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000136997", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000136997" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "93.02", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000136997", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000136997" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "89.27", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000136997", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000136997" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "82.31", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000136997", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000136997" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "97.9", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000136997", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000136997" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "92.9", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000136997", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000136997" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "93.27", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000136997", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000136997" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "86.2", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000136997", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000136997" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "87.02", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000136997", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000136997" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "97.39", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000136997", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000136997" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "85.74", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000136997", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000136997" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "88.19", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000136997", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000136997" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "97.13", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000136997", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000136997" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P01106", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01106" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P01106", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01106" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P01106", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01106" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P01106", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01106" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P01106", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01106" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P01106", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01106" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P01106", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01106" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P01106", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01106" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P01106", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01106" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P01106", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01106" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P01106", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01106" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P01106", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01106" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "common_name": "Human" } ], "gene": [ { "name": "MYC", "url": "https://www.uniprot.org/uniprot/P01106", "locus": { "chromosome": "8", "start_pos": 12518, "end_pos": 5798, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "LRG_1397", "url": "https://www.ensembl.org/id/LRG_1397" } ] } } ], "crossref": [ { "id": "ENSG00000136997", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000136997", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd11458", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd11458", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL1250348", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL1250348", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "MYC", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=MYC", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "4609", "url": "https://www.ncbi.nlm.nih.gov/gene/4609", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "7553", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=7553", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P01106", "url": "https://www.ebi.ac.uk/intact/interactors/id:P01106*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002418", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002418", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003327", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003327", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011598", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011598", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012682", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012682", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036638", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036638", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:4609", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:4609", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "113970", "url": "http://www.omim.org/entry/113970", "database": "MIM", "categories": [ "Other" ] }, { "id": "190080", "url": "http://www.omim.org/entry/190080", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P01106", "url": "https://www.nextprot.org/entry/NX_P01106", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P01106", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01106", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "STRKDCP", "url": "https://omabrowser.org/oma/group/STRKDCP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3039999at2759", "url": "http://www.orthodb.org/?query=3039999at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR45851", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45851", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR45851:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45851:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1A93", "url": "https://www.rcsb.org/structure/1A93", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1EE4", "url": "https://www.rcsb.org/structure/1EE4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1MV0", "url": "https://www.rcsb.org/structure/1MV0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1NKP", "url": "https://www.rcsb.org/structure/1NKP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2A93", "url": "https://www.rcsb.org/structure/2A93", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2OR9", "url": "https://www.rcsb.org/structure/2OR9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4Y7R", "url": "https://www.rcsb.org/structure/4Y7R", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5I4Z", "url": "https://www.rcsb.org/structure/5I4Z", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5I50", "url": "https://www.rcsb.org/structure/5I50", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6C4U", "url": "https://www.rcsb.org/structure/6C4U", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6E16", "url": "https://www.rcsb.org/structure/6E16", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6E24", "url": "https://www.rcsb.org/structure/6E24", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6G6J", "url": "https://www.rcsb.org/structure/6G6J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6G6K", "url": "https://www.rcsb.org/structure/6G6K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6G6L", "url": "https://www.rcsb.org/structure/6G6L", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7T1Y", "url": "https://www.rcsb.org/structure/7T1Y", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7T1Z", "url": "https://www.rcsb.org/structure/7T1Z", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8OTS", "url": "https://www.rcsb.org/structure/8OTS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8OTT", "url": "https://www.rcsb.org/structure/8OTT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00010", "url": "http://pfam.xfam.org/family/PF00010", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF01056", "url": "http://pfam.xfam.org/family/PF01056", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02344", "url": "http://pfam.xfam.org/family/PF02344", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P01106", "url": "https://pharos.nih.gov/targets/P01106", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P01106", "url": "http://purl.obolibrary.org/obo/PR_P01106", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1362277", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362277", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2894862", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2894862", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-4411364", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4411364", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-69202", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69202", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-69656", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69656", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8866911", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866911", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8951430", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951430", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9818749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818749", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_002458", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002458", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01106-1", "url": "https://www.uniprot.org/uniprot/P01106-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01106-2", "url": "https://www.uniprot.org/uniprot/P01106-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01106-3", "url": "https://www.uniprot.org/uniprot/P01106-3", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA", "length": 454, "header": "sp|P01106-2|MYC_HUMAN Isoform 2 of Myc proto-oncogene protein OS=Homo sapiens OX=9606 GN=MYC PE=1 SV=2 CANONICAL=P01106-2" }, "isoforms": [ { "isoform_ac": "P01106-1", "url": "", "sequence": { "sequence": "MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA", "length": 439, "header": "sp|P01106-1|MYC_HUMAN Isoform 1 of Myc proto-oncogene protein OS=Homo sapiens OX=9606 GN=MYC PE=1 SV=2 CANONICAL=P01106-2" }, "locus": { "chromosome": "8", "start_pos": 127740955, "end_pos": 127738263, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000652288.1", "url": "https://www.ensembl.org/id/ENST00000652288.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000499105.1", "url": "https://www.ensembl.org/id/ENSP00000499105.1" } ] } }, { "isoform_ac": "P01106-2", "url": "", "sequence": { "sequence": "MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA", "length": 454, "header": "sp|P01106-2|MYC_HUMAN Isoform 2 of Myc proto-oncogene protein OS=Homo sapiens OX=9606 GN=MYC PE=1 SV=2 CANONICAL=P01106-2" }, "locus": { "chromosome": "8", "start_pos": 127740955, "end_pos": 127736594, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000621592.8", "url": "https://www.ensembl.org/id/ENST00000621592.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000478887.2", "url": "https://www.ensembl.org/id/ENSP00000478887.2" } ] } }, { "isoform_ac": "P01106-3", "url": "", "sequence": { "sequence": "MDFFRVVENQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA", "length": 453, "header": "sp|P01106-3|MYC_HUMAN Isoform 3 of Myc proto-oncogene protein OS=Homo sapiens OX=9606 GN=MYC PE=1 SV=2 CANONICAL=P01106-2" }, "locus": { "chromosome": "8", "start_pos": 127740955, "end_pos": 127736594, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000524013.2", "url": "https://www.ensembl.org/id/ENST00000524013.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000430235.2", "url": "https://www.ensembl.org/id/ENSP00000430235.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GlcNAc) threonine; alternate O-GlcNAcylation", "start_pos": 73, "start_aa": "Thr", "end_pos": 73, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr73", "evidence": [ { "id": "P01106", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01106#ptm_processing" }, { "id": "7642555", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7642555" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P01106", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01106" }, { "id": "33544938", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33544938" }, { "id": "20668475", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20668475" }, { "id": "34646892", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34646892" }, { "id": "27505673", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27505673" }, { "id": "7753821", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7753821" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "36903375", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36903375" }, { "id": "28878262", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28878262" }, { "id": "30130254", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30130254" }, { "id": "27482104", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27482104" }, { "id": "32684624", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32684624" }, { "id": "7642555", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7642555" }, { "id": "35308201", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35308201" }, { "id": "37247228", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37247228" }, { "id": "30086259", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30086259" } ] } ], "phosphorylation": [ { "start_pos": 176, "end_pos": 176, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" } ], "site_lbl": "Ser176" }, { "start_pos": 217, "end_pos": 217, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" }, { "database": "PubMed", "id": "26284497", "url": "https://glygen.org/publication/PubMed/26284497" } ], "site_lbl": "Ser217" }, { "start_pos": 21, "end_pos": 21, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" } ], "site_lbl": "Ser21" }, { "start_pos": 23, "end_pos": 23, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by RAF; in vitro", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" }, { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" }, { "database": "PubMed", "id": "9315742", "url": "https://glygen.org/publication/PubMed/9315742" } ], "site_lbl": "Thr23" }, { "start_pos": 308, "end_pos": 308, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" } ], "site_lbl": "Ser308" }, { "start_pos": 329, "end_pos": 329, "kinase_uniprot_canonical_ac": "P11309-1", "kinase_gene_name": "PIM1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" }, { "database": "PubMed", "id": "18438430", "url": "https://glygen.org/publication/PubMed/18438430" } ], "site_lbl": "Ser329" }, { "start_pos": 329, "end_pos": 329, "kinase_uniprot_canonical_ac": "Q9P1W9-1", "kinase_gene_name": "PIM2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" }, { "database": "PubMed", "id": "18438430", "url": "https://glygen.org/publication/PubMed/18438430" } ], "site_lbl": "Ser329" }, { "start_pos": 329, "end_pos": 329, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" }, { "database": "PubMed", "id": "24830942", "url": "https://glygen.org/publication/PubMed/24830942" }, { "database": "PubMed", "id": "31501481", "url": "https://glygen.org/publication/PubMed/31501481" } ], "site_lbl": "Ser329" }, { "start_pos": 344, "end_pos": 344, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PIM2; in vitro", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "site_lbl": "Ser344" }, { "start_pos": 358, "end_pos": 358, "kinase_uniprot_canonical_ac": "Q13177-1", "kinase_gene_name": "PAK2", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" }, { "database": "PubMed", "id": "14749374", "url": "https://glygen.org/publication/PubMed/14749374" } ], "site_lbl": "Thr358" }, { "start_pos": 359, "end_pos": 359, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ], "site_lbl": "Ser359" }, { "start_pos": 363, "end_pos": 363, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ], "site_lbl": "Ser363" }, { "start_pos": 365, "end_pos": 365, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ], "site_lbl": "Thr365" }, { "start_pos": 73, "end_pos": 73, "kinase_uniprot_canonical_ac": "P19784-1", "kinase_gene_name": "CSNK2A2", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "2663470", "url": "https://glygen.org/publication/PubMed/2663470" } ], "site_lbl": "Thr73" }, { "start_pos": 73, "end_pos": 73, "kinase_uniprot_canonical_ac": "P49841-1", "kinase_gene_name": "GSK3B", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "2663470", "url": "https://glygen.org/publication/PubMed/2663470" } ], "site_lbl": "Thr73" }, { "start_pos": 73, "end_pos": 73, "kinase_uniprot_canonical_ac": "P68400-1", "kinase_gene_name": "CSNK2A1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "2663470", "url": "https://glygen.org/publication/PubMed/2663470" } ], "site_lbl": "Thr73" }, { "start_pos": 73, "end_pos": 73, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by GSK3; alternate", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" }, { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "17558397", "url": "https://glygen.org/publication/PubMed/17558397" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "8386367", "url": "https://glygen.org/publication/PubMed/8386367" }, { "database": "PubMed", "id": "15103331", "url": "https://glygen.org/publication/PubMed/15103331" } ], "site_lbl": "Thr73" }, { "start_pos": 77, "end_pos": 77, "kinase_uniprot_canonical_ac": "P45983-1", "kinase_gene_name": "MAPK8", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" }, { "database": "PubMed", "id": "10551811", "url": "https://glygen.org/publication/PubMed/10551811" }, { "database": "PubMed", "id": "1748630", "url": "https://glygen.org/publication/PubMed/1748630" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser77" }, { "start_pos": 77, "end_pos": 77, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by DYRK2, GSK3 and CDK2", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" }, { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" }, { "database": "PubMed", "id": "17558397", "url": "https://glygen.org/publication/PubMed/17558397" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19966300", "url": "https://glygen.org/publication/PubMed/19966300" }, { "database": "PubMed", "id": "20713526", "url": "https://glygen.org/publication/PubMed/20713526" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "22307329", "url": "https://glygen.org/publication/PubMed/22307329" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "25438055", "url": "https://glygen.org/publication/PubMed/25438055" }, { "database": "PubMed", "id": "25803737", "url": "https://glygen.org/publication/PubMed/25803737" }, { "database": "PubMed", "id": "8386367", "url": "https://glygen.org/publication/PubMed/8386367" }, { "database": "PubMed", "id": "15103331", "url": "https://glygen.org/publication/PubMed/15103331" } ], "site_lbl": "Ser77" }, { "start_pos": 79, "end_pos": 79, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser79" }, { "start_pos": 86, "end_pos": 86, "kinase_uniprot_canonical_ac": "P45983-1", "kinase_gene_name": "MAPK8", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" }, { "database": "PubMed", "id": "10551811", "url": "https://glygen.org/publication/PubMed/10551811" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" } ], "site_lbl": "Ser86" }, { "start_pos": 86, "end_pos": 86, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" } ], "site_lbl": "Ser86" }, { "start_pos": 88, "end_pos": 88, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser88" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Smad3-Smad4 and AP-1 complexes synergize in transcriptional activation of the c-Jun promoter by transforming growth factor beta.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Wong C, Rougier-Chapman EM, Frederick JP, Datto MB, Liberati NT, Li JM, Wang XF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "10022869", "url": "https://glygen.org/publication/PubMed/10022869" } ] }, { "title": "Constitutive activation of Stat3 signaling confers resistance to apoptosis in human U266 myeloma cells.", "journal": "Immunity", "date": "1999", "authors": "Catlett-Falcone R, Landowski TH, Oshiro MM, Turkson J, Levitzki A, Savino R, Ciliberto G, Moscinski L, Fernandez-Luna JL, Nunez G, Dalton WS, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10023775", "url": "https://glygen.org/publication/PubMed/10023775" } ] }, { "title": "A Smad transcriptional corepressor.", "journal": "Cell", "date": "1999", "authors": "Wotton D, Lo RS, Lee S, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "10199400", "url": "https://glygen.org/publication/PubMed/10199400" } ] }, { "title": "Beta-catenin regulates expression of cyclin D1 in colon carcinoma cells.", "journal": "Nature", "date": "1999", "authors": "Tetsu O, McCormick F", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951430", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951430" } ], "reference": [ { "type": "PubMed", "id": "10201372", "url": "https://glygen.org/publication/PubMed/10201372" } ] }, { "title": "A presenilin-1-dependent gamma-secretase-like protease mediates release of Notch intracellular domain.", "journal": "Nature", "date": "1999", "authors": "De Strooper B, Annaert W, Cupers P, Saftig P, Craessaerts K, Mumm JS, Schroeter EH, Schrijvers V, Wolfe MS, Ray WJ, Goate A, Kopan R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "10206645", "url": "https://glygen.org/publication/PubMed/10206645" } ] }, { "title": "Crystal structure of the interleukin-4/receptor alpha chain complex reveals a mosaic binding interface.", "journal": "Cell", "date": "1999", "authors": "Hage T, Sebald W, Reinemer P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10219247", "url": "https://glygen.org/publication/PubMed/10219247" } ] }, { "title": "C/EBPepsilon directly interacts with the DNA binding domain of c-myb and cooperatively activates transcription of myeloid promoters.", "journal": "Blood", "date": "1999", "authors": "Verbeek W, Gombart AF, Chumakov AM, Muller C, Friedman AD, Koeffler HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "10233885", "url": "https://glygen.org/publication/PubMed/10233885" } ] }, { "title": "The cyclin D1 gene is a target of the beta-catenin/LEF-1 pathway.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Shtutman M, Zhurinsky J, Simcha I, Albanese C, D'Amico M, Pestell R, Ben-Ze'ev A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951430", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951430" } ], "reference": [ { "type": "PubMed", "id": "10318916", "url": "https://glygen.org/publication/PubMed/10318916" } ] }, { "title": "Ubiquitination of p27 is regulated by Cdk-dependent phosphorylation and trimeric complex formation.", "journal": "Genes & development", "date": "1999", "authors": "Montagnoli A, Fiore F, Eytan E, Carrano AC, Draetta GF, Hershko A, Pagano M", "evidence": [ { "database": "Reactome", "id": "R-HSA-69656", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69656" } ], "reference": [ { "type": "PubMed", "id": "10323868", "url": "https://glygen.org/publication/PubMed/10323868" } ] }, { "title": "CCAAT/enhancer binding protein epsilon is a potential retinoid target gene in acute promyelocytic leukemia treatment.", "journal": "The Journal of clinical investigation", "date": "1999", "authors": "Park DJ, Chumakov AM, Vuong PT, Chih DY, Gombart AF, Miller WH Jr, Koeffler HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "10330422", "url": "https://glygen.org/publication/PubMed/10330422" } ] }, { "title": "Regulation of the germline immunoglobulin Cgamma1 promoter by CD40 ligand and IL-4: dual role for tandem NF-kappaB binding sites.", "journal": "Molecular immunology", "date": "1999", "authors": "Warren WD, Roberts KL, Linehan LA, Berton MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10369418", "url": "https://glygen.org/publication/PubMed/10369418" } ] }, { "title": "p27(Kip1) ubiquitination and degradation is regulated by the SCF(Skp2) complex through phosphorylated Thr187 in p27.", "journal": "Current biology : CB", "date": "1999", "authors": "Tsvetkov LM, Yeh KH, Lee SJ, Sun H, Zhang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-69656", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69656" } ], "reference": [ { "type": "PubMed", "id": "10375532", "url": "https://glygen.org/publication/PubMed/10375532" } ] }, { "title": "Identification, functional characterization, and chromosomal localization of USP15, a novel human ubiquitin-specific protease related to the UNP oncoprotein, and a systematic nomenclature for human ubiquitin-specific proteases.", "journal": "Genomics", "date": "1999", "authors": "Baker RT, Wang XW, Woollatt E, White JA, Sutherland GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "10444327", "url": "https://glygen.org/publication/PubMed/10444327" } ] }, { "title": "Ectopic expression of Cdc25A accelerates the G(1)/S transition and leads to premature activation of cyclin E- and cyclin A-dependent kinases.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Blomberg I, Hoffmann I", "evidence": [ { "database": "Reactome", "id": "R-HSA-69656", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69656" } ], "reference": [ { "type": "PubMed", "id": "10454565", "url": "https://glygen.org/publication/PubMed/10454565" } ] }, { "title": "CDC25A phosphatase is a target of E2F and is required for efficient E2F-induced S phase.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Vigo E, Muller H, Prosperini E, Hateboer G, Cartwright P, Moroni MC, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362277", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362277" } ], "reference": [ { "type": "PubMed", "id": "10454584", "url": "https://glygen.org/publication/PubMed/10454584" } ] }, { "title": "p21-activated protein kinase: a crucial component of morphological signaling?", "journal": "Trends in biochemical sciences", "date": "1999", "authors": "Daniels RH, Bokoch GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "10470034", "url": "https://glygen.org/publication/PubMed/10470034" } ] }, { "title": "Estrogen induction of the cyclin D1 promoter: involvement of a cAMP response-like element.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Sabbah M, Courilleau D, Mester J, Redeuilh G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "10500157", "url": "https://glygen.org/publication/PubMed/10500157" } ] }, { "title": "Functional synergism of STAT6 with either NF-kappa B or PU.1 to mediate IL-4-induced activation of IgE germline gene transcription.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Stutz AM, Woisetschlager M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10510379", "url": "https://glygen.org/publication/PubMed/10510379" } ] }, { "title": "Regulation of c-Myc through phosphorylation at Ser-62 and Ser-71 by c-Jun N-terminal kinase.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Noguchi K, Kitanaka C, Yamana H, Kokubu A, Mochizuki T, Kuchino Y", "evidence": [ { "database": "iPTMnet", "id": "P01106-2", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106-2" } ], "reference": [ { "type": "PubMed", "id": "10551811", "url": "https://glygen.org/publication/PubMed/10551811" } ] }, { "title": "Activation of eotaxin gene transcription by NF-kappa B and STAT6 in human airway epithelial cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Matsukura S, Stellato C, Plitt JR, Bickel C, Miura K, Georas SN, Casolaro V, Schleimer RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10586089", "url": "https://glygen.org/publication/PubMed/10586089" } ] }, { "title": "SKIP, a CBF1-associated protein, interacts with the ankyrin repeat domain of NotchIC To facilitate NotchIC function.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Zhou S, Fujimuro M, Hsieh JJ, Chen L, Miyamoto A, Weinmaster G, Hayward SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "10713164", "url": "https://glygen.org/publication/PubMed/10713164" } ] }, { "title": "Transcriptional activation of transforming growth factor alpha by estradiol: requirement for both a GC-rich site and an estrogen response element half-site.", "journal": "Journal of molecular endocrinology", "date": "2000", "authors": "Vyhlidal C, Samudio I, Kladde MP, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "10828826", "url": "https://glygen.org/publication/PubMed/10828826" } ] }, { "title": "Signal transducer and activator of transcription 3 activates CCAAT enhancer-binding protein delta gene transcription in G0 growth-arrested mouse mammary epithelial cells and in involuting mouse mammary gland.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Hutt JA, O'Rourke JP, DeWille J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10867011", "url": "https://glygen.org/publication/PubMed/10867011" } ] }, { "title": "Promoter analysis and chromosomal mapping of human EBAG9 gene.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Ikeda K, Sato M, Tsutsumi O, Tsuchiya F, Tsuneizumi M, Emi M, Imoto I, Inazawa J, Muramatsu M, Inoue S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "10873660", "url": "https://glygen.org/publication/PubMed/10873660" } ] }, { "title": "Embryonic lethality in mice homozygous for a processing-deficient allele of Notch1.", "journal": "Nature", "date": "2000", "authors": "Huppert SS, Le A, Schroeter EH, Mumm JS, Saxena MT, Milner LA, Kopan R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "10879540", "url": "https://glygen.org/publication/PubMed/10879540" } ] }, { "title": "A novel proteolytic cleavage involved in Notch signaling: the role of the disintegrin-metalloprotease TACE.", "journal": "Molecular cell", "date": "2000", "authors": "Brou C, Logeat F, Gupta N, Bessia C, LeBail O, Doedens JR, Cumano A, Roux P, Black RA, Israel A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "10882063", "url": "https://glygen.org/publication/PubMed/10882063" } ] }, { "title": "Comparative analysis of the human and mouse Hey1 promoter: Hey genes are new Notch target genes.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Maier MM, Gessler M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "10964718", "url": "https://glygen.org/publication/PubMed/10964718" } ] }, { "title": "Structure of PAK1 in an autoinhibited conformation reveals a multistage activation switch.", "journal": "Cell", "date": "2000", "authors": "Lei M, Lu W, Meng W, Parrini MC, Eck MJ, Mayer BJ, Harrison SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "10975528", "url": "https://glygen.org/publication/PubMed/10975528" } ] }, { "title": "A deubiquitinating enzyme UBPY interacts with the Src homology 3 domain of Hrs-binding protein via a novel binding motif PX(V/I)(D/N)RXXKP.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Kato M, Miyazawa K, Kitamura N", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "10982817", "url": "https://glygen.org/publication/PubMed/10982817" } ] }, { "title": "Physical interaction of Delta1, Jagged1, and Jagged2 with Notch1 and Notch3 receptors.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Shimizu K, Chiba S, Saito T, Kumano K, Hirai H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "11006133", "url": "https://glygen.org/publication/PubMed/11006133" } ] }, { "title": "Synergistic cooperation between Sp1 and Smad3/Smad4 mediates transforming growth factor beta1 stimulation of alpha 2(I)-collagen (COL1A2) transcription.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Zhang W, Ou J, Inagaki Y, Greenwel P, Ramirez F", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "11007770", "url": "https://glygen.org/publication/PubMed/11007770" } ] }, { "title": "Synergistic, p160 coactivator-dependent enhancement of estrogen receptor function by CARM1 and p300.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Chen D, Huang SM, Stallcup MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11010967", "url": "https://glygen.org/publication/PubMed/11010967" } ] }, { "title": "Smad2, Smad3 and Smad4 cooperate with Sp1 to induce p15(Ink4B) transcription in response to TGF-beta.", "journal": "The EMBO journal", "date": "2000", "authors": "Feng XH, Lin X, Derynck R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "11013220", "url": "https://glygen.org/publication/PubMed/11013220" } ] }, { "title": "MYB oncogene amplification in hereditary BRCA1 breast cancer.", "journal": "Cancer research", "date": "2000", "authors": "Kauraniemi P, Hedenfalk I, Persson K, Duggan DJ, Tanner M, Johannsson O, Olsson H, Trent JM, Isola J, Borg A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11034064", "url": "https://glygen.org/publication/PubMed/11034064" } ] }, { "title": "Analysis of HeyL expression in wild-type and Notch pathway mutant mouse embryos.", "journal": "Mechanisms of development", "date": "2000", "authors": "Leimeister C, Schumacher N, Steidl C, Gessler M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "11044625", "url": "https://glygen.org/publication/PubMed/11044625" } ] }, { "title": "Characterization of IL-4 and IL-13 signals dependent on the human IL-13 receptor alpha chain 1: redundancy of requirement of tyrosine residue for STAT3 activation.", "journal": "International immunology", "date": "2000", "authors": "Umeshita-Suyama R, Sugimoto R, Akaiwa M, Arima K, Yu B, Wada M, Kuwano M, Nakajima K, Hamasaki N, Izuhara K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11058569", "url": "https://glygen.org/publication/PubMed/11058569" } ] }, { "title": "A stat-responsive element in the promoter of the episialin/MUC1 gene is involved in its overexpression in carcinoma cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Gaemers IC, Vos HL, Volders HH, van der Valk SW, Hilkens J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11084045", "url": "https://glygen.org/publication/PubMed/11084045" } ] }, { "title": "PDZK1 and GREB1 are estrogen-regulated genes expressed in hormone-responsive breast cancer.", "journal": "Cancer research", "date": "2000", "authors": "Ghosh MG, Thompson DA, Weigel RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11103799", "url": "https://glygen.org/publication/PubMed/11103799" } ] }, { "title": "Direct regulation of pituitary proopiomelanocortin by STAT3 provides a novel mechanism for immuno-neuroendocrine interfacing.", "journal": "The Journal of clinical investigation", "date": "2000", "authors": "Bousquet C, Zatelli MC, Melmed S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11104795", "url": "https://glygen.org/publication/PubMed/11104795" } ] }, { "title": "Nucleophosmin-anaplastic lymphoma kinase associated with anaplastic large-cell lymphoma activates the phosphatidylinositol 3-kinase/Akt antiapoptotic signaling pathway.", "journal": "Blood", "date": "2000", "authors": "Bai RY, Ouyang T, Miething C, Morris SW, Peschel C, Duyster J", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "11110708", "url": "https://glygen.org/publication/PubMed/11110708" } ] }, { "title": "Suppression of signal transducer and activator of transcription 3-dependent B lymphocyte terminal differentiation by BCL-6.", "journal": "The Journal of experimental medicine", "date": "2000", "authors": "Reljic R, Wagner SD, Peakman LJ, Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11120780", "url": "https://glygen.org/publication/PubMed/11120780" } ] }, { "title": "Activation of anaplastic lymphoma kinase receptor tyrosine kinase induces neuronal differentiation through the mitogen-activated protein kinase pathway.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Souttou B, Carvalho NB, Raulais D, Vigny M", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "11121404", "url": "https://glygen.org/publication/PubMed/11121404" } ] }, { "title": "Cofactor dynamics and sufficiency in estrogen receptor-regulated transcription.", "journal": "Cell", "date": "2000", "authors": "Shang Y, Hu X, DiRenzo J, Lazar MA, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11136970", "url": "https://glygen.org/publication/PubMed/11136970" } ] }, { "title": "Transcriptional activation of cathepsin D gene expression by 17beta-estradiol: mechanism of aryl hydrocarbon receptor-mediated inhibition.", "journal": "Molecular and cellular endocrinology", "date": "2001", "authors": "Wang F, Samudio I, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11165043", "url": "https://glygen.org/publication/PubMed/11165043" } ] }, { "title": "The cell-cycle regulatory protein Cks1 is required for SCF(Skp2)-mediated ubiquitinylation of p27.", "journal": "Nature cell biology", "date": "2001", "authors": "Ganoth D, Bornstein G, Ko TK, Larsen B, Tyers M, Pagano M, Hershko A", "evidence": [ { "database": "Reactome", "id": "R-HSA-69656", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69656" } ], "reference": [ { "type": "PubMed", "id": "11231585", "url": "https://glygen.org/publication/PubMed/11231585" } ] }, { "title": "Dominant-negative mutations of CEBPA, encoding CCAAT/enhancer binding protein-alpha (C/EBPalpha), in acute myeloid leukemia.", "journal": "Nature genetics", "date": "2001", "authors": "Pabst T, Mueller BU, Zhang P, Radomska HS, Narravula S, Schnittger S, Behre G, Hiddemann W, Tenen DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "11242107", "url": "https://glygen.org/publication/PubMed/11242107" } ] }, { "title": "Inactivation of menin, a Smad3-interacting protein, blocks transforming growth factor type beta signaling.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Kaji H, Canaff L, Lebrun JJ, Goltzman D, Hendy GN", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "11274402", "url": "https://glygen.org/publication/PubMed/11274402" } ] }, { "title": "Thrombin regulates vascular smooth muscle cell growth and heat shock proteins via the JAK-STAT pathway.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Madamanchi NR, Li S, Patterson C, Runge MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11278437", "url": "https://glygen.org/publication/PubMed/11278437" } ] }, { "title": "Identification of anaplastic lymphoma kinase as a receptor for the growth factor pleiotrophin.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Stoica GE, Kuo A, Aigner A, Sunitha I, Souttou B, Malerczyk C, Caughey DJ, Wen D, Karavanov A, Riegel AT, Wellstein A", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "11278720", "url": "https://glygen.org/publication/PubMed/11278720" } ] }, { "title": "Co-operative effect of c-Src tyrosine kinase and Stat3 in activation of hepatocyte growth factor expression in mammary carcinoma cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Hung W, Elliott B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11278729", "url": "https://glygen.org/publication/PubMed/11278729" } ] }, { "title": "Role of phosphatidylinositol 3-kinase-Akt pathway in nucleophosmin/anaplastic lymphoma kinase-mediated lymphomagenesis.", "journal": "Cancer research", "date": "2001", "authors": "Slupianek A, Nieborowska-Skorska M, Hoser G, Morrione A, Majewski M, Xue L, Morris SW, Wasik MA, Skorski T", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "11280786", "url": "https://glygen.org/publication/PubMed/11280786" } ] }, { "title": "c-Myc is a critical target for c/EBPalpha in granulopoiesis.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Johansen LM, Iwama A, Lodie TA, Sasaki K, Felsher DW, Golub TR, Tenen DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "11340171", "url": "https://glygen.org/publication/PubMed/11340171" } ] }, { "title": "Transcriptional activation of genes by 17 beta-estradiol through estrogen receptor-Sp1 interactions.", "journal": "Vitamins and hormones", "date": "2001", "authors": "Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11345900", "url": "https://glygen.org/publication/PubMed/11345900" } ] }, { "title": "c-Jun and c-Fos cooperate with STAT3 in IL-6-induced transactivation of the IL-6 respone element (IRE).", "journal": "Cytokine", "date": "2001", "authors": "Schuringa JJ, Timmer H, Luttickhuizen D, Vellenga E, Kruijer W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11356008", "url": "https://glygen.org/publication/PubMed/11356008" } ] }, { "title": "CCAAT/enhancer-binding protein-alpha cooperates with p21 to inhibit cyclin-dependent kinase-2 activity and induces growth arrest independent of DNA binding.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Harris TE, Albrecht JH, Nakanishi M, Darlington GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "11369759", "url": "https://glygen.org/publication/PubMed/11369759" } ] }, { "title": "Stat3-mediated Myc expression is required for Src transformation and PDGF-induced mitogenesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Bowman T, Broome MA, Sinibaldi D, Wharton W, Pledger WJ, Sedivy JM, Irby R, Yeatman T, Courtneidge SA, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11404481", "url": "https://glygen.org/publication/PubMed/11404481" } ] }, { "title": "Estrogen regulation of cyclin D1 gene expression in ZR-75 breast cancer cells involves multiple enhancer elements.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Castro-Rivera E, Samudio I, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11410592", "url": "https://glygen.org/publication/PubMed/11410592" } ] }, { "title": "Involvement of Smads in TGFbeta1-induced furin (fur) transcription.", "journal": "Journal of cellular physiology", "date": "2001", "authors": "Blanchette F, Rudd P, Grondin F, Attisano L, Dubois CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "11424093", "url": "https://glygen.org/publication/PubMed/11424093" } ] }, { "title": "TGIF2 interacts with histone deacetylase 1 and represses transcription.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Melhuish TA, Gallo CM, Wotton D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "11427533", "url": "https://glygen.org/publication/PubMed/11427533" } ] }, { "title": "Estrogen receptor interaction with estrogen response elements.", "journal": "Nucleic acids research", "date": "2001", "authors": "Klinge CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11452016", "url": "https://glygen.org/publication/PubMed/11452016" } ] }, { "title": "The Notch intracellular domain is ubiquitinated and negatively regulated by the mammalian Sel-10 homolog.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Oberg C, Li J, Pauley A, Wolf E, Gurney M, Lendahl U", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "11461910", "url": "https://glygen.org/publication/PubMed/11461910" } ] }, { "title": "Cooperation between STAT3 and c-jun suppresses Fas transcription.", "journal": "Molecular cell", "date": "2001", "authors": "Ivanov VN, Bhoumik A, Krasilnikov M, Raz R, Owen-Schaub LB, Levy D, Horvath CM, Ronai Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11463377", "url": "https://glygen.org/publication/PubMed/11463377" } ] }, { "title": "Use of chromatin immunoprecipitation to clone novel E2F target promoters.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Weinmann AS, Bartley SM, Zhang T, Zhang MQ, Farnham PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "11564866", "url": "https://glygen.org/publication/PubMed/11564866" } ] }, { "title": "A novel active site-directed probe specific for deubiquitylating enzymes reveals proteasome association of USP14.", "journal": "The EMBO journal", "date": "2001", "authors": "Borodovsky A, Kessler BM, Casagrande R, Overkleeft HS, Wilkinson KD, Ploegh HL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "11566882", "url": "https://glygen.org/publication/PubMed/11566882" } ] }, { "title": "Selective coactivation of estrogen-dependent transcription by CITED1 CBP/p300-binding protein.", "journal": "Genes & development", "date": "2001", "authors": "Yahata T, Shao W, Endoh H, Hur J, Coser KR, Sun H, Ueda Y, Kato S, Isselbacher KJ, Brown M, Shioda T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11581164", "url": "https://glygen.org/publication/PubMed/11581164" } ] }, { "title": "Borg proteins control septin organization and are negatively regulated by Cdc42.", "journal": "Nature cell biology", "date": "2001", "authors": "Joberty G, Perlungher RR, Sheffield PJ, Kinoshita M, Noda M, Haystead T, Macara IG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "11584266", "url": "https://glygen.org/publication/PubMed/11584266" } ] }, { "title": "Cables enhances cdk2 tyrosine 15 phosphorylation by Wee1, inhibits cell growth, and is lost in many human colon and squamous cancers.", "journal": "Cancer research", "date": "2001", "authors": "Wu CL, Kirley SD, Xiao H, Chuang Y, Chung DC, Zukerberg LR", "evidence": [ { "database": "Reactome", "id": "R-HSA-69656", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69656" } ], "reference": [ { "type": "PubMed", "id": "11585773", "url": "https://glygen.org/publication/PubMed/11585773" } ] }, { "title": "SEL-10 is an inhibitor of notch signaling that targets notch for ubiquitin-mediated protein degradation.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Wu G, Lyapina S, Das I, Li J, Gurney M, Pauley A, Chui I, Deshaies RJ, Kitajewski J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "11585921", "url": "https://glygen.org/publication/PubMed/11585921" } ] }, { "title": "Signaling via Shc family adapter proteins.", "journal": "Oncogene", "date": "2001", "authors": "Ravichandran KS", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "11607835", "url": "https://glygen.org/publication/PubMed/11607835" } ] }, { "title": "Synergism between ERalpha transactivation function 1 (AF-1) and AF-2 mediated by steroid receptor coactivator protein-1: requirement for the AF-1 alpha-helical core and for a direct interaction between the N- and C-terminal domains.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2001", "authors": "Metivier R, Penot G, Flouriot G, Pakdel F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11682626", "url": "https://glygen.org/publication/PubMed/11682626" } ] }, { "title": "C/EBPalpha arrests cell proliferation through direct inhibition of Cdk2 and Cdk4.", "journal": "Molecular cell", "date": "2001", "authors": "Wang H, Iakova P, Wilde M, Welm A, Goode T, Roesler WJ, Timchenko NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "11684017", "url": "https://glygen.org/publication/PubMed/11684017" } ] }, { "title": "Drosophila neuralized is a ubiquitin ligase that promotes the internalization and degradation of delta.", "journal": "Developmental cell", "date": "2001", "authors": "Lai EC, Deblandre GA, Kintner C, Rubin GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "11740940", "url": "https://glygen.org/publication/PubMed/11740940" } ] }, { "title": "Multilevel dysregulation of STAT3 activation in anaplastic lymphoma kinase-positive T/null-cell lymphoma.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2002", "authors": "Zhang Q, Raghunath PN, Xue L, Majewski M, Carpentieri DF, Odum N, Morris S, Skorski T, Wasik MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "11751994", "url": "https://glygen.org/publication/PubMed/11751994" } ] }, { "title": "Pak1 kinase homodimers are autoinhibited in trans and dissociated upon activation by Cdc42 and Rac1.", "journal": "Molecular cell", "date": "2002", "authors": "Parrini MC, Lei M, Harrison SC, Mayer BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "11804587", "url": "https://glygen.org/publication/PubMed/11804587" } ] }, { "title": "Wnt/beta-catenin/Tcf signaling induces the transcription of Axin2, a negative regulator of the signaling pathway.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Jho EH, Zhang T, Domon C, Joo CK, Freund JN, Costantini F", "evidence": [ { "database": "Reactome", "id": "R-HSA-4411364", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4411364" } ], "reference": [ { "type": "PubMed", "id": "11809808", "url": "https://glygen.org/publication/PubMed/11809808" } ] }, { "title": "Negative feedback loop of Wnt signaling through upregulation of conductin/axin2 in colorectal and liver tumors.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Lustig B, Jerchow B, Sachs M, Weiler S, Pietsch T, Karsten U, van de Wetering M, Clevers H, Schlag PM, Birchmeier W, Behrens J", "evidence": [ { "database": "Reactome", "id": "R-HSA-4411364", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4411364" } ], "reference": [ { "type": "PubMed", "id": "11809809", "url": "https://glygen.org/publication/PubMed/11809809" } ] }, { "title": "Anaplastic lymphoma kinase (ALK) activates Stat3 and protects hematopoietic cells from cell death.", "journal": "Oncogene", "date": "2002", "authors": "Zamo A, Chiarle R, Piva R, Howes J, Fan Y, Chilosi M, Levy DE, Inghirami G", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "11850821", "url": "https://glygen.org/publication/PubMed/11850821" } ] }, { "title": "C/EBPalpha triggers proteasome-dependent degradation of cdk4 during growth arrest.", "journal": "The EMBO journal", "date": "2002", "authors": "Wang H, Goode T, Iakova P, Albrecht JH, Timchenko NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "11867521", "url": "https://glygen.org/publication/PubMed/11867521" } ] }, { "title": "Cyclin A- and cyclin E-Cdk complexes shuttle between the nucleus and the cytoplasm.", "journal": "Molecular biology of the cell", "date": "2002", "authors": "Jackman M, Kubota Y, den Elzen N, Hagting A, Pines J", "evidence": [ { "database": "Reactome", "id": "R-HSA-69202", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69202" } ], "reference": [ { "type": "PubMed", "id": "11907280", "url": "https://glygen.org/publication/PubMed/11907280" } ] }, { "title": "Deubiquitination of p53 by HAUSP is an important pathway for p53 stabilization.", "journal": "Nature", "date": "2002", "authors": "Li M, Chen D, Shiloh A, Luo J, Nikolaev AY, Qin J, Gu W", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "11923872", "url": "https://glygen.org/publication/PubMed/11923872" } ] }, { "title": "Activation of AXIN2 expression by beta-catenin-T cell factor. A feedback repressor pathway regulating Wnt signaling.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Leung JY, Kolligs FT, Wu R, Zhai Y, Kuick R, Hanash S, Cho KR, Fearon ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-4411364", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4411364" } ], "reference": [ { "type": "PubMed", "id": "11940574", "url": "https://glygen.org/publication/PubMed/11940574" } ] }, { "title": "Enhanced expression of the transcription factor Nrf2 by cancer chemopreventive agents: role of antioxidant response element-like sequences in the nrf2 promoter.", "journal": "Molecular and cellular biology", "date": "2002-05", "authors": "Kwak Mi-Kyoung, Itoh Ken, Yamamoto Masayuki, Kensler Thomas W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9818749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818749" } ], "reference": [ { "type": "PubMed", "id": "11940647", "url": "https://glygen.org/publication/PubMed/11940647" } ] }, { "title": "E2F mediates cell cycle-dependent transcriptional repression in vivo by recruitment of an HDAC1/mSin3B corepressor complex.", "journal": "Genes & development", "date": "2002", "authors": "Rayman JB, Takahashi Y, Indjeian VB, Dannenberg JH, Catchpole S, Watson RJ, te Riele H, Dynlacht BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362277", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362277" } ], "reference": [ { "type": "PubMed", "id": "11959842", "url": "https://glygen.org/publication/PubMed/11959842" } ] }, { "title": "Constitutive Stat3 activity up-regulates VEGF expression and tumor angiogenesis.", "journal": "Oncogene", "date": "2002", "authors": "Niu G, Wright KL, Huang M, Song L, Haura E, Turkson J, Zhang S, Wang T, Sinibaldi D, Coppola D, Heller R, Ellis LM, Karras J, Bromberg J, Pardoll D, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11960372", "url": "https://glygen.org/publication/PubMed/11960372" } ] }, { "title": "Mastermind mediates chromatin-specific transcription and turnover of the Notch enhancer complex.", "journal": "Genes & development", "date": "2002", "authors": "Fryer CJ, Lamar E, Turbachova I, Kintner C, Jones KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "12050117", "url": "https://glygen.org/publication/PubMed/12050117" } ] }, { "title": "Midkine binds to anaplastic lymphoma kinase (ALK) and acts as a growth factor for different cell types.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Stoica GE, Kuo A, Powers C, Bowden ET, Sale EB, Riegel AT, Wellstein A", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "12122009", "url": "https://glygen.org/publication/PubMed/12122009" } ] }, { "title": "E2F4/5 and p107 as Smad cofactors linking the TGFbeta receptor to c-myc repression.", "journal": "Cell", "date": "2002", "authors": "Chen CR, Kang Y, Siegel PM, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "12150994", "url": "https://glygen.org/publication/PubMed/12150994" } ] }, { "title": "Gamma-secretase-mediated proteolysis in cell-surface-receptor signalling.", "journal": "Nature reviews. Molecular cell biology", "date": "2002", "authors": "Fortini ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "12209127", "url": "https://glygen.org/publication/PubMed/12209127" } ] }, { "title": "IL-13 signal transduction in human monocytes: phosphorylation of receptor components, association with Jaks, and phosphorylation/activation of Stats.", "journal": "Journal of leukocyte biology", "date": "2002", "authors": "Roy B, Bhattacharjee A, Xu B, Ford D, Maizel AL, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12223527", "url": "https://glygen.org/publication/PubMed/12223527" } ] }, { "title": "Calreticulin interacts with C/EBPalpha and C/EBPbeta mRNAs and represses translation of C/EBP proteins.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Timchenko LT, Iakova P, Welm AL, Cai ZJ, Timchenko NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "12242300", "url": "https://glygen.org/publication/PubMed/12242300" } ] }, { "title": "Expression of the suppressor of cytokine signaling-5 (SOCS5) negatively regulates IL-4-dependent STAT6 activation and Th2 differentiation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Seki Y, Hayashi K, Matsumoto A, Seki N, Tsukada J, Ransom J, Naka T, Kishimoto T, Yoshimura A, Kubo M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12242343", "url": "https://glygen.org/publication/PubMed/12242343" } ] }, { "title": "The disintegrin/metalloprotease ADAM 10 is essential for Notch signalling but not for alpha-secretase activity in fibroblasts.", "journal": "Human molecular genetics", "date": "2002", "authors": "Hartmann D, de Strooper B, Serneels L, Craessaerts K, Herreman A, Annaert W, Umans L, Lubke T, Lena Illert A, von Figura K, Saftig P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "12354787", "url": "https://glygen.org/publication/PubMed/12354787" } ] }, { "title": "p300 and PCAF act cooperatively to mediate transcriptional activation from chromatin templates by notch intracellular domains in vitro.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Wallberg AE, Pedersen K, Lendahl U, Roeder RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "12391150", "url": "https://glygen.org/publication/PubMed/12391150" } ] }, { "title": "NPM-ALK transgenic mice spontaneously develop T-cell lymphomas and plasma cell tumors.", "journal": "Blood", "date": "2003", "authors": "Chiarle R, Gong JZ, Guasparri I, Pesci A, Cai J, Liu J, Simmons WJ, Dhall G, Howes J, Piva R, Inghirami G", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "12424201", "url": "https://glygen.org/publication/PubMed/12424201" } ] }, { "title": "Y-box-binding protein YB-1 mediates transcriptional repression of human alpha 2(I) collagen gene expression by interferon-gamma.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Higashi K, Inagaki Y, Suzuki N, Mitsui S, Mauviel A, Kaneko H, Nakatsuka I", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "12446674", "url": "https://glygen.org/publication/PubMed/12446674" } ] }, { "title": "Crosstalk between CARM1 methylation and CBP acetylation on histone H3.", "journal": "Current biology : CB", "date": "2002", "authors": "Daujat S, Bauer UM, Shah V, Turner B, Berger S, Kouzarides T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "12498683", "url": "https://glygen.org/publication/PubMed/12498683" } ] }, { "title": "Mind bomb is a ubiquitin ligase that is essential for efficient activation of Notch signaling by Delta.", "journal": "Developmental cell", "date": "2003", "authors": "Itoh M, Kim CH, Palardy G, Oda T, Jiang YJ, Maust D, Yeo SY, Lorick K, Wright GJ, Ariza-McNaughton L, Weissman AM, Lewis J, Chandrasekharappa SC, Chitnis AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "12530964", "url": "https://glygen.org/publication/PubMed/12530964" } ] }, { "title": "Rapid induction of dendritic spine morphogenesis by trans-synaptic ephrinB-EphB receptor activation of the Rho-GEF kalirin.", "journal": "Neuron", "date": "2003", "authors": "Penzes P, Beeser A, Chernoff J, Schiller MR, Eipper BA, Mains RE, Huganir RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "12546821", "url": "https://glygen.org/publication/PubMed/12546821" } ] }, { "title": "Independent and cooperative activation of chromosomal c-fos promoter by STAT3.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Yang E, Lerner L, Besser D, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12600988", "url": "https://glygen.org/publication/PubMed/12600988" } ] }, { "title": "Two domains of the progesterone receptor interact with the estrogen receptor and are required for progesterone activation of the c-Src/Erk pathway in mammalian cells.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Ballare C, Uhrig M, Bechtold T, Sancho E, Di Domenico M, Migliaccio A, Auricchio F, Beato M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "12612073", "url": "https://glygen.org/publication/PubMed/12612073" } ] }, { "title": "Transcription activation function of C/EBPalpha is required for induction of granulocytic differentiation.", "journal": "Blood", "date": "2003", "authors": "Keeshan K, Santilli G, Corradini F, Perrotti D, Calabretta B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "12702500", "url": "https://glygen.org/publication/PubMed/12702500" } ] }, { "title": "Role of the SCFSkp2 ubiquitin ligase in the degradation of p21Cip1 in S phase.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Bornstein G, Bloom J, Sitry-Shevah D, Nakayama K, Pagano M, Hershko A", "evidence": [ { "database": "Reactome", "id": "R-HSA-69656", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69656" } ], "reference": [ { "type": "PubMed", "id": "12730199", "url": "https://glygen.org/publication/PubMed/12730199" } ] }, { "title": "An E2F site in the 5'-promoter region contributes to serum-dependent up-regulation of the human proliferating cell nuclear antigen gene.", "journal": "FEBS letters", "date": "2003", "authors": "Li YY, Wang L, Lu CD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362277", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362277" } ], "reference": [ { "type": "PubMed", "id": "12782299", "url": "https://glygen.org/publication/PubMed/12782299" } ] }, { "title": "Rapid turnover of extracellular signal-regulated kinase 3 by the ubiquitin-proteasome pathway defines a novel paradigm of mitogen-activated protein kinase regulation during cellular differentiation.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Coulombe P, Rodier G, Pelletier S, Pellerin J, Meloche S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "12808096", "url": "https://glygen.org/publication/PubMed/12808096" } ] }, { "title": "STATs dimerize in the absence of phosphorylation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Braunstein J, Brutsaert S, Olson R, Schindler C", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12832402", "url": "https://glygen.org/publication/PubMed/12832402" } ] }, { "title": "The amino terminal and E2F interaction domains are critical for C/EBP alpha-mediated induction of granulopoietic development of hematopoietic cells.", "journal": "Blood", "date": "2003", "authors": "D'Alo' F, Johansen LM, Nelson EA, Radomska HS, Evans EK, Zhang P, Nerlov C, Tenen DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "12869508", "url": "https://glygen.org/publication/PubMed/12869508" } ] }, { "title": "Nuclear export of ERK3 by a CRM1-dependent mechanism regulates its inhibitory action on cell cycle progression.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Julien C, Coulombe P, Meloche S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "12915405", "url": "https://glygen.org/publication/PubMed/12915405" } ] }, { "title": "Interferon-gamma interferes with transforming growth factor-beta signaling through direct interaction of YB-1 with Smad3.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Higashi K, Inagaki Y, Fujimori K, Nakao A, Kaneko H, Nakatsuka I", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "12917425", "url": "https://glygen.org/publication/PubMed/12917425" } ] }, { "title": "CYLD is a deubiquitinating enzyme that negatively regulates NF-kappaB activation by TNFR family members.", "journal": "Nature", "date": "2003", "authors": "Trompouki E, Hatzivassiliou E, Tsichritzis T, Farmer H, Ashworth A, Mosialos G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "12917689", "url": "https://glygen.org/publication/PubMed/12917689" } ] }, { "title": "The tumour suppressor CYLD negatively regulates NF-kappaB signalling by deubiquitination.", "journal": "Nature", "date": "2003", "authors": "Kovalenko A, Chable-Bessia C, Cantarella G, Israel A, Wallach D, Courtois G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "12917691", "url": "https://glygen.org/publication/PubMed/12917691" } ] }, { "title": "Inhibition of JAK3 induces apoptosis and decreases anaplastic lymphoma kinase activity in anaplastic large cell lymphoma.", "journal": "Oncogene", "date": "2003", "authors": "Amin HM, Medeiros LJ, Ma Y, Feretzaki M, Das P, Leventaki V, Rassidakis GZ, O'Connor SL, McDonnell TJ, Lai R", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "12934099", "url": "https://glygen.org/publication/PubMed/12934099" } ] }, { "title": "Profiling of estrogen up- and down-regulated gene expression in human breast cancer cells: insights into gene networks and pathways underlying estrogenic control of proliferation and cell phenotype.", "journal": "Endocrinology", "date": "2003", "authors": "Frasor J, Danes JM, Komm B, Chang KC, Lyttle CR, Katzenellenbogen BS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "12959972", "url": "https://glygen.org/publication/PubMed/12959972" } ] }, { "title": "Cyclin A is required at two points in the human cell cycle.", "journal": "The EMBO journal", "date": "1992", "authors": "Pagano M, Pepperkok R, Verde F, Ansorge W, Draetta G", "evidence": [ { "database": "Reactome", "id": "R-HSA-69656", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69656" } ], "reference": [ { "type": "PubMed", "id": "1312467", "url": "https://glygen.org/publication/PubMed/1312467" } ] }, { "title": "Cell cycle regulation of CDK2 activity by phosphorylation of Thr160 and Tyr15.", "journal": "The EMBO journal", "date": "1992", "authors": "Gu Y, Rosenblatt J, Morgan DO", "evidence": [ { "database": "Reactome", "id": "R-HSA-69656", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69656" } ], "reference": [ { "type": "PubMed", "id": "1396589", "url": "https://glygen.org/publication/PubMed/1396589" } ] }, { "title": "Restoration of C/EBPalpha expression in a BCR-ABL+ cell line induces terminal granulocytic differentiation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Tavor S, Park DJ, Gery S, Vuong PT, Gombart AF, Koeffler HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "14517214", "url": "https://glygen.org/publication/PubMed/14517214" } ] }, { "title": "Nucleophosmin-anaplastic lymphoma kinase of anaplastic large-cell lymphoma recruits, activates, and uses pp60c-src to mediate its mitogenicity.", "journal": "Blood", "date": "2004", "authors": "Cussac D, Greenland C, Roche S, Bai RY, Duyster J, Morris SW, Delsol G, Allouche M, Payrastre B", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "14563642", "url": "https://glygen.org/publication/PubMed/14563642" } ] }, { "title": "Acetylation and methylation in nuclear receptor gene activation.", "journal": "Methods in enzymology", "date": "2003", "authors": "Xu W, Cho H, Evans RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "14631847", "url": "https://glygen.org/publication/PubMed/14631847" } ] }, { "title": "IL-4 and IL-13 induce SOCS-1 gene expression in A549 cells by three functional STAT6-binding motifs located upstream of the transcription initiation site.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2003", "authors": "Hebenstreit D, Luft P, Schmiedlechner A, Regl G, Frischauf AM, Aberger F, Duschl A, Horejs-Hoeck J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "14634100", "url": "https://glygen.org/publication/PubMed/14634100" } ] }, { "title": "Arkadia amplifies TGF-beta superfamily signalling through degradation of Smad7.", "journal": "The EMBO journal", "date": "2003", "authors": "Koinuma D, Shinozaki M, Komuro A, Goto K, Saitoh M, Hanyu A, Ebina M, Nukiwa T, Miyazawa K, Imamura T, Miyazono K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "14657019", "url": "https://glygen.org/publication/PubMed/14657019" } ] }, { "title": "Two isoforms of otubain 1 regulate T cell anergy via GRAIL.", "journal": "Nature immunology", "date": "2004", "authors": "Soares L, Seroogy C, Skrenta H, Anandasabapathy N, Lovelace P, Chung CD, Engleman E, Fathman CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "14661020", "url": "https://glygen.org/publication/PubMed/14661020" } ] }, { "title": "Estrogen receptor-alpha directs ordered, cyclical, and combinatorial recruitment of cofactors on a natural target promoter.", "journal": "Cell", "date": "2003", "authors": "Metivier R, Penot G, Hubner MR, Reid G, Brand H, Kos M, Gannon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "14675539", "url": "https://glygen.org/publication/PubMed/14675539" } ] }, { "title": "Stat3 enhances vimentin gene expression by binding to the antisilencer element and interacting with the repressor protein, ZBP-89.", "journal": "Oncogene", "date": "2004", "authors": "Wu Y, Diab I, Zhang X, Izmailova ES, Zehner ZE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "14712222", "url": "https://glygen.org/publication/PubMed/14712222" } ] }, { "title": "Negative control of the Myc protein by the stress-responsive kinase Pak2.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Huang Z, Traugh JA, Bishop JM", "evidence": [ { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" } ], "reference": [ { "type": "PubMed", "id": "14749374", "url": "https://glygen.org/publication/PubMed/14749374" } ] }, { "title": "NPM-ALK fusion kinase of anaplastic large-cell lymphoma regulates survival and proliferative signaling through modulation of FOXO3a.", "journal": "Blood", "date": "2004", "authors": "Gu TL, Tothova Z, Scheijen B, Griffin JD, Gilliland DG, Sternberg DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "14962911", "url": "https://glygen.org/publication/PubMed/14962911" } ] }, { "title": "A corepressor/coactivator exchange complex required for transcriptional activation by nuclear receptors and other regulated transcription factors.", "journal": "Cell", "date": "2004", "authors": "Perissi V, Aggarwal A, Glass CK, Rose DW, Rosenfeld MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "14980219", "url": "https://glygen.org/publication/PubMed/14980219" } ] }, { "title": "Genome-wide identification of high-affinity estrogen response elements in human and mouse.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2004", "authors": "Bourdeau V, Deschenes J, Metivier R, Nagai Y, Nguyen D, Bretschneider N, Gannon F, White JH, Mader S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15001666", "url": "https://glygen.org/publication/PubMed/15001666" } ] }, { "title": "A dynamic role of HAUSP in the p53-Mdm2 pathway.", "journal": "Molecular cell", "date": "2004", "authors": "Li M, Brooks CL, Kon N, Gu W", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "15053880", "url": "https://glygen.org/publication/PubMed/15053880" } ] }, { "title": "Sorting of furin in polarized epithelial and endothelial cells: expression beyond the Golgi apparatus.", "journal": "The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society", "date": "2004", "authors": "Mayer G, Boileau G, Bendayan M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "15100235", "url": "https://glygen.org/publication/PubMed/15100235" } ] }, { "title": "Phosphorylation-dependent degradation of c-Myc is mediated by the F-box protein Fbw7.", "journal": "The EMBO journal", "date": "2004", "authors": "Yada M, Hatakeyama S, Kamura T, Nishiyama M, Tsunematsu R, Imaki H, Ishida N, Okumura F, Nakayama K, Nakayama KI", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" }, { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" } ], "reference": [ { "type": "PubMed", "id": "15103331", "url": "https://glygen.org/publication/PubMed/15103331" } ] }, { "title": "The Notch target genes Hey1 and Hey2 are required for embryonic vascular development.", "journal": "Genes & development", "date": "2004", "authors": "Fischer A, Schumacher N, Maier M, Sendtner M, Gessler M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "15107403", "url": "https://glygen.org/publication/PubMed/15107403" } ] }, { "title": "Stat3 activation regulates the expression of matrix metalloproteinase-2 and tumor invasion and metastasis.", "journal": "Oncogene", "date": "2004", "authors": "Xie TX, Wei D, Liu M, Gao AC, Ali-Osman F, Sawaya R, Huang S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15116091", "url": "https://glygen.org/publication/PubMed/15116091" } ] }, { "title": "Menin is required for bone morphogenetic protein 2- and transforming growth factor beta-regulated osteoblastic differentiation through interaction with Smads and Runx2.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Sowa H, Kaji H, Hendy GN, Canaff L, Komori T, Sugimoto T, Chihara K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "15150273", "url": "https://glygen.org/publication/PubMed/15150273" } ] }, { "title": "ALK receptor tyrosine kinase promotes cell growth and neurite outgrowth.", "journal": "Journal of cell science", "date": "2004", "authors": "Motegi A, Fujimoto J, Kotani M, Sakuraba H, Yamamoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "15226403", "url": "https://glygen.org/publication/PubMed/15226403" } ] }, { "title": "N-Terminal ubiquitination of extracellular signal-regulated kinase 3 and p21 directs their degradation by the proteasome.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Coulombe P, Rodier G, Bonneil E, Thibault P, Meloche S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "15226418", "url": "https://glygen.org/publication/PubMed/15226418" } ] }, { "title": "STAT-1 is activated by IL-4 and IL-13 in multiple cell types.", "journal": "Molecular immunology", "date": "2004", "authors": "Wang IM, Lin H, Goldman SJ, Kobayashi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15261459", "url": "https://glygen.org/publication/PubMed/15261459" } ] }, { "title": "Cellular control of gene expression by T-type cyclin/CDK9 complexes.", "journal": "Gene", "date": "2004", "authors": "Garriga J, Grana X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15276198", "url": "https://glygen.org/publication/PubMed/15276198" } ] }, { "title": "Estrogens and progesterone promote persistent CCND1 gene activation during G1 by inducing transcriptional derepression via c-Jun/c-Fos/estrogen receptor (progesterone receptor) complex assembly to a distal regulatory element and recruitment of cyclin D1 to its own gene promoter.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Cicatiello L, Addeo R, Sasso A, Altucci L, Petrizzi VB, Borgo R, Cancemi M, Caporali S, Caristi S, Scafoglio C, Teti D, Bresciani F, Perillo B, Weisz A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15282324", "url": "https://glygen.org/publication/PubMed/15282324" } ] }, { "title": "Methylation of SHP1 gene and loss of SHP1 protein expression are frequent in systemic anaplastic large cell lymphoma.", "journal": "Blood", "date": "2004", "authors": "Khoury JD, Rassidakis GZ, Medeiros LJ, Amin HM, Lai R", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "15317731", "url": "https://glygen.org/publication/PubMed/15317731" } ] }, { "title": "Transcriptional complexes engaged by apo-estrogen receptor-alpha isoforms have divergent outcomes.", "journal": "The EMBO journal", "date": "2004", "authors": "Metivier R, Penot G, Carmouche RP, Hubner MR, Reid G, Denger S, Manu D, Brand H, Kos M, Benes V, Gannon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15343269", "url": "https://glygen.org/publication/PubMed/15343269" } ] }, { "title": "Discovery of estrogen receptor alpha target genes and response elements in breast tumor cells.", "journal": "Genome biology", "date": "2004", "authors": "Lin CY, Strom A, Vega VB, Kong SL, Yeo AL, Thomsen JS, Chan WC, Doray B, Bangarusamy DK, Ramasamy A, Vergara LA, Tang S, Chong A, Bajic VB, Miller LD, Gustafsson JA, Liu ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15345050", "url": "https://glygen.org/publication/PubMed/15345050" } ] }, { "title": "Inhibition of Akt increases p27Kip1 levels and induces cell cycle arrest in anaplastic large cell lymphoma.", "journal": "Blood", "date": "2005", "authors": "Rassidakis GZ, Feretzaki M, Atwell C, Grammatikakis I, Lin Q, Lai R, Claret FX, Medeiros LJ, Amin HM", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "15374880", "url": "https://glygen.org/publication/PubMed/15374880" } ] }, { "title": "Global gene expression analysis of estrogen receptor transcription factor cross talk in breast cancer: identification of estrogen-induced/activator protein-1-dependent genes.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2005", "authors": "DeNardo DG, Kim HT, Hilsenbeck S, Cuba V, Tsimelzon A, Brown PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15514030", "url": "https://glygen.org/publication/PubMed/15514030" } ] }, { "title": "Scaffolding by ERK3 regulates MK5 in development.", "journal": "The EMBO journal", "date": "2004", "authors": "Schumacher S, Laass K, Kant S, Shi Y, Visel A, Gruber AD, Kotlyarov A, Gaestel M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "15538386", "url": "https://glygen.org/publication/PubMed/15538386" } ] }, { "title": "Mastermind recruits CycC:CDK8 to phosphorylate the Notch ICD and coordinate activation with turnover.", "journal": "Molecular cell", "date": "2004", "authors": "Fryer CJ, White JB, Jones KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "15546612", "url": "https://glygen.org/publication/PubMed/15546612" } ] }, { "title": "Fringe glycosyltransferases differentially modulate Notch1 proteolysis induced by Delta1 and Jagged1.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Yang LT, Nichols JT, Yao C, Manilay JO, Robey EA, Weinmaster G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "15574878", "url": "https://glygen.org/publication/PubMed/15574878" } ] }, { "title": "Activation of MK5/PRAK by the atypical MAP kinase ERK3 defines a novel signal transduction pathway.", "journal": "The EMBO journal", "date": "2004", "authors": "Seternes OM, Mikalsen T, Johansen B, Michaelsen E, Armstrong CG, Morrice NA, Turgeon B, Meloche S, Moens U, Keyse SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "15577943", "url": "https://glygen.org/publication/PubMed/15577943" } ] }, { "title": "STAT6 transcription factor binding sites with mismatches within the canonical 5'-TTC...GAA-3' motif involved in regulation of delta- and mu-opioid receptors.", "journal": "Journal of neurochemistry", "date": "2004", "authors": "Borner C, Woltje M, Hollt V, Kraus J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15584925", "url": "https://glygen.org/publication/PubMed/15584925" } ] }, { "title": "NPM/ALK downregulates p27Kip1 in a PI-3K-dependent manner.", "journal": "Experimental hematology", "date": "2004", "authors": "Slupianek A, Skorski T", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "15588951", "url": "https://glygen.org/publication/PubMed/15588951" } ] }, { "title": "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.", "journal": "Nature biotechnology", "date": "2005", "authors": "Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "15592455", "url": "https://glygen.org/publication/PubMed/15592455" } ] }, { "title": "PARP-10, a novel Myc-interacting protein with poly(ADP-ribose) polymerase activity, inhibits transformation.", "journal": "Oncogene", "date": "2005", "authors": "Yu M, Schreek S, Cerni C, Schamberger C, Lesniewicz K, Poreba E, Vervoorts J, Walsemann G, Grotzinger J, Kremmer E, Mehraein Y, Mertsching J, Kraft R, Austen M, Luscher-Firzlaff J, Luscher B", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "reference": [ { "type": "PubMed", "id": "15674325", "url": "https://glygen.org/publication/PubMed/15674325" } ] }, { "title": "c-Myc binds to human ribosomal DNA and stimulates transcription of rRNA genes by RNA polymerase I.", "journal": "Nat. Cell Biol.", "date": "2005", "authors": "Grandori Carla, Gomez-Roman Natividad, Felton-Edkins Zoe A, Ngouenet Celine, Galloway Denise A, Eisenman Robert N, White Robert J", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "reference": [ { "type": "PubMed", "id": "15723054", "url": "https://glygen.org/publication/PubMed/15723054" } ] }, { "title": "Two distinct E3 ubiquitin ligases have complementary functions in the regulation of delta and serrate signaling in Drosophila.", "journal": "PLoS biology", "date": "2005", "authors": "Le Borgne R, Remaud S, Hamel S, Schweisguth F", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "15760269", "url": "https://glygen.org/publication/PubMed/15760269" } ] }, { "title": "Aberrant Stat3 signaling by interleukin-4 in malignant glioma cells: involvement of IL-13Ralpha2.", "journal": "Cancer research", "date": "2005", "authors": "Rahaman SO, Vogelbaum MA, Haque SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15805299", "url": "https://glygen.org/publication/PubMed/15805299" } ] }, { "title": "Mind bomb-2 is an E3 ligase for Notch ligand.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Koo BK, Yoon KJ, Yoo KW, Lim HS, Song R, So JH, Kim CH, Kong YY", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "15824097", "url": "https://glygen.org/publication/PubMed/15824097" } ] }, { "title": "The ubiquitin ligase Drosophila Mind bomb promotes Notch signaling by regulating the localization and activity of Serrate and Delta.", "journal": "Development (Cambridge, England)", "date": "2005", "authors": "Lai EC, Roegiers F, Qin X, Jan YN, Rubin GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "15829515", "url": "https://glygen.org/publication/PubMed/15829515" } ] }, { "title": "Gene expression alterations of human peripheral blood monocytes induced by medium-term treatment with the TH2-cytokines interleukin-4 and -13.", "journal": "Cytokine", "date": "2005", "authors": "Chaitidis P, O'Donnell V, Kuban RJ, Bermudez-Fajardo A, Ungethuem U, Kuhn H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15869882", "url": "https://glygen.org/publication/PubMed/15869882" } ] }, { "title": "Stat3 is required for ALK-mediated lymphomagenesis and provides a possible therapeutic target.", "journal": "Nature medicine", "date": "2005", "authors": "Chiarle R, Simmons WJ, Cai H, Dhall G, Zamo A, Raz R, Karras JG, Levy DE, Inghirami G", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "15895073", "url": "https://glygen.org/publication/PubMed/15895073" } ] }, { "title": "Loss of HAUSP-mediated deubiquitination contributes to DNA damage-induced destabilization of Hdmx and Hdm2.", "journal": "Molecular cell", "date": "2005", "authors": "Meulmeester E, Maurice MM, Boutell C, Teunisse AF, Ovaa H, Abraham TE, Dirks RW, Jochemsen AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "15916963", "url": "https://glygen.org/publication/PubMed/15916963" } ] }, { "title": "Unique substrate specificity of anaplastic lymphoma kinase (ALK): development of phosphoacceptor peptides for the assay of ALK activity.", "journal": "Biochemistry", "date": "2005", "authors": "Donella-Deana A, Marin O, Cesaro L, Gunby RH, Ferrarese A, Coluccia AM, Tartari CJ, Mologni L, Scapozza L, Gambacorti-Passerini C, Pinna LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "15938644", "url": "https://glygen.org/publication/PubMed/15938644" } ] }, { "title": "Nuclear interaction of EGFR and STAT3 in the activation of the iNOS/NO pathway.", "journal": "Cancer cell", "date": "2005", "authors": "Lo HW, Hsu SC, Ali-Seyed M, Gunduz M, Xia W, Wei Y, Bartholomeusz G, Shih JY, Hung MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15950906", "url": "https://glygen.org/publication/PubMed/15950906" } ] }, { "title": "DNA-activated protein kinase in Raji Burkitt's lymphoma cells. Phosphorylation of c-Myc oncoprotein.", "journal": "European journal of biochemistry", "date": "1992", "authors": "Iijima S, Teraoka H, Date T, Tsukada K", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "reference": [ { "type": "PubMed", "id": "1597196", "url": "https://glygen.org/publication/PubMed/1597196" } ] }, { "title": "GREB 1 is a critical regulator of hormone dependent breast cancer growth.", "journal": "Breast cancer research and treatment", "date": "2005", "authors": "Rae JM, Johnson MD, Scheys JO, Cordero KE, Larios JM, Lippman ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15986123", "url": "https://glygen.org/publication/PubMed/15986123" } ] }, { "title": "Targeting Stat3 blocks both HIF-1 and VEGF expression induced by multiple oncogenic growth signaling pathways.", "journal": "Oncogene", "date": "2005", "authors": "Xu Q, Briggs J, Park S, Niu G, Kortylewski M, Zhang S, Gritsko T, Turkson J, Kay H, Semenza GL, Cheng JQ, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16007214", "url": "https://glygen.org/publication/PubMed/16007214" } ] }, { "title": "Chromosome-wide mapping of estrogen receptor binding reveals long-range regulation requiring the forkhead protein FoxA1.", "journal": "Cell", "date": "2005", "authors": "Carroll JS, Liu XS, Brodsky AS, Li W, Meyer CA, Szary AJ, Eeckhoute J, Shao W, Hestermann EV, Geistlinger TR, Fox EA, Silver PA, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16009131", "url": "https://glygen.org/publication/PubMed/16009131" } ] }, { "title": "Cathepsin D: newly discovered functions of a long-standing aspartic protease in cancer and apoptosis.", "journal": "Cancer letters", "date": "2006", "authors": "Liaudet-Coopman E, Beaujouin M, Derocq D, Garcia M, Glondu-Lassis M, Laurent-Matha V, Prebois C, Rochefort H, Vignon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16046058", "url": "https://glygen.org/publication/PubMed/16046058" } ] }, { "title": "STAT3-mediated transcription of Bcl-2, Mcl-1 and c-IAP2 prevents apoptosis in polyamine-depleted cells.", "journal": "The Biochemical journal", "date": "2005", "authors": "Bhattacharya S, Ray RM, Johnson LR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16048438", "url": "https://glygen.org/publication/PubMed/16048438" } ] }, { "title": "From the Cover: Location analysis of estrogen receptor alpha target promoters reveals that FOXA1 defines a domain of the estrogen response.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Laganiere J, Deblois G, Lefebvre C, Bataille AR, Robert F, Giguere V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16087863", "url": "https://glygen.org/publication/PubMed/16087863" } ] }, { "title": "The interplay between DSL proteins and ubiquitin ligases in Notch signaling.", "journal": "Development (Cambridge, England)", "date": "2005", "authors": "Pitsouli C, Delidakis C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "16093323", "url": "https://glygen.org/publication/PubMed/16093323" } ] }, { "title": "Role of Stat3 in regulating p53 expression and function.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Niu G, Wright KL, Ma Y, Wright GM, Huang M, Irby R, Briggs J, Karras J, Cress WD, Pardoll D, Jove R, Chen J, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16107692", "url": "https://glygen.org/publication/PubMed/16107692" } ] }, { "title": "Downstream targets of growth factor and oestrogen signalling and endocrine resistance: the potential roles of c-Myc, cyclin D1 and cyclin E.", "journal": "Endocrine-related cancer", "date": "2005", "authors": "Butt AJ, McNeil CM, Musgrove EA, Sutherland RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16113099", "url": "https://glygen.org/publication/PubMed/16113099" } ] }, { "title": "Six lysine residues on c-Myc are direct substrates for acetylation by p300.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Zhang K, Faiola F, Martinez E", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "reference": [ { "type": "PubMed", "id": "16126174", "url": "https://glygen.org/publication/PubMed/16126174" } ] }, { "title": "Jak3 activation is significantly associated with ALK expression in anaplastic large cell lymphoma.", "journal": "Human pathology", "date": "2005", "authors": "Lai R, Rassidakis GZ, Lin Q, Atwell C, Medeiros LJ, Amin HM", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "16153455", "url": "https://glygen.org/publication/PubMed/16153455" } ] }, { "title": "Inhibition of ALK enzymatic activity in T-cell lymphoma cells induces apoptosis and suppresses proliferation and STAT3 phosphorylation independently of Jak3.", "journal": "Laboratory investigation; a journal of technical methods and pathology", "date": "2005", "authors": "Marzec M, Kasprzycka M, Ptasznik A, Wlodarski P, Zhang Q, Odum N, Wasik MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "16170336", "url": "https://glygen.org/publication/PubMed/16170336" } ] }, { "title": "Requirement of STAT3 activation for maximal collagenase-1 (MMP-1) induction by epidermal growth factor and malignant characteristics in T24 bladder cancer cells.", "journal": "Oncogene", "date": "2006", "authors": "Itoh M, Murata T, Suzuki T, Shindoh M, Nakajima K, Imai K, Yoshida K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16205632", "url": "https://glygen.org/publication/PubMed/16205632" } ] }, { "title": "Human ubiquitin specific protease 31 is a deubiquitinating enzyme implicated in activation of nuclear factor-kappaB.", "journal": "Cellular signalling", "date": "2006", "authors": "Tzimas C, Michailidou G, Arsenakis M, Kieff E, Mosialos G, Hatzivassiliou EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "16214042", "url": "https://glygen.org/publication/PubMed/16214042" } ] }, { "title": "Essential role of STAT3 in cytokine-driven NF-kappaB-mediated serum amyloid A gene expression.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2005", "authors": "Hagihara K, Nishikawa T, Sugamata Y, Song J, Isobe T, Taga T, Yoshizaki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16236134", "url": "https://glygen.org/publication/PubMed/16236134" } ] }, { "title": "Hypoxia requires notch signaling to maintain the undifferentiated cell state.", "journal": "Developmental cell", "date": "2005", "authors": "Gustafsson MV, Zheng X, Pereira T, Gradin K, Jin S, Lundkvist J, Ruas JL, Poellinger L, Lendahl U, Bondesson M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "16256737", "url": "https://glygen.org/publication/PubMed/16256737" } ] }, { "title": "Y-box protein-1 is the crucial mediator of antifibrotic interferon-gamma effects.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Dooley S, Said HM, Gressner AM, Floege J, En-Nia A, Mertens PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "16278212", "url": "https://glygen.org/publication/PubMed/16278212" } ] }, { "title": "Mechanism of estrogen activation of c-myc oncogene expression.", "journal": "Oncogene", "date": "1992", "authors": "Dubik D, Shiu RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "1630819", "url": "https://glygen.org/publication/PubMed/1630819" } ] }, { "title": "Role of the subcellular localization of ALK tyrosine kinase domain in neuronal differentiation of PC12 cells.", "journal": "Journal of cell science", "date": "2005", "authors": "Gouzi JY, Moog-Lutz C, Vigny M, Brunet-de Carvalho N", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "16317043", "url": "https://glygen.org/publication/PubMed/16317043" } ] }, { "title": "Constitutively phosphorylated Smad3 interacts with Sp1 and p300 in scleroderma fibroblasts.", "journal": "Rheumatology (Oxford, England)", "date": "2006", "authors": "Ihn H, Yamane K, Asano Y, Jinnin M, Tamaki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "16319104", "url": "https://glygen.org/publication/PubMed/16319104" } ] }, { "title": "Identification of extracellular signal-regulated kinase 3 as a new interaction partner of cyclin D3.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Sun M, Wei Y, Yao L, Xie J, Chen X, Wang H, Jiang J, Gu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "16360641", "url": "https://glygen.org/publication/PubMed/16360641" } ] }, { "title": "Here come the septins: novel polymers that coordinate intracellular functions and organization.", "journal": "Journal of cell science", "date": "2006", "authors": "Spiliotis ET, Nelson WJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "16371649", "url": "https://glygen.org/publication/PubMed/16371649" } ] }, { "title": "Persistent activation of stat3 signaling induces survivin gene expression and confers resistance to apoptosis in human breast cancer cells.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2006", "authors": "Gritsko T, Williams A, Turkson J, Kaneko S, Bowman T, Huang M, Nam S, Eweis I, Diaz N, Sullivan D, Yoder S, Enkemann S, Eschrich S, Lee JH, Beam CA, Cheng J, Minton S, Muro-Cacho CA, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16397018", "url": "https://glygen.org/publication/PubMed/16397018" } ] }, { "title": "Global identification of O-GlcNAc-modified proteins.", "journal": "Analytical chemistry", "date": "2006", "authors": "Nandi A, Sprung R, Barma DK, Zhao Y, Kim SC, Falck JR, Zhao Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P01106", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01106" } ], "reference": [ { "type": "PubMed", "id": "16408927", "url": "https://glygen.org/publication/PubMed/16408927" } ] }, { "title": "SOCS1: a potent and multifaceted regulator of cytokines and cell-mediated inflammation.", "journal": "Tissue antigens", "date": "2006", "authors": "Davey GM, Heath WR, Starr R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16451196", "url": "https://glygen.org/publication/PubMed/16451196" } ] }, { "title": "Cyclin D1 is transcriptionally regulated by and required for transformation by activated signal transducer and activator of transcription 3.", "journal": "Cancer research", "date": "2006", "authors": "Leslie K, Lang C, Devgan G, Azare J, Berishaj M, Gerald W, Kim YB, Paz K, Darnell JE, Albanese C, Sakamaki T, Pestell R, Bromberg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16510571", "url": "https://glygen.org/publication/PubMed/16510571" } ] }, { "title": "The APC tumor suppressor counteracts beta-catenin activation and H3K4 methylation at Wnt target genes.", "journal": "Genes & development", "date": "2006", "authors": "Sierra J, Yoshida T, Joazeiro CA, Jones KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-4411364", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4411364" } ], "reference": [ { "type": "PubMed", "id": "16510874", "url": "https://glygen.org/publication/PubMed/16510874" } ] }, { "title": "Structural basis for cooperativity in recruitment of MAML coactivators to Notch transcription complexes.", "journal": "Cell", "date": "2006", "authors": "Nam Y, Sliz P, Song L, Aster JC, Blacklow SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "16530044", "url": "https://glygen.org/publication/PubMed/16530044" } ] }, { "title": "Signaling mechanisms, interaction partners, and target genes of STAT6.", "journal": "Cytokine & growth factor reviews", "date": "2006", "authors": "Hebenstreit D, Wirnsberger G, Horejs-Hoeck J, Duschl A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16540365", "url": "https://glygen.org/publication/PubMed/16540365" } ] }, { "title": "Dual regulation of the anaphase promoting complex in human cells by cyclin A-Cdk2 and cyclin A-Cdk1 complexes.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2006", "authors": "Mitra J, Enders GH, Azizkhan-Clifford J, Lengel KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-69656", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69656" } ], "reference": [ { "type": "PubMed", "id": "16582612", "url": "https://glygen.org/publication/PubMed/16582612" } ] }, { "title": "Loss of SOCS3 in T helper cells resulted in reduced immune responses and hyperproduction of interleukin 10 and transforming growth factor-beta 1.", "journal": "The Journal of experimental medicine", "date": "2006", "authors": "Kinjyo I, Inoue H, Hamano S, Fukuyama S, Yoshimura T, Koga K, Takaki H, Himeno K, Takaesu G, Kobayashi T, Yoshimura A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16606674", "url": "https://glygen.org/publication/PubMed/16606674" } ] }, { "title": "Leukemia-associated mutations within the NOTCH1 heterodimerization domain fall into at least two distinct mechanistic classes.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Malecki MJ, Sanchez-Irizarry C, Mitchell JL, Histen G, Xu ML, Aster JC, Blacklow SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2894862", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2894862" } ], "reference": [ { "type": "PubMed", "id": "16738328", "url": "https://glygen.org/publication/PubMed/16738328" } ] }, { "title": "C/EBPbeta is required for 'emergency' granulopoiesis.", "journal": "Nature immunology", "date": "2006", "authors": "Hirai H, Zhang P, Dayaram T, Hetherington CJ, Mizuno S, Imanishi J, Akashi K, Tenen DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "16751774", "url": "https://glygen.org/publication/PubMed/16751774" } ] }, { "title": "Loss of SHP1 enhances JAK3/STAT3 signaling and decreases proteosome degradation of JAK3 and NPM-ALK in ALK+ anaplastic large-cell lymphoma.", "journal": "Blood", "date": "2006", "authors": "Han Y, Amin HM, Franko B, Frantz C, Shi X, Lai R", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "16825495", "url": "https://glygen.org/publication/PubMed/16825495" } ] }, { "title": "Restoration of shp1 expression by 5-AZA-2'-deoxycytidine is associated with downregulation of JAK3/STAT3 signaling in ALK-positive anaplastic large cell lymphoma.", "journal": "Leukemia", "date": "2006", "authors": "Han Y, Amin HM, Frantz C, Franko B, Lee J, Lin Q, Lai R", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "16871283", "url": "https://glygen.org/publication/PubMed/16871283" } ] }, { "title": "Recruitment of insulin receptor substrate-1 and activation of NF-kappaB essential for midkine growth signaling through anaplastic lymphoma kinase.", "journal": "Oncogene", "date": "2007", "authors": "Kuo AH, Stoica GE, Riegel AT, Wellstein A", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "16878150", "url": "https://glygen.org/publication/PubMed/16878150" } ] }, { "title": "A role for the deubiquitinating enzyme USP28 in control of the DNA-damage response.", "journal": "Cell", "date": "2006", "authors": "Zhang D, Zaugg K, Mak TW, Elledge SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "16901786", "url": "https://glygen.org/publication/PubMed/16901786" } ] }, { "title": "JSI-124 (cucurbitacin I) inhibits Janus kinase-3/signal transducer and activator of transcription-3 signalling, downregulates nucleophosmin-anaplastic lymphoma kinase (ALK), and induces apoptosis in ALK-positive anaplastic large cell lymphoma cells.", "journal": "British journal of haematology", "date": "2006", "authors": "Shi X, Franko B, Frantz C, Amin HM, Lai R", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "16939498", "url": "https://glygen.org/publication/PubMed/16939498" } ] }, { "title": "FOXO4 transcriptional activity is regulated by monoubiquitination and USP7/HAUSP.", "journal": "Nature cell biology", "date": "2006", "authors": "van der Horst A, de Vries-Smits AM, Brenkman AB, van Triest MH, van den Broek N, Colland F, Maurice MM, Burgering BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "16964248", "url": "https://glygen.org/publication/PubMed/16964248" } ] }, { "title": "Regulation of MAPK-activated protein kinase 5 activity and subcellular localization by the atypical MAPK ERK4/MAPK4.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Aberg E, Perander M, Johansen B, Julien C, Meloche S, Keyse SM, Seternes OM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "16971392", "url": "https://glygen.org/publication/PubMed/16971392" } ] }, { "title": "Characterization of the atypical MAPK ERK4 and its activation of the MAPK-activated protein kinase MK5.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Kant S, Schumacher S, Singh MK, Kispert A, Kotlyarov A, Gaestel M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "16973613", "url": "https://glygen.org/publication/PubMed/16973613" } ] }, { "title": "A cell-type-specific transcriptional network required for estrogen regulation of cyclin D1 and cell cycle progression in breast cancer.", "journal": "Genes & development", "date": "2006", "authors": "Eeckhoute J, Carroll JS, Geistlinger TR, Torres-Arzayus MI, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16980581", "url": "https://glygen.org/publication/PubMed/16980581" } ] }, { "title": "Neuralized-2 regulates a Notch ligand in cooperation with Mind bomb-1.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Song R, Koo BK, Yoon KJ, Yoon MJ, Yoo KW, Kim HT, Oh HJ, Kim YY, Han JK, Kim CH, Kong YY", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "17003037", "url": "https://glygen.org/publication/PubMed/17003037" } ] }, { "title": "Genome-wide analysis of estrogen receptor binding sites.", "journal": "Nature genetics", "date": "2006", "authors": "Carroll JS, Meyer CA, Song J, Li W, Geistlinger TR, Eeckhoute J, Brodsky AS, Keeton EK, Fertuck KC, Hall GF, Wang Q, Bekiranov S, Sementchenko V, Fox EA, Silver PA, Gingeras TR, Liu XS, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17013392", "url": "https://glygen.org/publication/PubMed/17013392" } ] }, { "title": "LEF-1 is crucial for neutrophil granulocytopoiesis and its expression is severely reduced in congenital neutropenia.", "journal": "Nature medicine", "date": "2006", "authors": "Skokowa J, Cario G, Uenalan M, Schambach A, Germeshausen M, Battmer K, Zeidler C, Lehmann U, Eder M, Baum C, Grosschedl R, Stanulla M, Scherr M, Welte K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "17063141", "url": "https://glygen.org/publication/PubMed/17063141" } ] }, { "title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.", "journal": "Cell", "date": "2006", "authors": "Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" }, { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" } ], "reference": [ { "type": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ] }, { "title": "Identification of multiple SNT-binding sites on NPM-ALK oncoprotein and their involvement in cell transformation.", "journal": "Oncogene", "date": "2007", "authors": "Chikamori M, Fujimoto J, Tokai-Nishizumi N, Yamamoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "17086210", "url": "https://glygen.org/publication/PubMed/17086210" } ] }, { "title": "NOTCH1 directly regulates c-MYC and activates a feed-forward-loop transcriptional network promoting leukemic cell growth.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Palomero T, Lim WK, Odom DT, Sulis ML, Real PJ, Margolin A, Barnes KC, O'Neil J, Neuberg D, Weng AP, Aster JC, Sigaux F, Soulier J, Look AT, Young RA, Califano A, Ferrando AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "17114293", "url": "https://glygen.org/publication/PubMed/17114293" } ] }, { "title": "Atypical mitogen-activated protein kinases: structure, regulation and functions.", "journal": "Biochimica et biophysica acta", "date": "2007", "authors": "Coulombe P, Meloche S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "17161475", "url": "https://glygen.org/publication/PubMed/17161475" } ] }, { "title": "Identification of NVP-TAE684, a potent, selective, and efficacious inhibitor of NPM-ALK.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Galkin AV, Melnick JS, Kim S, Hood TL, Li N, Li L, Xia G, Steensma R, Chopiuk G, Jiang J, Wan Y, Ding P, Liu Y, Sun F, Schultz PG, Gray NS, Warmuth M", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "17185414", "url": "https://glygen.org/publication/PubMed/17185414" } ] }, { "title": "PRAK is essential for ras-induced senescence and tumor suppression.", "journal": "Cell", "date": "2007", "authors": "Sun P, Yoshizuka N, New L, Moser BA, Li Y, Liao R, Xie C, Chen J, Deng Q, Yamout M, Dong MQ, Frangou CG, Yates JR 3rd, Wright PE, Han J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "17254968", "url": "https://glygen.org/publication/PubMed/17254968" } ] }, { "title": "ALK activation induces Shc and FRS2 recruitment: Signaling and phenotypic outcomes in PC12 cells differentiation.", "journal": "FEBS letters", "date": "2007", "authors": "Degoutin J, Vigny M, Gouzi JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "17274988", "url": "https://glygen.org/publication/PubMed/17274988" } ] }, { "title": "Cooperative demethylation by JMJD2C and LSD1 promotes androgen receptor-dependent gene expression.", "journal": "Nature cell biology", "date": "2007", "authors": "Wissmann M, Yin N, Muller JM, Greschik H, Fodor BD, Jenuwein T, Vogler C, Schneider R, Gunther T, Buettner R, Metzger E, Schule R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17277772", "url": "https://glygen.org/publication/PubMed/17277772" } ] }, { "title": "The deubiquitinating enzyme USP2a regulates the p53 pathway by targeting Mdm2.", "journal": "The EMBO journal", "date": "2007", "authors": "Stevenson LF, Sparks A, Allende-Vega N, Xirodimas DP, Lane DP, Saville MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "17290220", "url": "https://glygen.org/publication/PubMed/17290220" } ] }, { "title": "Identification of Myc-associated protein with JmjC domain as a novel therapeutic target oncogene for lung cancer.", "journal": "Mol. Cancer Ther.", "date": "2007", "authors": "Suzuki Chie, Takahashi Koji, Hayama Satoshi, Ishikawa Nobuhisa, Kato Tatsuya, Ito Tomoo, Tsuchiya Eiju, Nakamura Yusuke, Daigo Yataro", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "reference": [ { "type": "PubMed", "id": "17308053", "url": "https://glygen.org/publication/PubMed/17308053" } ] }, { "title": "The Trithorax group protein Lid is a trimethyl histone H3K4 demethylase required for dMyc-induced cell growth.", "journal": "Genes Dev.", "date": "2007", "authors": "Secombe J, Li L, Carlos L, Eisenman RN", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "reference": [ { "type": "PubMed", "id": "17311883", "url": "https://glygen.org/publication/PubMed/17311883" } ] }, { "title": "Oncogenic tyrosine kinase NPM/ALK induces activation of the rapamycin-sensitive mTOR signaling pathway.", "journal": "Oncogene", "date": "2007", "authors": "Marzec M, Kasprzycka M, Liu X, El-Salem M, Halasa K, Raghunath PN, Bucki R, Wlodarski P, Wasik MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "17353907", "url": "https://glygen.org/publication/PubMed/17353907" } ] }, { "title": "Myc deletion rescues Apc deficiency in the small intestine.", "journal": "Nature", "date": "2007", "authors": "Sansom OJ, Meniel VS, Muncan V, Phesse TJ, Wilkins JA, Reed KR, Vass JK, Athineos D, Clevers H, Clarke AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-4411364", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4411364" } ], "reference": [ { "type": "PubMed", "id": "17377531", "url": "https://glygen.org/publication/PubMed/17377531" } ] }, { "title": "Endothelial cell migration during angiogenesis.", "journal": "Circulation research", "date": "2007", "authors": "Lamalice L, Le Boeuf F, Huot J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "17395884", "url": "https://glygen.org/publication/PubMed/17395884" } ] }, { "title": "Structural basis for autoinhibition of Notch.", "journal": "Nature structural & molecular biology", "date": "2007", "authors": "Gordon WR, Vardar-Ulu D, Histen G, Sanchez-Irizarry C, Aster JC, Blacklow SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "17401372", "url": "https://glygen.org/publication/PubMed/17401372" } ] }, { "title": "Diverse effects of Stat1 on the regulation of hsp90alpha gene under heat shock.", "journal": "Journal of cellular biochemistry", "date": "2007", "authors": "Chen XS, Zhang Y, Wang JS, Li XY, Cheng XK, Zhang Y, Wu NH, Shen YF", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "17427945", "url": "https://glygen.org/publication/PubMed/17427945" } ] }, { "title": "Smad7 antagonizes transforming growth factor beta signaling in the nucleus by interfering with functional Smad-DNA complex formation.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Zhang S, Fei T, Zhang L, Zhang R, Chen F, Ning Y, Han Y, Feng XH, Meng A, Chen YG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "17438144", "url": "https://glygen.org/publication/PubMed/17438144" } ] }, { "title": "Anaphase initiation is regulated by antagonistic ubiquitination and deubiquitination activities.", "journal": "Nature", "date": "2007", "authors": "Stegmeier F, Rape M, Draviam VM, Nalepa G, Sowa ME, Ang XL, McDonald ER 3rd, Li MZ, Hannon GJ, Sorger PK, Kirschner MW, Harper JW, Elledge SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "17443180", "url": "https://glygen.org/publication/PubMed/17443180" } ] }, { "title": "IL-13 induces expression of CD36 in human monocytes through PPARgamma activation.", "journal": "European journal of immunology", "date": "2007", "authors": "Berry A, Balard P, Coste A, Olagnier D, Lagane C, Authier H, Benoit-Vical F, Lepert JC, Seguela JP, Magnaval JF, Chambon P, Metzger D, Desvergne B, Wahli W, Auwerx J, Pipy B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "17458857", "url": "https://glygen.org/publication/PubMed/17458857" } ] }, { "title": "Regulation of GREB1 transcription by estrogen receptor alpha through a multipartite enhancer spread over 20 kb of upstream flanking sequences.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Deschenes J, Bourdeau V, White JH, Mader S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17463000", "url": "https://glygen.org/publication/PubMed/17463000" } ] }, { "title": "A phosphorylation site located in the NH2-terminal domain of c-Myc increases transactivation of gene expression.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Seth A, Alvarez E, Gupta S, Davis RJ", "evidence": [ { "database": "iPTMnet", "id": "P01106-2", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106-2" } ], "reference": [ { "type": "PubMed", "id": "1748630", "url": "https://glygen.org/publication/PubMed/1748630" } ] }, { "title": "The DEAD-box p68/p72 proteins and the noncoding RNA steroid receptor activator SRA: eclectic regulators of disparate biological functions.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2007", "authors": "Caretti G, Lei EP, Sartorelli V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17495528", "url": "https://glygen.org/publication/PubMed/17495528" } ] }, { "title": "Novel estrogen receptor-alpha binding sites and estradiol target genes identified by chromatin immunoprecipitation cloning in breast cancer.", "journal": "Cancer research", "date": "2007", "authors": "Lin Z, Reierstad S, Huang CC, Bulun SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17510434", "url": "https://glygen.org/publication/PubMed/17510434" } ] }, { "title": "Evolutionarily conserved multisubunit RBL2/p130 and E2F4 protein complex represses human cell cycle-dependent genes in quiescence.", "journal": "Molecular cell", "date": "2007", "authors": "Litovchick L, Sadasivam S, Florens L, Zhu X, Swanson SK, Velmurugan S, Chen R, Washburn MP, Liu XS, DeCaprio JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362277", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362277" } ], "reference": [ { "type": "PubMed", "id": "17531812", "url": "https://glygen.org/publication/PubMed/17531812" } ] }, { "title": "The ubiquitin-specific protease USP28 is required for MYC stability.", "journal": "Nature cell biology", "date": "2007", "authors": "Popov N, Wanzel M, Madiredjo M, Zhang D, Beijersbergen R, Bernards R, Moll R, Elledge SJ, Eilers M", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" }, { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" } ], "reference": [ { "type": "PubMed", "id": "17558397", "url": "https://glygen.org/publication/PubMed/17558397" } ] }, { "title": "PML-retinoic acid receptor alpha inhibits PML IV enhancement of PU.1-induced C/EBPepsilon expression in myeloid differentiation.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Yoshida H, Ichikawa H, Tagata Y, Katsumoto T, Ohnishi K, Akao Y, Naoe T, Pandolfi PP, Kitabayashi I", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "17562868", "url": "https://glygen.org/publication/PubMed/17562868" } ] }, { "title": "Fra-1 and Stat3 synergistically regulate activation of human MMP-9 gene.", "journal": "Molecular immunology", "date": "2008", "authors": "Song Y, Qian L, Song S, Chen L, Zhang Y, Yuan G, Zhang H, Xia Q, Hu M, Yu M, Shi M, Jiang Z, Guo N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "17572495", "url": "https://glygen.org/publication/PubMed/17572495" } ] }, { "title": "CIP2A inhibits PP2A in human malignancies.", "journal": "Cell", "date": "2007", "authors": "Junttila MR, Puustinen P, Niemela M, Ahola R, Arnold H, Bottzauw T, Ala-aho R, Nielsen C, Ivaska J, Taya Y, Lu SL, Lin S, Chan EK, Wang XJ, Grenman R, Kast J, Kallunki T, Sears R, Kahari VM, Westermarck J", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "reference": [ { "type": "PubMed", "id": "17632056", "url": "https://glygen.org/publication/PubMed/17632056" } ] }, { "title": "The AP-1 transcription factor regulates breast cancer cell growth via cyclins and E2F factors.", "journal": "Oncogene", "date": "2008", "authors": "Shen Q, Uray IP, Li Y, Krisko TI, Strecker TE, Kim HT, Brown PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17637753", "url": "https://glygen.org/publication/PubMed/17637753" } ] }, { "title": "The SCFFBW7 ubiquitin ligase complex as a tumor suppressor in T cell leukemia.", "journal": "The Journal of experimental medicine", "date": "2007", "authors": "Thompson BJ, Buonamici S, Sulis ML, Palomero T, Vilimas T, Basso G, Ferrando A, Aifantis I", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "17646408", "url": "https://glygen.org/publication/PubMed/17646408" } ] }, { "title": "FBW7 mutations in leukemic cells mediate NOTCH pathway activation and resistance to gamma-secretase inhibitors.", "journal": "The Journal of experimental medicine", "date": "2007", "authors": "O'Neil J, Grim J, Strack P, Rao S, Tibbitts D, Winter C, Hardwick J, Welcker M, Meijerink JP, Pieters R, Draetta G, Sears R, Clurman BE, Look AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "17646409", "url": "https://glygen.org/publication/PubMed/17646409" } ] }, { "title": "Long-range activation of GREB1 by estrogen receptor via three distal consensus estrogen-responsive elements in breast cancer cells.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2007", "authors": "Sun J, Nawaz Z, Slingerland JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17666587", "url": "https://glygen.org/publication/PubMed/17666587" } ] }, { "title": "Anaplastic lymphoma kinase is activated through the pleiotrophin/receptor protein-tyrosine phosphatase beta/zeta signaling pathway: an alternative mechanism of receptor tyrosine kinase activation.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Perez-Pinera P, Zhang W, Chang Y, Vega JA, Deuel TF", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "17681947", "url": "https://glygen.org/publication/PubMed/17681947" } ] }, { "title": "Mechanism of and requirement for estrogen-regulated MYB expression in estrogen-receptor-positive breast cancer cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Drabsch Y, Hugo H, Zhang R, Dowhan DH, Miao YR, Gewirtz AM, Barry SC, Ramsay RG, Gonda TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17690249", "url": "https://glygen.org/publication/PubMed/17690249" } ] }, { "title": "14-3-3epsilon inhibits MK5-mediated cell migration by disrupting F-actin polymerization.", "journal": "Cellular signalling", "date": "2007", "authors": "Tak H, Jang E, Kim SB, Park J, Suk J, Yoon YS, Ahn JK, Lee JH, Joe CO", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "17728103", "url": "https://glygen.org/publication/PubMed/17728103" } ] }, { "title": "Fbw7 and Usp28 regulate myc protein stability in response to DNA damage.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2007", "authors": "Popov N, Herold S, Llamazares M, Schulein C, Eilers M", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" }, { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "17873522", "url": "https://glygen.org/publication/PubMed/17873522" } ] }, { "title": "Differential control of Wnt target genes involves epigenetic mechanisms and selective promoter occupancy by T-cell factors.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Wohrle S, Wallmen B, Hecht A", "evidence": [ { "database": "Reactome", "id": "R-HSA-4411364", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4411364" } ], "reference": [ { "type": "PubMed", "id": "17923689", "url": "https://glygen.org/publication/PubMed/17923689" } ] }, { "title": "Modulation of F-actin rearrangement by the cyclic AMP/cAMP-dependent protein kinase (PKA) pathway is mediated by MAPK-activated protein kinase 5 and requires PKA-induced nuclear export of MK5.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Gerits N, Mikalsen T, Kostenko S, Shiryaev A, Johannessen M, Moens U", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "17947239", "url": "https://glygen.org/publication/PubMed/17947239" } ] }, { "title": "Human USP3 is a chromatin modifier required for S phase progression and genome stability.", "journal": "Current biology : CB", "date": "2007", "authors": "Nicassio F, Corrado N, Vissers JH, Areces LB, Bergink S, Marteijn JA, Geverts B, Houtsmuller AB, Vermeulen W, Di Fiore PP, Citterio E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "17980597", "url": "https://glygen.org/publication/PubMed/17980597" } ] }, { "title": "Regulation of early wave of germ cell apoptosis and spermatogenesis by deubiquitinating enzyme CYLD.", "journal": "Developmental cell", "date": "2007", "authors": "Wright A, Reiley WW, Chang M, Jin W, Lee AJ, Zhang M, Sun SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "17981138", "url": "https://glygen.org/publication/PubMed/17981138" } ] }, { "title": "Kalirin-7 controls activity-dependent structural and functional plasticity of dendritic spines.", "journal": "Neuron", "date": "2007", "authors": "Xie Z, Srivastava DP, Photowala H, Kai L, Cahill ME, Woolfrey KM, Shum CY, Surmeier DJ, Penzes P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "18031682", "url": "https://glygen.org/publication/PubMed/18031682" } ] }, { "title": "Induction of pluripotent stem cells from adult human fibroblasts by defined factors.", "journal": "Cell", "date": "2007", "authors": "Takahashi K, Tanabe K, Ohnuki M, Narita M, Ichisaka T, Tomoda K, Yamanaka S", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "reference": [ { "type": "PubMed", "id": "18035408", "url": "https://glygen.org/publication/PubMed/18035408" } ] }, { "title": "An obligatory role of mind bomb-1 in notch signaling of mammalian development.", "journal": "PloS one", "date": "2007", "authors": "Koo BK, Yoon MJ, Yoon KJ, Im SK, Kim YY, Kim CH, Suh PG, Jan YN, Kong YY", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "18043734", "url": "https://glygen.org/publication/PubMed/18043734" } ] }, { "title": "Characterization of some molecular mechanisms governing autoactivation of the catalytic domain of the anaplastic lymphoma kinase.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Tartari CJ, Gunby RH, Coluccia AM, Sottocornola R, Cimbro B, Scapozza L, Donella-Deana A, Pinna LA, Gambacorti-Passerini C", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "18070884", "url": "https://glygen.org/publication/PubMed/18070884" } ] }, { "title": "Neuralized-like 1 (Neurl1) targeted to the plasma membrane by N-myristoylation regulates the Notch ligand Jagged1.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Koutelou E, Sato S, Tomomori-Sato C, Florens L, Swanson SK, Washburn MP, Kokkinaki M, Conaway RC, Conaway JW, Moschonas NK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "18077452", "url": "https://glygen.org/publication/PubMed/18077452" } ] }, { "title": "FBW7 ubiquitin ligase: a tumour suppressor at the crossroads of cell division, growth and differentiation.", "journal": "Nature reviews. Cancer", "date": "2008", "authors": "Welcker M, Clurman BE", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "18094723", "url": "https://glygen.org/publication/PubMed/18094723" } ] }, { "title": "The anaplastic lymphoma kinase in the pathogenesis of cancer.", "journal": "Nature reviews. Cancer", "date": "2008", "authors": "Chiarle R, Voena C, Ambrogio C, Piva R, Inghirami G", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "18097461", "url": "https://glygen.org/publication/PubMed/18097461" } ] }, { "title": "Proto-oncogene ACTR/AIB1 promotes cancer cell invasion by up-regulating specific matrix metalloproteinase expression.", "journal": "Cancer letters", "date": "2008", "authors": "Li LB, Louie MC, Chen HW, Zou JX", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "18162290", "url": "https://glygen.org/publication/PubMed/18162290" } ] }, { "title": "Deubiquitylation of histone H2A activates transcriptional initiation via trans-histone cross-talk with H3K4 di- and trimethylation.", "journal": "Genes & development", "date": "2008", "authors": "Nakagawa T, Kajitani T, Togo S, Masuko N, Ohdan H, Hishikawa Y, Koji T, Matsuyama T, Ikura T, Muramatsu M, Ito T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "18172164", "url": "https://glygen.org/publication/PubMed/18172164" } ] }, { "title": "DNA oxidation as triggered by H3K9me2 demethylation drives estrogen-induced gene expression.", "journal": "Science (New York, N.Y.)", "date": "2008", "authors": "Perillo B, Ombra MN, Bertoni A, Cuozzo C, Sacchetti S, Sasso A, Chiariotti L, Malorni A, Abbondanza C, Avvedimento EV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18187655", "url": "https://glygen.org/publication/PubMed/18187655" } ] }, { "title": "Cohesins localize with CTCF at the KSHV latency control region and at cellular c-myc and H19/Igf2 insulators.", "journal": "The EMBO journal", "date": "2008", "authors": "Stedman W, Kang H, Lin S, Kissil JL, Bartolomei MS, Lieberman PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18219272", "url": "https://glygen.org/publication/PubMed/18219272" } ] }, { "title": "A functional link between the human cell cycle-regulatory phosphatase Cdc14A and the atypical mitogen-activated kinase Erk3.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2008", "authors": "Hansen CA, Bartek J, Jensen S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "18235225", "url": "https://glygen.org/publication/PubMed/18235225" } ] }, { "title": "Molecular and structural basis of cytokine receptor pleiotropy in the interleukin-4/13 system.", "journal": "Cell", "date": "2008", "authors": "LaPorte SL, Juo ZS, Vaclavikova J, Colf LA, Qi X, Heller NM, Keegan AD, Garcia KC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18243101", "url": "https://glygen.org/publication/PubMed/18243101" } ] }, { "title": "The Ser(186) phospho-acceptor site within ERK4 is essential for its ability to interact with and activate PRAK/MK5.", "journal": "The Biochemical journal", "date": "2008", "authors": "Perander M, Aberg E, Johansen B, Dreyer B, Guldvik IJ, Outzen H, Keyse SM, Seternes OM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "18248330", "url": "https://glygen.org/publication/PubMed/18248330" } ] }, { "title": "Genome-wide mapping and characterization of hypomethylated sites in human tissues and breast cancer cell lines.", "journal": "Genome research", "date": "2008", "authors": "Shann YJ, Cheng C, Chiao CH, Chen DT, Li PH, Hsu MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18256232", "url": "https://glygen.org/publication/PubMed/18256232" } ] }, { "title": "Localization of the delta-like-1-binding site in human Notch-1 and its modulation by calcium affinity.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Cordle J, Redfieldz C, Stacey M, van der Merwe PA, Willis AC, Champion BR, Hambleton S, Handford PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "18296446", "url": "https://glygen.org/publication/PubMed/18296446" } ] }, { "title": "Transient cyclical methylation of promoter DNA.", "journal": "Nature", "date": "2008", "authors": "Kangaspeska S, Stride B, Metivier R, Polycarpou-Schwarz M, Ibberson D, Carmouche RP, Benes V, Gannon F, Reid G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18322535", "url": "https://glygen.org/publication/PubMed/18322535" } ] }, { "title": "Twist is transcriptionally induced by activation of STAT3 and mediates STAT3 oncogenic function.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Cheng GZ, Zhang WZ, Sun M, Wang Q, Coppola D, Mansour M, Xu LM, Costanzo C, Cheng JQ, Wang LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18353781", "url": "https://glygen.org/publication/PubMed/18353781" } ] }, { "title": "FoxA1 translates epigenetic signatures into enhancer-driven lineage-specific transcription.", "journal": "Cell", "date": "2008", "authors": "Lupien M, Eeckhoute J, Meyer CA, Wang Q, Zhang Y, Li W, Carroll JS, Liu XS, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18358809", "url": "https://glygen.org/publication/PubMed/18358809" } ] }, { "title": "TBL1 and TBLR1 phosphorylation on regulated gene promoters overcomes dual CtBP and NCoR/SMRT transcriptional repression checkpoints.", "journal": "Molecular cell", "date": "2008", "authors": "Perissi V, Scafoglio C, Zhang J, Ohgi KA, Rose DW, Glass CK, Rosenfeld MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "18374649", "url": "https://glygen.org/publication/PubMed/18374649" } ] }, { "title": "Pim kinase-dependent inhibition of c-Myc degradation.", "journal": "Oncogene", "date": "2008", "authors": "Zhang Y, Wang Z, Li X, Magnuson NS", "evidence": [ { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" } ], "reference": [ { "type": "PubMed", "id": "18438430", "url": "https://glygen.org/publication/PubMed/18438430" } ] }, { "title": "Regulation of Sox2 by STAT3 initiates commitment to the neural precursor cell fate.", "journal": "Stem cells and development", "date": "2008", "authors": "Foshay KM, Gallicano GI", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18447642", "url": "https://glygen.org/publication/PubMed/18447642" } ] }, { "title": "Regulation of IkappaB kinase-related kinases and antiviral responses by tumor suppressor CYLD.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Zhang M, Wu X, Lee AJ, Jin W, Chang M, Wright A, Imaizumi T, Sun SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "18467330", "url": "https://glygen.org/publication/PubMed/18467330" } ] }, { "title": "Estrogen and MYB in breast cancer: potential for new therapies.", "journal": "Expert opinion on biological therapy", "date": "2008", "authors": "Gonda TJ, Leo P, Ramsay RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18476782", "url": "https://glygen.org/publication/PubMed/18476782" } ] }, { "title": "Meta-analysis of human cancer microarrays reveals GATA3 is integral to the estrogen receptor alpha pathway.", "journal": "Molecular cancer", "date": "2008", "authors": "Wilson BJ, Giguere V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18533032", "url": "https://glygen.org/publication/PubMed/18533032" } ] }, { "title": "TAZ controls Smad nucleocytoplasmic shuttling and regulates human embryonic stem-cell self-renewal.", "journal": "Nature cell biology", "date": "2008", "authors": "Varelas X, Sakuma R, Samavarchi-Tehrani P, Peerani R, Rao BM, Dembowy J, Yaffe MB, Zandstra PW, Wrana JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "18568018", "url": "https://glygen.org/publication/PubMed/18568018" } ] }, { "title": "C-Myc is a critical mediator of the phenotypes of Apc loss in the intestine.", "journal": "Cancer research", "date": "2008", "authors": "Wilkins JA, Sansom OJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-4411364", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4411364" } ], "reference": [ { "type": "PubMed", "id": "18593890", "url": "https://glygen.org/publication/PubMed/18593890" } ] }, { "title": "Steroid receptor coactivator-3/AIB1 promotes cell migration and invasiveness through focal adhesion turnover and matrix metalloproteinase expression.", "journal": "Cancer research", "date": "2008", "authors": "Yan J, Erdem H, Li R, Cai Y, Ayala G, Ittmann M, Yu-Lee LY, Tsai SY, Tsai MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "18593949", "url": "https://glygen.org/publication/PubMed/18593949" } ] }, { "title": "Vasopressin-inducible ubiquitin-specific protease 10 increases ENaC cell surface expression by deubiquitylating and stabilizing sorting nexin 3.", "journal": "American journal of physiology. Renal physiology", "date": "2008", "authors": "Boulkroun S, Ruffieux-Daidie D, Vitagliano JJ, Poirot O, Charles RP, Lagnaz D, Firsov D, Kellenberger S, Staub O", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "18632802", "url": "https://glygen.org/publication/PubMed/18632802" } ] }, { "title": "The tumour suppressor CYLD is a negative regulator of RIG-I-mediated antiviral response.", "journal": "EMBO reports", "date": "2008", "authors": "Friedman CS, O'Donnell MA, Legarda-Addison D, Ng A, Cardenas WB, Yount JS, Moran TM, Basler CF, Komuro A, Horvath CM, Xavier R, Ting AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "18636086", "url": "https://glygen.org/publication/PubMed/18636086" } ] }, { "title": "The AIB1 oncogene promotes breast cancer metastasis by activation of PEA3-mediated matrix metalloproteinase 2 (MMP2) and MMP9 expression.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Qin L, Liao L, Redmond A, Young L, Yuan Y, Chen H, O'Malley BW, Xu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "18644862", "url": "https://glygen.org/publication/PubMed/18644862" } ] }, { "title": "Signal transducer and activator of transcription 3 is required for hypoxia-inducible factor-1alpha RNA expression in both tumor cells and tumor-associated myeloid cells.", "journal": "Molecular cancer research : MCR", "date": "2008", "authors": "Niu G, Briggs J, Deng J, Ma Y, Lee H, Kortylewski M, Kujawski M, Kay H, Cress WD, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18644974", "url": "https://glygen.org/publication/PubMed/18644974" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" }, { "database": "iPTMnet", "id": "P01106-2", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106-2" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Activation loop phosphorylation of the atypical MAP kinases ERK3 and ERK4 is required for binding, activation and cytoplasmic relocalization of MK5.", "journal": "Journal of cellular physiology", "date": "2008", "authors": "Deleris P, Rousseau J, Coulombe P, Rodier G, Tanguay PL, Meloche S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "18720373", "url": "https://glygen.org/publication/PubMed/18720373" } ] }, { "title": "Identification of ALK as a major familial neuroblastoma predisposition gene.", "journal": "Nature", "date": "2008", "authors": "Mosse YP, Laudenslager M, Longo L, Cole KA, Wood A, Attiyeh EF, Laquaglia MJ, Sennett R, Lynch JE, Perri P, Laureys G, Speleman F, Kim C, Hou C, Hakonarson H, Torkamani A, Schork NJ, Brodeur GM, Tonini GP, Rappaport E, Devoto M, Maris JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "18724359", "url": "https://glygen.org/publication/PubMed/18724359" } ] }, { "title": "Cathepsin D: a cellular roadmap.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Zaidi N, Maurer A, Nieke S, Kalbacher H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18762174", "url": "https://glygen.org/publication/PubMed/18762174" } ] }, { "title": "Successive and selective release of phosphorylated peptides captured by hydroxy acid-modified metal oxide chromatography.", "journal": "Journal of proteome research", "date": "2008", "authors": "Kyono Y, Sugiyama N, Imami K, Tomita M, Ishihama Y", "evidence": [ { "database": "iPTMnet", "id": "P01106-2", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106-2" } ], "reference": [ { "type": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" } ] }, { "title": "RUNX3 attenuates beta-catenin/T cell factors in intestinal tumorigenesis.", "journal": "Cancer cell", "date": "2008", "authors": "Ito K, Lim AC, Salto-Tellez M, Motoda L, Osato M, Chuang LS, Lee CW, Voon DC, Koo JK, Wang H, Fukamachi H, Ito Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951430", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951430" } ], "reference": [ { "type": "PubMed", "id": "18772112", "url": "https://glygen.org/publication/PubMed/18772112" } ] }, { "title": "C/EBPalpha and C/EBPvarepsilon induce the monocytic differentiation of myelomonocytic cells with the MLL-chimeric fusion gene.", "journal": "Oncogene", "date": "2008", "authors": "Matsushita H, Nakajima H, Nakamura Y, Tsukamoto H, Tanaka Y, Jin G, Yabe M, Asai S, Ono R, Nosaka T, Sugita K, Morimoto A, Hayashi Y, Hotta T, Ando K, Miyachi H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "18776924", "url": "https://glygen.org/publication/PubMed/18776924" } ] }, { "title": "Marking time: the dynamic role of chromatin and covalent modification in transcription.", "journal": "The international journal of biochemistry & cell biology", "date": "2009", "authors": "Reid G, Gallais R, Metivier R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18805503", "url": "https://glygen.org/publication/PubMed/18805503" } ] }, { "title": "Delta-like 4 is indispensable in thymic environment specific for T cell development.", "journal": "The Journal of experimental medicine", "date": "2008", "authors": "Hozumi K, Mailhos C, Negishi N, Hirano K, Yahata T, Ando K, Zuklys S, Hollander GA, Shima DT, Habu S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "18824583", "url": "https://glygen.org/publication/PubMed/18824583" } ] }, { "title": "Delta-like 4 is the essential, nonredundant ligand for Notch1 during thymic T cell lineage commitment.", "journal": "The Journal of experimental medicine", "date": "2008", "authors": "Koch U, Fiorini E, Benedito R, Besseyrias V, Schuster-Gossler K, Pierres M, Manley NR, Duarte A, Macdonald HR, Radtke F", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "18824585", "url": "https://glygen.org/publication/PubMed/18824585" } ] }, { "title": "Oncogenic mutations of ALK kinase in neuroblastoma.", "journal": "Nature", "date": "2008", "authors": "Chen Y, Takita J, Choi YL, Kato M, Ohira M, Sanada M, Wang L, Soda M, Kikuchi A, Igarashi T, Nakagawara A, Hayashi Y, Mano H, Ogawa S", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "18923524", "url": "https://glygen.org/publication/PubMed/18923524" } ] }, { "title": "High incidence of DNA mutations and gene amplifications of the ALK gene in advanced sporadic neuroblastoma tumours.", "journal": "The Biochemical journal", "date": "2008", "authors": "Caren H, Abel F, Kogner P, Martinsson T", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "18990089", "url": "https://glygen.org/publication/PubMed/18990089" } ] }, { "title": "CXXC5 is a novel BMP4-regulated modulator of Wnt signaling in neural stem cells.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Andersson T, Sodersten E, Duckworth JK, Cascante A, Fritz N, Sacchetti P, Cervenka I, Bryja V, Hermanson O", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19001364", "url": "https://glygen.org/publication/PubMed/19001364" } ] }, { "title": "USP19 deubiquitinating enzyme supports cell proliferation by stabilizing KPC1, a ubiquitin ligase for p27Kip1.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Lu Y, Adegoke OA, Nepveu A, Nakayama KI, Bedard N, Cheng D, Peng J, Wing SS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19015242", "url": "https://glygen.org/publication/PubMed/19015242" } ] }, { "title": "Transcriptional regulation of the cyclin D1 gene at a glance.", "journal": "Journal of cell science", "date": "2008", "authors": "Klein EA, Assoian RK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19020303", "url": "https://glygen.org/publication/PubMed/19020303" } ] }, { "title": "The lysine demethylase LSD1 (KDM1) is required for maintenance of global DNA methylation.", "journal": "Nature genetics", "date": "2009", "authors": "Wang J, Hevi S, Kurash JK, Lei H, Gay F, Bajko J, Su H, Sun W, Chang H, Xu G, Gaudet F, Li E, Chen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19098913", "url": "https://glygen.org/publication/PubMed/19098913" } ] }, { "title": "Mechanism of interferon-gamma mediated down-regulation of interleukin-10 gene expression.", "journal": "Molecular immunology", "date": "2009", "authors": "Schaefer A, Unterberger C, Frankenberger M, Lohrum M, Staples KJ, Werner T, Stunnenberg H, Ziegler-Heitbrock L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "19124156", "url": "https://glygen.org/publication/PubMed/19124156" } ] }, { "title": "FAM/USP9x, a deubiquitinating enzyme essential for TGFbeta signaling, controls Smad4 monoubiquitination.", "journal": "Cell", "date": "2009", "authors": "Dupont S, Mamidi A, Cordenonsi M, Montagner M, Zacchigna L, Adorno M, Martello G, Stinchfield MJ, Soligo S, Morsut L, Inui M, Moro S, Modena N, Argenton F, Newfeld SJ, Piccolo S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19135894", "url": "https://glygen.org/publication/PubMed/19135894" } ] }, { "title": "The prolyl-isomerase Pin1 is a Notch1 target that enhances Notch1 activation in cancer.", "journal": "Nature cell biology", "date": "2009", "authors": "Rustighi A, Tiberi L, Soldano A, Napoli M, Nuciforo P, Rosato A, Kaplan F, Capobianco A, Pece S, Di Fiore PP, Del Sal G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "19151708", "url": "https://glygen.org/publication/PubMed/19151708" } ] }, { "title": "PKA-induced F-actin rearrangement requires phosphorylation of Hsp27 by the MAPKAP kinase MK5.", "journal": "Cellular signalling", "date": "2009", "authors": "Kostenko S, Johannessen M, Moens U", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "19166925", "url": "https://glygen.org/publication/PubMed/19166925" } ] }, { "title": "Regulation of the IL-23 and IL-12 balance by Stat3 signaling in the tumor microenvironment.", "journal": "Cancer cell", "date": "2009", "authors": "Kortylewski M, Xin H, Kujawski M, Lee H, Liu Y, Harris T, Drake C, Pardoll D, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "19185846", "url": "https://glygen.org/publication/PubMed/19185846" } ] }, { "title": "USP17 regulates Ras activation and cell proliferation by blocking RCE1 activity.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Burrows JF, Kelvin AA, McFarlane C, Burden RE, McGrattan MJ, De la Vega M, Govender U, Quinn DJ, Dib K, Gadina M, Scott CJ, Johnston JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19188362", "url": "https://glygen.org/publication/PubMed/19188362" } ] }, { "title": "Breast cancer, estrogen receptor and ligands.", "journal": "Archiv der Pharmazie", "date": "2009", "authors": "Bai Z, Gust R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19274700", "url": "https://glygen.org/publication/PubMed/19274700" } ] }, { "title": "Histone modifications at human enhancers reflect global cell-type-specific gene expression.", "journal": "Nature", "date": "2009", "authors": "Heintzman ND, Hon GC, Hawkins RD, Kheradpour P, Stark A, Harp LF, Ye Z, Lee LK, Stuart RK, Ching CW, Ching KA, Antosiewicz-Bourget JE, Liu H, Zhang X, Green RD, Lobanenkov VV, Stewart R, Thomson JA, Crawford GE, Kellis M, Ren B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19295514", "url": "https://glygen.org/publication/PubMed/19295514" } ] }, { "title": "Genomic responses from the estrogen-responsive element-dependent signaling pathway mediated by estrogen receptor alpha are required to elicit cellular alterations.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Nott SL, Huang Y, Li X, Fluharty BR, Qiu X, Welshons WV, Yeh S, Muyan M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19321454", "url": "https://glygen.org/publication/PubMed/19321454" } ] }, { "title": "Beta-arrestin-dependent signaling and trafficking of 7-transmembrane receptors is reciprocally regulated by the deubiquitinase USP33 and the E3 ligase Mdm2.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Shenoy SK, Modi AS, Shukla AK, Xiao K, Berthouze M, Ahn S, Wilkinson KD, Miller WE, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19363159", "url": "https://glygen.org/publication/PubMed/19363159" } ] }, { "title": "E2-mediated cathepsin D (CTSD) activation involves looping of distal enhancer elements.", "journal": "Molecular oncology", "date": "2008", "authors": "Bretschneider N, Kangaspeska S, Seifert M, Reid G, Gannon F, Denger S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19383337", "url": "https://glygen.org/publication/PubMed/19383337" } ] }, { "title": "The RhoU/Wrch1 Rho GTPase gene is a common transcriptional target of both the gp130/STAT3 and Wnt-1 pathways.", "journal": "The Biochemical journal", "date": "2009", "authors": "Schiavone D, Dewilde S, Vallania F, Turkson J, Di Cunto F, Poli V", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "19397496", "url": "https://glygen.org/publication/PubMed/19397496" } ] }, { "title": "The deubiquitinating enzyme USP10 regulates the post-endocytic sorting of cystic fibrosis transmembrane conductance regulator in airway epithelial cells.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Bomberger JM, Barnaby RL, Stanton BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19398555", "url": "https://glygen.org/publication/PubMed/19398555" } ] }, { "title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.", "journal": "Analytical chemistry", "date": "2009", "authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S", "evidence": [ { "database": "iPTMnet", "id": "P01106-2", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106-2" } ], "reference": [ { "type": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ] }, { "title": "The deubiquitinases USP33 and USP20 coordinate beta2 adrenergic receptor recycling and resensitization.", "journal": "The EMBO journal", "date": "2009", "authors": "Berthouze M, Venkataramanan V, Li Y, Shenoy SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19424180", "url": "https://glygen.org/publication/PubMed/19424180" } ] }, { "title": "Anaplastic lymphoma kinase: signalling in development and disease.", "journal": "The Biochemical journal", "date": "2009", "authors": "Palmer RH, Vernersson E, Grabbe C, Hallberg B", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "19459784", "url": "https://glygen.org/publication/PubMed/19459784" } ] }, { "title": "Docking of PRAK/MK5 to the atypical MAPKs ERK3 and ERK4 defines a novel MAPK interaction motif.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Aberg E, Torgersen KM, Johansen B, Keyse SM, Perander M, Seternes OM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "19473979", "url": "https://glygen.org/publication/PubMed/19473979" } ] }, { "title": "Involvement of Rac/Cdc42/PAK pathway in cytoskeletal rearrangements.", "journal": "Acta biochimica Polonica", "date": "2009", "authors": "Szczepanowska J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "19513348", "url": "https://glygen.org/publication/PubMed/19513348" } ] }, { "title": "The notch ligands Dll4 and Jagged1 have opposing effects on angiogenesis.", "journal": "Cell", "date": "2009", "authors": "Benedito R, Roca C, Sorensen I, Adams S, Gossler A, Fruttiger M, Adams RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "19524514", "url": "https://glygen.org/publication/PubMed/19524514" } ] }, { "title": "Telomerase modulates Wnt signalling by association with target gene chromatin.", "journal": "Nature", "date": "2009", "authors": "Park JI, Venteicher AS, Hong JY, Choi J, Jun S, Shkreli M, Chang W, Meng Z, Cheung P, Ji H, McLaughlin M, Veenstra TD, Nusse R, McCrea PD, Artandi SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-4411364", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4411364" } ], "reference": [ { "type": "PubMed", "id": "19571879", "url": "https://glygen.org/publication/PubMed/19571879" } ] }, { "title": "Heat shock protein 27 phosphorylation: kinases, phosphatases, functions and pathology.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2009", "authors": "Kostenko S, Moens U", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "19593530", "url": "https://glygen.org/publication/PubMed/19593530" } ] }, { "title": "Lysine acetylation targets protein complexes and co-regulates major cellular functions.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "reference": [ { "type": "PubMed", "id": "19608861", "url": "https://glygen.org/publication/PubMed/19608861" } ] }, { "title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Pan C, Olsen JV, Daub H, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P01106-2", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106-2" } ], "reference": [ { "type": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ] }, { "title": "Phosphorylation dynamics during early differentiation of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Van Hoof D, Munoz J, Braam SR, Pinkse MW, Linding R, Heck AJ, Mummery CL, Krijgsveld J", "evidence": [ { "database": "iPTMnet", "id": "P01106-2", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106-2" } ], "reference": [ { "type": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" } ] }, { "title": "The DEAD-box protein p72 regulates ERalpha-/oestrogen-dependent transcription and cell growth, and is associated with improved survival in ERalpha-positive breast cancer.", "journal": "Oncogene", "date": "2009", "authors": "Wortham NC, Ahamed E, Nicol SM, Thomas RS, Periyasamy M, Jiang J, Ochocka AM, Shousha S, Huson L, Bray SE, Coombes RC, Ali S, Fuller-Pace FV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19718048", "url": "https://glygen.org/publication/PubMed/19718048" } ] }, { "title": "Metalloprotease ADAM10 is required for Notch1 site 2 cleavage.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "van Tetering G, van Diest P, Verlaan I, van der Wall E, Kopan R, Vooijs M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "19726682", "url": "https://glygen.org/publication/PubMed/19726682" } ] }, { "title": "AP-2gamma promotes proliferation in breast tumour cells by direct repression of the CDKN1A gene.", "journal": "The EMBO journal", "date": "2009", "authors": "Williams CM, Scibetta AG, Friedrich JK, Canosa M, Berlato C, Moss CH, Hurst HC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866911", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866911" } ], "reference": [ { "type": "PubMed", "id": "19798054", "url": "https://glygen.org/publication/PubMed/19798054" } ] }, { "title": "MdmX is a substrate for the deubiquitinating enzyme USP2a.", "journal": "Oncogene", "date": "2010", "authors": "Allende-Vega N, Sparks A, Lane DP, Saville MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19838211", "url": "https://glygen.org/publication/PubMed/19838211" } ] }, { "title": "USP11 negatively regulates TNFalpha-induced NF-kappaB activation by targeting on IkappaBalpha.", "journal": "Cellular signalling", "date": "2010", "authors": "Sun W, Tan X, Shi Y, Xu G, Mao R, Gu X, Fan Y, Yu Y, Burlingame S, Zhang H, Rednam SP, Lu X, Zhang T, Fu S, Cao G, Qin J, Yang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19874889", "url": "https://glygen.org/publication/PubMed/19874889" } ] }, { "title": "Ubiquitin-specific peptidase 21 inhibits tumor necrosis factor alpha-induced nuclear factor kappaB activation via binding to and deubiquitinating receptor-interacting protein 1.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Xu G, Tan X, Wang H, Sun W, Shi Y, Burlingame S, Gu X, Cao G, Zhang T, Qin J, Yang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19910467", "url": "https://glygen.org/publication/PubMed/19910467" } ] }, { "title": "Nuclear CDKs drive Smad transcriptional activation and turnover in BMP and TGF-beta pathways.", "journal": "Cell", "date": "2009", "authors": "Alarcon C, Zaromytidou AI, Xi Q, Gao S, Yu J, Fujisawa S, Barlas A, Miller AN, Manova-Todorova K, Macias MJ, Sapkota G, Pan D, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "19914168", "url": "https://glygen.org/publication/PubMed/19914168" } ] }, { "title": "Phosphorylation by Cdk2 is required for Myc to repress Ras-induced senescence in cotransformation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Hydbring P, Bahram F, Su Y, Tronnersjo S, Hogstrand K, von der Lehr N, Sharifi HR, Lilischkis R, Hein N, Wu S, Vervoorts J, Henriksson M, Grandien A, Luscher B, Larsson LG", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" }, { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" } ], "reference": [ { "type": "PubMed", "id": "19966300", "url": "https://glygen.org/publication/PubMed/19966300" } ] }, { "title": "HnRNP proteins controlled by c-Myc deregulate pyruvate kinase mRNA splicing in cancer.", "journal": "Nature", "date": "2010-01-21", "authors": "David Charles J, Chen Mo, Assanah Marcela, Canoll Peter, Manley James L", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "reference": [ { "type": "PubMed", "id": "20010808", "url": "https://glygen.org/publication/PubMed/20010808" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" }, { "database": "iPTMnet", "id": "P01106-2", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106-2" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "USP10 regulates p53 localization and stability by deubiquitinating p53.", "journal": "Cell", "date": "2010", "authors": "Yuan J, Luo K, Zhang L, Cheville JC, Lou Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "20096447", "url": "https://glygen.org/publication/PubMed/20096447" } ] }, { "title": "A CTCF-independent role for cohesin in tissue-specific transcription.", "journal": "Genome research", "date": "2010", "authors": "Schmidt D, Schwalie PC, Ross-Innes CS, Hurtado A, Brown GD, Carroll JS, Flicek P, Odom DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20219941", "url": "https://glygen.org/publication/PubMed/20219941" } ] }, { "title": "A novel Wilms tumor 1 (WT1) target gene negatively regulates the WNT signaling pathway.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Kim MS, Yoon SK, Bollig F, Kitagaki J, Hur W, Whye NJ, Wu YP, Rivera MN, Park JY, Kim HS, Malik K, Bell DW, Englert C, Perantoni AO, Lee SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20220130", "url": "https://glygen.org/publication/PubMed/20220130" } ] }, { "title": "Ubiquitin hydrolase Dub3 promotes oncogenic transformation by stabilizing Cdc25A.", "journal": "Nature cell biology", "date": "2010", "authors": "Pereg Y, Liu BY, O'Rourke KM, Sagolla M, Dey A, Komuves L, French DM, Dixit VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "20228808", "url": "https://glygen.org/publication/PubMed/20228808" } ] }, { "title": "C-terminal domain phosphorylation of ERK3 controlled by Cdk1 and Cdc14 regulates its stability in mitosis.", "journal": "The Biochemical journal", "date": "2010", "authors": "Tanguay PL, Rodier G, Meloche S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "20236090", "url": "https://glygen.org/publication/PubMed/20236090" } ] }, { "title": "The ubiquitin-specific protease 17 is involved in virus-triggered type I IFN signaling.", "journal": "Cell research", "date": "2010", "authors": "Chen R, Zhang L, Zhong B, Tan B, Liu Y, Shu HB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "20368735", "url": "https://glygen.org/publication/PubMed/20368735" } ] }, { "title": "Diverse targets of the transcription factor STAT3 contribute to T cell pathogenicity and homeostasis.", "journal": "Immunity", "date": "2010", "authors": "Durant L, Watford WT, Ramos HL, Laurence A, Vahedi G, Wei L, Takahashi H, Sun HW, Kanno Y, Powrie F, O'Shea JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "20493732", "url": "https://glygen.org/publication/PubMed/20493732" } ] }, { "title": "Novel trans-tail regulation of H2B ubiquitylation and H3K4 methylation by the N terminus of histone H2A.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Zheng S, Wyrick JJ, Reese JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20498280", "url": "https://glygen.org/publication/PubMed/20498280" } ] }, { "title": "The deubiquitinating enzyme USP26 is a regulator of androgen receptor signaling.", "journal": "Molecular cancer research : MCR", "date": "2010", "authors": "Dirac AM, Bernards R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "20501646", "url": "https://glygen.org/publication/PubMed/20501646" } ] }, { "title": "HSPB1, actin filament dynamics, and aging cells.", "journal": "Annals of the New York Academy of Sciences", "date": "2010", "authors": "Doshi BM, Hightower LE, Lee J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "20536836", "url": "https://glygen.org/publication/PubMed/20536836" } ] }, { "title": "A global network of transcription factors, involving E2A, EBF1 and Foxo1, that orchestrates B cell fate.", "journal": "Nature immunology", "date": "2010", "authors": "Lin YC, Jhunjhunwala S, Benner C, Heinz S, Welinder E, Mansson R, Sigvardsson M, Hagman J, Espinoza CA, Dutkowski J, Ideker T, Glass CK, Murre C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "20543837", "url": "https://glygen.org/publication/PubMed/20543837" } ] }, { "title": "Myc protein is stabilized by suppression of a novel E3 ligase complex in cancer cells.", "journal": "Genes & development", "date": "2010", "authors": "Choi SH, Wright JB, Gerber SA, Cole MD", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "reference": [ { "type": "PubMed", "id": "20551172", "url": "https://glygen.org/publication/PubMed/20551172" } ] }, { "title": "Role of EBAG9 protein in coat protein complex I-dependent glycoprotein maturation and secretion processes in tumor cells.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2010", "authors": "Wolf J, Reimer TA, Schuck S, Ruder C, Gerlach K, Muller EC, Otto A, Dorken B, Rehm A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20570965", "url": "https://glygen.org/publication/PubMed/20570965" } ] }, { "title": "Smad2 protects against TGF-beta/Smad3-mediated renal fibrosis.", "journal": "Journal of the American Society of Nephrology : JASN", "date": "2010", "authors": "Meng XM, Huang XR, Chung AC, Qin W, Shao X, Igarashi P, Ju W, Bottinger EP, Lan HY", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "20595680", "url": "https://glygen.org/publication/PubMed/20595680" } ] }, { "title": "Crystal structure of the ALK (anaplastic lymphoma kinase) catalytic domain.", "journal": "The Biochemical journal", "date": "2010", "authors": "Lee CC, Jia Y, Li N, Sun X, Ng K, Ambing E, Gao MY, Hua S, Chen C, Kim S, Michellys PY, Lesley SA, Harris JL, Spraggon G", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "20632993", "url": "https://glygen.org/publication/PubMed/20632993" } ] }, { "title": "C/EBPepsilon participates in all-trans retinoic acid induction of PI3Kgamma in U937 cells via an intronic matrix attachment region sequence.", "journal": "Molecular biology reports", "date": "2010", "authors": "Cai R, Cai X, Chen B, Xu W, Lu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "20661648", "url": "https://glygen.org/publication/PubMed/20661648" } ] }, { "title": "Aberrant O-GlcNAcylation characterizes chronic lymphocytic leukemia.", "journal": "Leukemia", "date": "2010", "authors": "Shi Y, Tomic J, Wen F, Shaha S, Bahlo A, Harrison R, Dennis JW, Williams R, Gross BJ, Walker S, Zuccolo J, Deans JP, Hart GW, Spaner DE", "evidence": [ { "database": "O-GlcNAc Database", "id": "P01106", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01106" } ], "reference": [ { "type": "PubMed", "id": "20668475", "url": "https://glygen.org/publication/PubMed/20668475" } ] }, { "title": "The histone demethylase JMJD2B is regulated by estrogen receptor alpha and hypoxia, and is a key mediator of estrogen induced growth.", "journal": "Cancer research", "date": "2010", "authors": "Yang J, Jubb AM, Pike L, Buffa FM, Turley H, Baban D, Leek R, Gatter KC, Ragoussis J, Harris AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20682797", "url": "https://glygen.org/publication/PubMed/20682797" } ] }, { "title": "A chromosome 12 coding region is juxtaposed to the MYC protooncogene locus in a t(8;12)(q24;q22) translocation in a case of B-cell chronic lymphocytic leukemia.", "journal": "Genes Chromosomes Cancer", "date": "1991", "authors": "Rimokh R, Rouault J P, Wahbi K, Gadoux M, Lafage M, Archimbaud E, Charrin C, Gentilhomme O, Germain D, Samarut J", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "reference": [ { "type": "PubMed", "id": "2069907", "url": "https://glygen.org/publication/PubMed/2069907" } ] }, { "title": "Tipping the balance: Cdk2 enables Myc to suppress senescence.", "journal": "Cancer research", "date": "2010", "authors": "Hydbring P, Larsson LG", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" }, { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" } ], "reference": [ { "type": "PubMed", "id": "20713526", "url": "https://glygen.org/publication/PubMed/20713526" } ] }, { "title": "Meta-analysis of neuroblastomas reveals a skewed ALK mutation spectrum in tumors with MYCN amplification.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2010", "authors": "De Brouwer S, De Preter K, Kumps C, Zabrocki P, Porcu M, Westerhout EM, Lakeman A, Vandesompele J, Hoebeeck J, Van Maerken T, De Paepe A, Laureys G, Schulte JH, Schramm A, Van Den Broecke C, Vermeulen J, Van Roy N, Beiske K, Renard M, Noguera R, Delattre O, Janoueix-Lerosey I, Kogner P, Martinsson T, Nakagawara A, Ohira M, Caron H, Eggert A, Cools J, Versteeg R, Speleman F", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "20719933", "url": "https://glygen.org/publication/PubMed/20719933" } ] }, { "title": "Serine residue 115 of MAPK-activated protein kinase MK5 is crucial for its PKA-regulated nuclear export and biological function.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2011", "authors": "Kostenko S, Shiryaev A, Gerits N, Dumitriu G, Klenow H, Johannessen M, Moens U", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "20734105", "url": "https://glygen.org/publication/PubMed/20734105" } ] }, { "title": "Cross-talk between protein kinase A and the MAPK-activated protein kinases RSK1 and MK5.", "journal": "Journal of receptor and signal transduction research", "date": "2011", "authors": "Kostenko S, Shiryaev A, Dumitriu G, Gerits N, Moens U", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "20849292", "url": "https://glygen.org/publication/PubMed/20849292" } ] }, { "title": "Structural and mechanistic insights into cooperative assembly of dimeric Notch transcription complexes.", "journal": "Nature structural & molecular biology", "date": "2010", "authors": "Arnett KL, Hass M, McArthur DG, Ilagan MX, Aster JC, Kopan R, Blacklow SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "20972443", "url": "https://glygen.org/publication/PubMed/20972443" } ] }, { "title": "Dual association by TFAP2A during activation of the p21cip/CDKN1A promoter.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2010", "authors": "Scibetta AG, Wong PP, Chan KV, Canosa M, Hurst HC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866911", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866911" } ], "reference": [ { "type": "PubMed", "id": "21084835", "url": "https://glygen.org/publication/PubMed/21084835" } ] }, { "title": "STAT3-induced S1PR1 expression is crucial for persistent STAT3 activation in tumors.", "journal": "Nature medicine", "date": "2010", "authors": "Lee H, Deng J, Kujawski M, Yang C, Liu Y, Herrmann A, Kortylewski M, Horne D, Somlo G, Forman S, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21102457", "url": "https://glygen.org/publication/PubMed/21102457" } ] }, { "title": "Histone H3K27ac separates active from poised enhancers and predicts developmental state.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Creyghton MP, Cheng AW, Welstead GG, Kooistra T, Carey BW, Steine EJ, Hanna J, Lodato MA, Frampton GM, Sharp PA, Boyer LA, Young RA, Jaenisch R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21106759", "url": "https://glygen.org/publication/PubMed/21106759" } ] }, { "title": "FOXA1 is a key determinant of estrogen receptor function and endocrine response.", "journal": "Nature genetics", "date": "2011", "authors": "Hurtado A, Holmes KA, Ross-Innes CS, Schmidt D, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21151129", "url": "https://glygen.org/publication/PubMed/21151129" } ] }, { "title": "Crizotinib, a small-molecule dual inhibitor of the c-Met and ALK receptor tyrosine kinases.", "journal": "Current opinion in investigational drugs (London, England : 2000)", "date": "2010", "authors": "Rodig SJ, Shapiro GI", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "21154129", "url": "https://glygen.org/publication/PubMed/21154129" } ] }, { "title": "Activation loop phosphorylation of ERK3/ERK4 by group I p21-activated kinases (PAKs) defines a novel PAK-ERK3/4-MAPK-activated protein kinase 5 signaling pathway.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Deleris P, Trost M, Topisirovic I, Tanguay PL, Borden KL, Thibault P, Meloche S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "21177870", "url": "https://glygen.org/publication/PubMed/21177870" } ] }, { "title": "Lys-63-specific deubiquitination of SDS3 by USP17 regulates HDAC activity.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Ramakrishna S, Suresh B, Lee EJ, Lee HJ, Ahn WS, Baek KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21239494", "url": "https://glygen.org/publication/PubMed/21239494" } ] }, { "title": "alphaMbeta(2) integrin activation prevents alternative activation of human and murine macrophages and impedes foam cell formation.", "journal": "Circulation research", "date": "2011", "authors": "Yakubenko VP, Bhattacharjee A, Pluskota E, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21252155", "url": "https://glygen.org/publication/PubMed/21252155" } ] }, { "title": "Identification of the atypical MAPK Erk3 as a novel substrate for p21-activated kinase (Pak) activity.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "De la Mota-Peynado A, Chernoff J, Beeser A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "21317288", "url": "https://glygen.org/publication/PubMed/21317288" } ] }, { "title": "More, more, more: downregulation of a MK5-FoxO3a-mir34b/c pathway further increases c-Myc levels in colorectal cancer.", "journal": "Molecular cell", "date": "2011", "authors": "Myant K, Sansom OJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "21329875", "url": "https://glygen.org/publication/PubMed/21329875" } ] }, { "title": "The MK5/PRAK kinase and Myc form a negative feedback loop that is disrupted during colorectal tumorigenesis.", "journal": "Molecular cell", "date": "2011", "authors": "Kress TR, Cannell IG, Brenkman AB, Samans B, Gaestel M, Roepman P, Burgering BM, Bushell M, Rosenwald A, Eilers M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "21329882", "url": "https://glygen.org/publication/PubMed/21329882" } ] }, { "title": "Crizotinib in anaplastic large-cell lymphoma.", "journal": "The New England journal of medicine", "date": "2011", "authors": "Gambacorti-Passerini C, Messa C, Pogliani EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "21345110", "url": "https://glygen.org/publication/PubMed/21345110" } ] }, { "title": "USP47 is a deubiquitylating enzyme that regulates base excision repair by controlling steady-state levels of DNA polymerase beta.", "journal": "Molecular cell", "date": "2011", "authors": "Parsons JL, Dianova II, Khoronenkova SV, Edelmann MJ, Kessler BM, Dianov GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21362556", "url": "https://glygen.org/publication/PubMed/21362556" } ] }, { "title": "Activation and function of the MAPKs and their substrates, the MAPK-activated protein kinases.", "journal": "Microbiology and molecular biology reviews : MMBR", "date": "2011", "authors": "Cargnello M, Roux PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "21372320", "url": "https://glygen.org/publication/PubMed/21372320" } ] }, { "title": "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.", "journal": "Science signaling", "date": "2011", "authors": "Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B", "evidence": [ { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" } ], "reference": [ { "type": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" } ] }, { "title": "Histone demethylase JMJD2B functions as a co-factor of estrogen receptor in breast cancer proliferation and mammary gland development.", "journal": "PloS one", "date": "2011", "authors": "Kawazu M, Saso K, Tong KI, McQuire T, Goto K, Son DO, Wakeham A, Miyagishi M, Mak TW, Okada H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21445275", "url": "https://glygen.org/publication/PubMed/21445275" } ] }, { "title": "Protein disulfide isomerase blocks CEBPA translation and is up-regulated during the unfolded protein response in AML.", "journal": "Blood", "date": "2011", "authors": "Haefliger S, Klebig C, Schaubitzer K, Schardt J, Timchenko N, Mueller BU, Pabst T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "21471526", "url": "https://glygen.org/publication/PubMed/21471526" } ] }, { "title": "DYRK1A protein kinase promotes quiescence and senescence through DREAM complex assembly.", "journal": "Genes & development", "date": "2011", "authors": "Litovchick L, Florens LA, Swanson SK, Washburn MP, DeCaprio JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362277", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362277" } ], "reference": [ { "type": "PubMed", "id": "21498570", "url": "https://glygen.org/publication/PubMed/21498570" } ] }, { "title": "Ubiquitin-recognition protein Ufd1 couples the endoplasmic reticulum (ER) stress response to cell cycle control.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Chen M, Gutierrez GJ, Ronai ZA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21571647", "url": "https://glygen.org/publication/PubMed/21571647" } ] }, { "title": "Intracellular estrogen receptor-binding fragment-associated antigen 9 exerts in vivo tumor-promoting effects via its coiled-coil region.", "journal": "International journal of oncology", "date": "2011", "authors": "Maeyama Y, Otsu M, Kubo S, Yamano T, Iimura Y, Onodera M, Kondo S, Sakiyama Y, Ariga T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21573489", "url": "https://glygen.org/publication/PubMed/21573489" } ] }, { "title": "Deubiquitinase USP37 is activated by CDK2 to antagonize APC(CDH1) and promote S phase entry.", "journal": "Molecular cell", "date": "2011", "authors": "Huang X, Summers MK, Pham V, Lill JR, Liu J, Lee G, Kirkpatrick DS, Jackson PK, Fang G, Dixit VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21596315", "url": "https://glygen.org/publication/PubMed/21596315" } ] }, { "title": "USP13 enzyme regulates Siah2 ligase stability and activity via noncatalytic ubiquitin-binding domains.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Scortegagna M, Subtil T, Qi J, Kim H, Zhao W, Gu W, Kluger H, Ronai ZA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21659512", "url": "https://glygen.org/publication/PubMed/21659512" } ] }, { "title": "The pathogenesis of Burkitt's lymphoma.", "journal": "Adv. Cancer Res.", "date": "1990", "authors": "Magrath I", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "reference": [ { "type": "PubMed", "id": "2166998", "url": "https://glygen.org/publication/PubMed/2166998" } ] }, { "title": "TRIM8 regulates Nanog via Hsp90beta-mediated nuclear translocation of STAT3 in embryonic stem cells.", "journal": "Biochimica et biophysica acta", "date": "2011", "authors": "Okumura F, Okumura AJ, Matsumoto M, Nakayama KI, Hatakeyama S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21689689", "url": "https://glygen.org/publication/PubMed/21689689" } ] }, { "title": "STAT3 protein promotes T-cell survival and inhibits interleukin-2 production through up-regulation of Class O Forkhead transcription factors.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Oh HM, Yu CR, Golestaneh N, Amadi-Obi A, Lee YS, Eseonu A, Mahdi RM, Egwuagu CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21730069", "url": "https://glygen.org/publication/PubMed/21730069" } ] }, { "title": "Oncogene-induced Nrf2 transcription promotes ROS detoxification and tumorigenesis.", "journal": "Nature", "date": "2011", "authors": "DeNicola GM, Karreth FA, Humpton TJ, Gopinathan A, Wei C, Frese K, Mangal D, Yu KH, Yeo CJ, Calhoun ES, Scrimieri F, Winter JM, Hruban RH, Iacobuzio-Donahue C, Kern SE, Blair IA, Tuveson DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9818749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818749" } ], "reference": [ { "type": "PubMed", "id": "21734707", "url": "https://glygen.org/publication/PubMed/21734707" } ] }, { "title": "Strong association between c-myb and oestrogen-receptor expression in human breast cancer.", "journal": "Oncogene", "date": "1990", "authors": "Guerin M, Sheng ZM, Andrieu N, Riou G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "2181374", "url": "https://glygen.org/publication/PubMed/2181374" } ] }, { "title": "Estrogen induces c-myc gene expression via an upstream enhancer activated by the estrogen receptor and the AP-1 transcription factor.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2011", "authors": "Wang C, Mayer JA, Mazumdar A, Fertuck K, Kim H, Brown M, Brown PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21835891", "url": "https://glygen.org/publication/PubMed/21835891" } ] }, { "title": "The USP19 deubiquitinase regulates the stability of c-IAP1 and c-IAP2.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Mei Y, Hahn AA, Hu S, Yang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21849505", "url": "https://glygen.org/publication/PubMed/21849505" } ] }, { "title": "Cellular reprogramming by the conjoint action of ERalpha, FOXA1, and GATA3 to a ligand-inducible growth state.", "journal": "Molecular systems biology", "date": "2011", "authors": "Kong SL, Li G, Loh SL, Sung WK, Liu ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21878914", "url": "https://glygen.org/publication/PubMed/21878914" } ] }, { "title": "FOXA1: master of steroid receptor function in cancer.", "journal": "The EMBO journal", "date": "2011", "authors": "Augello MA, Hickey TE, Knudsen KE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21934649", "url": "https://glygen.org/publication/PubMed/21934649" } ] }, { "title": "Signal transducers and activators of transcription 3 (STAT3) directly regulates cytokine-induced fascin expression and is required for breast cancer cell migration.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Snyder M, Huang XY, Zhang JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21937440", "url": "https://glygen.org/publication/PubMed/21937440" } ] }, { "title": "Gene regulation by cohesin in cancer: is the ring an unexpected party to proliferation?", "journal": "Molecular cancer research : MCR", "date": "2011", "authors": "Rhodes JM, McEwan M, Horsfield JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21940756", "url": "https://glygen.org/publication/PubMed/21940756" } ] }, { "title": "Beclin1 controls the levels of p53 by regulating the deubiquitination activity of USP10 and USP13.", "journal": "Cell", "date": "2011", "authors": "Liu J, Xia H, Kim M, Xu L, Li Y, Zhang L, Cai Y, Norberg HV, Zhang T, Furuya T, Jin M, Zhu Z, Wang H, Yu J, Li Y, Hao Y, Choi A, Ke H, Ma D, Yuan J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21962518", "url": "https://glygen.org/publication/PubMed/21962518" } ] }, { "title": "The granulocyte-associated transcription factor Kruppel-like factor 5 is silenced by hypermethylation in acute myeloid leukemia.", "journal": "Leukemia research", "date": "2012", "authors": "Diakiw SM, Kok CH, To LB, Lewis ID, Brown AL, D'Andrea RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "21993314", "url": "https://glygen.org/publication/PubMed/21993314" } ] }, { "title": "Cytokine induction of tumor necrosis factor receptor 2 is mediated by STAT3 in colon cancer cells.", "journal": "Molecular cancer research : MCR", "date": "2011", "authors": "Hamilton KE, Simmons JG, Ding S, Van Landeghem L, Lund PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21994466", "url": "https://glygen.org/publication/PubMed/21994466" } ] }, { "title": "Ubiquitin-specific protease 4 (USP4) targets TRAF2 and TRAF6 for deubiquitination and inhibits TNFalpha-induced cancer cell migration.", "journal": "The Biochemical journal", "date": "2012", "authors": "Xiao N, Li H, Luo J, Wang R, Chen H, Chen J, Wang P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "22029577", "url": "https://glygen.org/publication/PubMed/22029577" } ] }, { "title": "Necdin, a negative growth regulator, is a novel STAT3 target gene down-regulated in human cancer.", "journal": "PloS one", "date": "2011", "authors": "Haviland R, Eschrich S, Bloom G, Ma Y, Minton S, Jove R, Cress WD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22046235", "url": "https://glygen.org/publication/PubMed/22046235" } ] }, { "title": "Pioneer transcription factors: establishing competence for gene expression.", "journal": "Genes & development", "date": "2011", "authors": "Zaret KS, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22056668", "url": "https://glygen.org/publication/PubMed/22056668" } ] }, { "title": "Regulation of p53 stability and function by the deubiquitinating enzyme USP42.", "journal": "The EMBO journal", "date": "2011", "authors": "Hock AK, Vigneron AM, Carter S, Ludwig RL, Vousden KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "22085928", "url": "https://glygen.org/publication/PubMed/22085928" } ] }, { "title": "Ubiquitin-specific protease 19 (USP19) regulates hypoxia-inducible factor 1alpha (HIF-1alpha) during hypoxia.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Altun M, Zhao B, Velasco K, Liu H, Hassink G, Paschke J, Pereira T, Lindsten K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "22128162", "url": "https://glygen.org/publication/PubMed/22128162" } ] }, { "title": "Crizotinib: a novel and first-in-class multitargeted tyrosine kinase inhibitor for the treatment of anaplastic lymphoma kinase rearranged non-small cell lung cancer and beyond.", "journal": "Drug design, development and therapy", "date": "2011", "authors": "Ou SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "22162641", "url": "https://glygen.org/publication/PubMed/22162641" } ] }, { "title": "Activation of Wnt and Myc signaling in hepatoblastoma.", "journal": "Frontiers in bioscience (Elite edition)", "date": "2012", "authors": "Cairo S, Armengol C, Buendia MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-4411364", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4411364" } ], "reference": [ { "type": "PubMed", "id": "22201888", "url": "https://glygen.org/publication/PubMed/22201888" } ] }, { "title": "Roles of STAT3 and ZEB1 proteins in E-cadherin down-regulation and human colorectal cancer epithelial-mesenchymal transition.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Xiong H, Hong J, Du W, Lin YW, Ren LL, Wang YC, Su WY, Wang JL, Cui Y, Wang ZH, Fang JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22205702", "url": "https://glygen.org/publication/PubMed/22205702" } ] }, { "title": "Domain analysis reveals that a deubiquitinating enzyme USP13 performs non-activating catalysis for Lys63-linked polyubiquitin.", "journal": "PloS one", "date": "2011", "authors": "Zhang YH, Zhou CJ, Zhou ZR, Song AX, Hu HY", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "22216260", "url": "https://glygen.org/publication/PubMed/22216260" } ] }, { "title": "Extensive promoter-centered chromatin interactions provide a topological basis for transcription regulation.", "journal": "Cell", "date": "2012", "authors": "Li G, Ruan X, Auerbach RK, Sandhu KS, Zheng M, Wang P, Poh HM, Goh Y, Lim J, Zhang J, Sim HS, Peh SQ, Mulawadi FH, Ong CT, Orlov YL, Hong S, Zhang Z, Landt S, Raha D, Euskirchen G, Wei CL, Ge W, Wang H, Davis C, Fisher-Aylor KI, Mortazavi A, Gerstein M, Gingeras T, Wold B, Sun Y, Fullwood MJ, Cheung E, Liu E, Sung WK, Snyder M, Ruan Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22265404", "url": "https://glygen.org/publication/PubMed/22265404" } ] }, { "title": "A self-reinforcing regulatory network triggered by limiting IL-7 activates pre-BCR signaling and differentiation.", "journal": "Nature immunology", "date": "2012", "authors": "Ochiai K, Maienschein-Cline M, Mandal M, Triggs JR, Bertolino E, Sciammas R, Dinner AR, Clark MR, Singh H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "22267219", "url": "https://glygen.org/publication/PubMed/22267219" } ] }, { "title": "Impaired transforming growth factor-beta (TGF-beta) transcriptional activity and cell proliferation control of a menin in-frame deletion mutant associated with multiple endocrine neoplasia type 1 (MEN1).", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Canaff L, Vanbellinghen JF, Kaji H, Goltzman D, Hendy GN", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "22275377", "url": "https://glygen.org/publication/PubMed/22275377" } ] }, { "title": "IGF2BP1 promotes cell migration by regulating MK5 and PTEN signaling.", "journal": "Genes & development", "date": "2012", "authors": "Stohr N, Kohn M, Lederer M, Glass M, Reinke C, Singer RH, Huttelmaier S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "22279049", "url": "https://glygen.org/publication/PubMed/22279049" } ] }, { "title": "Anaplastic Lymphoma Kinase (ALK) regulates initiation of transcription of MYCN in neuroblastoma cells.", "journal": "Oncogene", "date": "2012", "authors": "Schonherr C, Ruuth K, Kamaraj S, Wang CL, Yang HL, Combaret V, Djos A, Martinsson T, Christensen JG, Palmer RH, Hallberg B", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "22286764", "url": "https://glygen.org/publication/PubMed/22286764" } ] }, { "title": "DYRK2 priming phosphorylation of c-Jun and c-Myc modulates cell cycle progression in human cancer cells.", "journal": "The Journal of clinical investigation", "date": "2012", "authors": "Taira N, Mimoto R, Kurata M, Yamaguchi T, Kitagawa M, Miki Y, Yoshida K", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" }, { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" } ], "reference": [ { "type": "PubMed", "id": "22307329", "url": "https://glygen.org/publication/PubMed/22307329" } ] }, { "title": "Overexpression of wild-type or mutants forms of CEBPA alter normal human hematopoiesis.", "journal": "Leukemia", "date": "2012", "authors": "Quintana-Bustamante O, Lan-Lan Smith S, Griessinger E, Reyal Y, Vargaftig J, Lister TA, Fitzgibbon J, Bonnet D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "22371011", "url": "https://glygen.org/publication/PubMed/22371011" } ] }, { "title": "Histone demethylase KDM5B collaborates with TFAP2C and Myc to repress the cell cycle inhibitor p21(cip) (CDKN1A).", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Wong PP, Miranda F, Chan KV, Berlato C, Hurst HC, Scibetta AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866911", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866911" } ], "reference": [ { "type": "PubMed", "id": "22371483", "url": "https://glygen.org/publication/PubMed/22371483" } ] }, { "title": "The Jak/STAT pathway.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2012", "authors": "Harrison DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22383755", "url": "https://glygen.org/publication/PubMed/22383755" } ] }, { "title": "Activated ALK collaborates with MYCN in neuroblastoma pathogenesis.", "journal": "Cancer cell", "date": "2012", "authors": "Zhu S, Lee JS, Guo F, Shin J, Perez-Atayde AR, Kutok JL, Rodig SJ, Neuberg DS, Helman D, Feng H, Stewart RA, Wang W, George RE, Kanki JP, Look AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "22439933", "url": "https://glygen.org/publication/PubMed/22439933" } ] }, { "title": "C/EBPalpha and DEK coordinately regulate myeloid differentiation.", "journal": "Blood", "date": "2012", "authors": "Koleva RI, Ficarro SB, Radomska HS, Carrasco-Alfonso MJ, Alberta JA, Webber JT, Luckey CJ, Marcucci G, Tenen DG, Marto JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "22474248", "url": "https://glygen.org/publication/PubMed/22474248" } ] }, { "title": "Estrogen receptor-alpha recruits P-TEFb to overcome transcriptional pausing in intron 1 of the MYB gene.", "journal": "Nucleic acids research", "date": "2012", "authors": "Mitra P, Pereira LA, Drabsch Y, Ramsay RG, Gonda TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22492511", "url": "https://glygen.org/publication/PubMed/22492511" } ] }, { "title": "ERK3 signals through SRC-3 coactivator to promote human lung cancer cell invasion.", "journal": "The Journal of clinical investigation", "date": "2012", "authors": "Long W, Foulds CE, Qin J, Liu J, Ding C, Lonard DM, Solis LM, Wistuba II, Qin J, Tsai SY, Tsai MJ, O'Malley BW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "22505454", "url": "https://glygen.org/publication/PubMed/22505454" } ] }, { "title": "The extracellular signal-regulated kinase 3 (mitogen-activated protein kinase 6 [MAPK6])-MAPK-activated protein kinase 5 signaling complex regulates septin function and dendrite morphology.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Brand F, Schumacher S, Kant S, Menon MB, Simon R, Turgeon B, Britsch S, Meloche S, Gaestel M, Kotlyarov A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "22508986", "url": "https://glygen.org/publication/PubMed/22508986" } ] }, { "title": "Non-overlapping progesterone receptor cistromes contribute to cell-specific transcriptional outcomes.", "journal": "PloS one", "date": "2012", "authors": "Clarke CL, Graham JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22545144", "url": "https://glygen.org/publication/PubMed/22545144" } ] }, { "title": "Identification of novel NRF2-regulated genes by ChIP-Seq: influence on retinoid X receptor alpha.", "journal": "Nucleic acids research", "date": "2012-08", "authors": "Chorley Brian N, Campbell Michelle R, Wang Xuting, Karaca Mehmet, Sambandan Deepa, Bangura Fatu, Xue Peng, Pi Jingbo, Kleeberger Steven R, Bell Douglas A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9818749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818749" } ], "reference": [ { "type": "PubMed", "id": "22581777", "url": "https://glygen.org/publication/PubMed/22581777" } ] }, { "title": "STAT1 gene expression is enhanced by nuclear EGFR and HER2 via cooperation with STAT3.", "journal": "Molecular carcinogenesis", "date": "2013", "authors": "Han W, Carpenter RL, Cao X, Lo HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22693070", "url": "https://glygen.org/publication/PubMed/22693070" } ] }, { "title": "The elements of human cyclin D1 promoter and regulation involved.", "journal": "Clinical epigenetics", "date": "2011", "authors": "Guo ZY, Hao XH, Tan FF, Pei X, Shang LM, Jiang XL, Yang F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22704330", "url": "https://glygen.org/publication/PubMed/22704330" } ] }, { "title": "Nrf2 redirects glucose and glutamine into anabolic pathways in metabolic reprogramming.", "journal": "Cancer cell", "date": "2012", "authors": "Mitsuishi Y, Taguchi K, Kawatani Y, Shibata T, Nukiwa T, Aburatani H, Yamamoto M, Motohashi H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9818749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818749" } ], "reference": [ { "type": "PubMed", "id": "22789539", "url": "https://glygen.org/publication/PubMed/22789539" } ] }, { "title": "Tumour promoting and suppressing roles of the atypical MAP kinase signalling pathway ERK3/4-MK5.", "journal": "Journal of molecular signaling", "date": "2012", "authors": "Kostenko S, Dumitriu G, Moens U", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "22800433", "url": "https://glygen.org/publication/PubMed/22800433" } ] }, { "title": "Interleukin-10-induced neutrophil gelatinase-associated lipocalin production in macrophages with consequences for tumor growth.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Jung M, Weigert A, Tausendschon M, Mora J, Oren B, Sola A, Hotter G, Muta T, Brune B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22851691", "url": "https://glygen.org/publication/PubMed/22851691" } ] }, { "title": "Interactions among HCLS1, HAX1 and LEF-1 proteins are essential for G-CSF-triggered granulopoiesis.", "journal": "Nature medicine", "date": "2012", "authors": "Skokowa J, Klimiankou M, Klimenkova O, Lan D, Gupta K, Hussein K, Carrizosa E, Kusnetsova I, Li Z, Sustmann C, Ganser A, Zeidler C, Kreipe HH, Burkhardt J, Grosschedl R, Welte K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "23001182", "url": "https://glygen.org/publication/PubMed/23001182" } ] }, { "title": "Insulin-like growth factor 2 mRNA-binding proteins (IGF2BPs): post-transcriptional drivers of cancer progression?", "journal": "Cellular and molecular life sciences : CMLS", "date": "2013", "authors": "Bell JL, Wachter K, Muhleck B, Pazaitis N, Kohn M, Lederer M, Huttelmaier S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "23069990", "url": "https://glygen.org/publication/PubMed/23069990" } ] }, { "title": "The high Nrf2 expression in human acute myeloid leukemia is driven by NF-\u03baB and underlies its chemo-resistance.", "journal": "Blood", "date": "2012-12-20", "authors": "Rushworth Stuart A, Zaitseva Lyubov, Murray Megan Y, Shah Niraj M, Bowles Kristian M, MacEwan David J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9818749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818749" } ], "reference": [ { "type": "PubMed", "id": "23077289", "url": "https://glygen.org/publication/PubMed/23077289" } ] }, { "title": "STAT1 activation by venous malformations mutant Tie2-R849W antagonizes VEGF-A-mediated angiogenic response partly via reduced bFGF production.", "journal": "Angiogenesis", "date": "2013", "authors": "Huang YH, Wu MP, Pan SC, Su WC, Chen YW, Wu LW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23086340", "url": "https://glygen.org/publication/PubMed/23086340" } ] }, { "title": "IL-4 and IL-13 employ discrete signaling pathways for target gene expression in alternatively activated monocytes/macrophages.", "journal": "Free radical biology & medicine", "date": "2013", "authors": "Bhattacharjee A, Shukla M, Yakubenko VP, Mulya A, Kundu S, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23124025", "url": "https://glygen.org/publication/PubMed/23124025" } ] }, { "title": "Cohesin is required for activation of MYC by estradiol.", "journal": "PloS one", "date": "2012", "authors": "McEwan MV, Eccles MR, Horsfield JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23145106", "url": "https://glygen.org/publication/PubMed/23145106" } ] }, { "title": "The deubiquitinating protein USP24 interacts with DDB2 and regulates DDB2 stability.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2012", "authors": "Zhang L, Lubin A, Chen H, Sun Z, Gong F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "23159851", "url": "https://glygen.org/publication/PubMed/23159851" } ] }, { "title": "STAT3 is involved in esophageal carcinogenesis through regulation of Oct-1.", "journal": "Carcinogenesis", "date": "2013", "authors": "Wang Z, Zhu S, Shen M, Liu J, Wang M, Li C, Wang Y, Deng A, Mei Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23172665", "url": "https://glygen.org/publication/PubMed/23172665" } ] }, { "title": "GATA3 acts upstream of FOXA1 in mediating ESR1 binding by shaping enhancer accessibility.", "journal": "Genome research", "date": "2013", "authors": "Theodorou V, Stark R, Menon S, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23172872", "url": "https://glygen.org/publication/PubMed/23172872" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" }, { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Cooperating transcription factors mediate the function of estrogen receptor.", "journal": "Chromosoma", "date": "2013", "authors": "Fiorito E, Katika MR, Hurtado A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23192763", "url": "https://glygen.org/publication/PubMed/23192763" } ] }, { "title": "Anaplastic lymphoma kinase (ALK): structure, oncogenic activation, and pharmacological inhibition.", "journal": "Pharmacological research", "date": "2013", "authors": "Roskoski R Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "23201355", "url": "https://glygen.org/publication/PubMed/23201355" } ] }, { "title": "Crizotinib-resistant NPM-ALK mutants confer differential sensitivity to unrelated Alk inhibitors.", "journal": "Molecular cancer research : MCR", "date": "2013", "authors": "Ceccon M, Mologni L, Bisson W, Scapozza L, Gambacorti-Passerini C", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "23239810", "url": "https://glygen.org/publication/PubMed/23239810" } ] }, { "title": "Oxygen-dependent expression of cytochrome c oxidase subunit 4-2 gene expression is mediated by transcription factors RBPJ, CXXC5 and CHCHD2.", "journal": "Nucleic acids research", "date": "2013", "authors": "Aras S, Pak O, Sommer N, Finley R Jr, Huttemann M, Weissmann N, Grossman LI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23303788", "url": "https://glygen.org/publication/PubMed/23303788" } ] }, { "title": "Identification of the E3 deubiquitinase ubiquitin-specific peptidase 21 (USP21) as a positive regulator of the transcription factor GATA3.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Zhang J, Chen C, Hou X, Gao Y, Lin F, Yang J, Gao Z, Pan L, Tao L, Wen C, Yao Z, Tsun A, Shi G, Li B", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "23395819", "url": "https://glygen.org/publication/PubMed/23395819" } ] }, { "title": "Endogenous purification reveals GREB1 as a key estrogen receptor regulatory factor.", "journal": "Cell reports", "date": "2013", "authors": "Mohammed H, D'Santos C, Serandour AA, Ali HR, Brown GD, Atkins A, Rueda OM, Holmes KA, Theodorou V, Robinson JL, Zwart W, Saadi A, Ross-Innes CS, Chin SF, Menon S, Stingl J, Palmieri C, Caldas C, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23403292", "url": "https://glygen.org/publication/PubMed/23403292" } ] }, { "title": "The lysine demethylase, KDM4B, is a key molecule in androgen receptor signalling and turnover.", "journal": "Nucleic acids research", "date": "2013", "authors": "Coffey K, Rogerson L, Ryan-Munden C, Alkharaif D, Stockley J, Heer R, Sahadevan K, O'Neill D, Jones D, Darby S, Staller P, Mantilla A, Gaughan L, Robson CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23435229", "url": "https://glygen.org/publication/PubMed/23435229" } ] }, { "title": "Mutant B-RAF-Mcl-1 survival signaling depends on the STAT3 transcription factor.", "journal": "Oncogene", "date": "2014", "authors": "Becker TM, Boyd SC, Mijatov B, Gowrishankar K, Snoyman S, Pupo GM, Scolyer RA, Mann GJ, Kefford RF, Zhang XD, Rizos H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23455323", "url": "https://glygen.org/publication/PubMed/23455323" } ] }, { "title": "USP33 regulates centrosome biogenesis via deubiquitination of the centriolar protein CP110.", "journal": "Nature", "date": "2013", "authors": "Li J, D'Angiolella V, Seeley ES, Kim S, Kobayashi T, Fu W, Campos EI, Pagano M, Dynlacht BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "23486064", "url": "https://glygen.org/publication/PubMed/23486064" } ] }, { "title": "Tissue inhibitor of metalloproteinase 1 is preferentially expressed in Th1 and Th17 T-helper cell subsets and is a direct STAT target gene.", "journal": "PloS one", "date": "2013", "authors": "Adamson A, Ghoreschi K, Rittler M, Chen Q, Sun HW, Vahedi G, Kanno Y, Stetler-Stevenson WG, O'Shea JJ, Laurence A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23555662", "url": "https://glygen.org/publication/PubMed/23555662" } ] }, { "title": "KDM4B is a master regulator of the estrogen receptor signalling cascade.", "journal": "Nucleic acids research", "date": "2013", "authors": "Gaughan L, Stockley J, Coffey K, O'Neill D, Jones DL, Wade M, Wright J, Moore M, Tse S, Rogerson L, Robson CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23723241", "url": "https://glygen.org/publication/PubMed/23723241" } ] }, { "title": "USP49 deubiquitinates histone H2B and regulates cotranscriptional pre-mRNA splicing.", "journal": "Genes & development", "date": "2013", "authors": "Zhang Z, Jones A, Joo HY, Zhou D, Cao Y, Chen S, Erdjument-Bromage H, Renfrow M, He H, Tempst P, Townes TM, Giles KE, Ma L, Wang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "23824326", "url": "https://glygen.org/publication/PubMed/23824326" } ] }, { "title": "USP18 inhibits NF-kappaB and NFAT activation during Th17 differentiation by deubiquitinating the TAK1-TAB1 complex.", "journal": "The Journal of experimental medicine", "date": "2013", "authors": "Liu X, Li H, Zhong B, Blonska M, Gorjestani S, Yan M, Tian Q, Zhang DE, Lin X, Dong C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "23825189", "url": "https://glygen.org/publication/PubMed/23825189" } ] }, { "title": "MK5 activates Rag transcription via Foxo1 in developing B cells.", "journal": "The Journal of experimental medicine", "date": "2013", "authors": "Chow KT, Timblin GA, McWhirter SM, Schlissel MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "23878308", "url": "https://glygen.org/publication/PubMed/23878308" } ] }, { "title": "Phosphoproteomic analysis of anaplastic lymphoma kinase (ALK) downstream signaling pathways identifies signal transducer and activator of transcription 3 as a functional target of activated ALK in neuroblastoma cells.", "journal": "The FEBS journal", "date": "2013", "authors": "Sattu K, Hochgrafe F, Wu J, Umapathy G, Schonherr C, Ruuth K, Chand D, Witek B, Fuchs J, Li PK, Hugosson F, Daly RJ, Palmer RH, Hallberg B", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "23889739", "url": "https://glygen.org/publication/PubMed/23889739" } ] }, { "title": "CXXC5 Associates with Smads to Mediate TNF-alpha Induced Apoptosis.", "journal": "Current molecular medicine", "date": "2013", "authors": "Wang X, Liao P, Fan X, Wan Y, Wang Y, Li Y, Jiang Z, Ye X, Mo X, Ocorr K, Deng Y, Wu X, Yuan W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23906331", "url": "https://glygen.org/publication/PubMed/23906331" } ] }, { "title": "STAT3 regulates MMP3 in heme-induced endothelial cell apoptosis.", "journal": "PloS one", "date": "2013", "authors": "Liu M, Wilson NO, Hibbert JM, Stiles JK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23967200", "url": "https://glygen.org/publication/PubMed/23967200" } ] }, { "title": "Deubiquitinating enzyme Usp12 is a novel co-activator of the androgen receptor.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Burska UL, Harle VJ, Coffey K, Darby S, Ramsey H, O'Neill D, Logan IR, Gaughan L, Robson CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "24056413", "url": "https://glygen.org/publication/PubMed/24056413" } ] }, { "title": "Mechanistic insight into ALK receptor tyrosine kinase in human cancer biology.", "journal": "Nature reviews. Cancer", "date": "2013", "authors": "Hallberg B, Palmer RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "24060861", "url": "https://glygen.org/publication/PubMed/24060861" } ] }, { "title": "The signal transducers Stat1 and Stat3 and their novel target Jmjd3 drive the expression of inflammatory genes in microglia.", "journal": "Journal of molecular medicine (Berlin, Germany)", "date": "2014", "authors": "Przanowski P, Dabrowski M, Ellert-Miklaszewska A, Kloss M, Mieczkowski J, Kaza B, Ronowicz A, Hu F, Piotrowski A, Kettenmann H, Komorowski J, Kaminska B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "24097101", "url": "https://glygen.org/publication/PubMed/24097101" } ] }, { "title": "Increased RCAS1 expression is associated with advanced histopathological stage and poor prognosis in patients with gastric adenocarcinoma.", "journal": "Disease markers", "date": "2013", "authors": "Giaginis C, Efkarpidis T, Alexandrou P, Patsouris E, Kouraklis G, Theocharis S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24167369", "url": "https://glygen.org/publication/PubMed/24167369" } ] }, { "title": "Myc is required for beta-catenin-mediated mammary stem cell amplification and tumorigenesis.", "journal": "Molecular cancer", "date": "2013", "authors": "Moumen M, Chiche A, Decraene C, Petit V, Gandarillas A, Deugnier MA, Glukhova MA, Faraldo MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-4411364", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4411364" } ], "reference": [ { "type": "PubMed", "id": "24171719", "url": "https://glygen.org/publication/PubMed/24171719" } ] }, { "title": "Ubiquitin-specific proteases 25 negatively regulates virus-induced type I interferon signaling.", "journal": "PloS one", "date": "2013", "authors": "Zhong H, Wang D, Fang L, Zhang H, Luo R, Shang M, Ouyang C, Ouyang H, Chen H, Xiao S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "24260525", "url": "https://glygen.org/publication/PubMed/24260525" } ] }, { "title": "Notch-Nrf2 axis: regulation of Nrf2 gene expression and cytoprotection by notch signaling.", "journal": "Molecular and cellular biology", "date": "2014", "authors": "Wakabayashi N, Skoko JJ, Chartoumpekis DV, Kimura S, Slocum SL, Noda K, Palliyaguru DL, Fujimuro M, Boley PA, Tanaka Y, Shigemura N, Biswal S, Yamamoto M, Kensler TW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9818749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818749" } ], "reference": [ { "type": "PubMed", "id": "24298019", "url": "https://glygen.org/publication/PubMed/24298019" } ] }, { "title": "Phosphorylation of heat shock protein 40 (Hsp40/DnaJB1) by mitogen-activated protein kinase-activated protein kinase 5 (MK5/PRAK).", "journal": "The international journal of biochemistry & cell biology", "date": "2014", "authors": "Kostenko S, Jensen KL, Moens U", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "24309468", "url": "https://glygen.org/publication/PubMed/24309468" } ] }, { "title": "ALK is a MYCN target gene and regulates cell migration and invasion in neuroblastoma.", "journal": "Scientific reports", "date": "2013", "authors": "Hasan MK, Nafady A, Takatori A, Kishida S, Ohira M, Suenaga Y, Hossain S, Akter J, Ogura A, Nakamura Y, Kadomatsu K, Nakagawara A", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "24356251", "url": "https://glygen.org/publication/PubMed/24356251" } ] }, { "title": "An H2A histone isotype regulates estrogen receptor target genes by mediating enhancer-promoter-3'-UTR interactions in breast cancer cells.", "journal": "Nucleic acids research", "date": "2014", "authors": "Su CH, Tzeng TY, Cheng C, Hsu MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24371278", "url": "https://glygen.org/publication/PubMed/24371278" } ] }, { "title": "Enhancement of differentiation induction and upregulation of CCAAT/enhancer-binding proteins and PU.1 in NB4 cells treated with combination of ATRA and valproic acid.", "journal": "International journal of oncology", "date": "2014", "authors": "Iriyama N, Yuan B, Yoshino Y, Hatta Y, Horikoshi A, Aizawa S, Takei M, Takeuchi J, Takagi N, Toyoda H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "24379003", "url": "https://glygen.org/publication/PubMed/24379003" } ] }, { "title": "USP21 negatively regulates antiviral response by acting as a RIG-I deubiquitinase.", "journal": "The Journal of experimental medicine", "date": "2014", "authors": "Fan Y, Mao R, Yu Y, Liu S, Shi Z, Cheng J, Zhang H, An L, Zhao Y, Xu X, Chen Z, Kogiso M, Zhang D, Zhang H, Zhang P, Jung JU, Li X, Xu G, Yang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "24493797", "url": "https://glygen.org/publication/PubMed/24493797" } ] }, { "title": "CEBPA-dependent HK3 and KLF5 expression in primary AML and during AML differentiation.", "journal": "Scientific reports", "date": "2014", "authors": "Federzoni EA, Humbert M, Torbett BE, Behre G, Fey MF, Tschan MP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "24584857", "url": "https://glygen.org/publication/PubMed/24584857" } ] }, { "title": "ERK3 promotes endothelial cell functions by upregulating SRC-3/SP1-mediated VEGFR2 expression.", "journal": "Journal of cellular physiology", "date": "2014", "authors": "Wang W, Bian K, Vallabhaneni S, Zhang B, Wu RC, O'Malley BW, Long W", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "24585635", "url": "https://glygen.org/publication/PubMed/24585635" } ] }, { "title": "Ceritinib in ALK-rearranged non-small-cell lung cancer.", "journal": "The New England journal of medicine", "date": "2014", "authors": "Shaw AT, Kim DW, Mehra R, Tan DS, Felip E, Chow LQ, Camidge DR, Vansteenkiste J, Sharma S, De Pas T, Riely GJ, Solomon BJ, Wolf J, Thomas M, Schuler M, Liu G, Santoro A, Lau YY, Goldwasser M, Boral AL, Engelman JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "24670165", "url": "https://glygen.org/publication/PubMed/24670165" } ] }, { "title": "Identification of miR-26 as a key mediator of estrogen stimulated cell proliferation by targeting CHD1, GREB1 and KPNA2.", "journal": "Breast cancer research : BCR", "date": "2014", "authors": "Tan S, Ding K, Li R, Zhang W, Li G, Kong X, Qian P, Lobie PE, Zhu T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24735615", "url": "https://glygen.org/publication/PubMed/24735615" } ] }, { "title": "Next-generation sequencing reveals a Novel NSCLC ALK F1174V mutation and confirms ALK G1202R mutation confers high-level resistance to alectinib (CH5424802/RO5424802) in ALK-rearranged NSCLC patients who progressed on crizotinib.", "journal": "Journal of thoracic oncology : official publication of the International Association for the Study of Lung Cancer", "date": "2014", "authors": "Ignatius Ou SH, Azada M, Hsiang DJ, Herman JM, Kain TS, Siwak-Tapp C, Casey C, He J, Ali SM, Klempner SJ, Miller VA", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "24736079", "url": "https://glygen.org/publication/PubMed/24736079" } ] }, { "title": "STAT3 Target Genes Relevant to Human Cancers.", "journal": "Cancers", "date": "2014", "authors": "Carpenter RL, Lo HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "24743777", "url": "https://glygen.org/publication/PubMed/24743777" } ] }, { "title": "Combination of PIM and JAK2 inhibitors synergistically suppresses MPN cell proliferation and overcomes drug resistance.", "journal": "Oncotarget", "date": "2014-05-30", "authors": "Huang Shih-Min A, Wang Anlai, Greco Rita, Li Zhifang, Barberis Claude, Tabart Michel, Patel Vinod, Schio Laurent, Hurley Raelene, Chen Bo, Cheng Hong, Lengauer Christoph, Pollard Jack, Watters James, Garcia-Echeverria Carlos, Wiederschain Dmitri, Adrian Francisco, Zhang JingXin", "evidence": [ { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" } ], "reference": [ { "type": "PubMed", "id": "24830942", "url": "https://glygen.org/publication/PubMed/24830942" } ] }, { "title": "Cohesin in cancer: chromosome segregation and beyond.", "journal": "Nature reviews. Cancer", "date": "2014", "authors": "Losada A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24854081", "url": "https://glygen.org/publication/PubMed/24854081" } ] }, { "title": "Apoptotic function of tumor-associated antigen RCAS1 in oral squamous cell carcinoma.", "journal": "Journal of translational medicine", "date": "2014", "authors": "Tanaka H, Toyoshima T, Sonoda K, Kitamura R, Sasaguri M, Kawano S, Matsubara R, Goto Y, Nakamura S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24885040", "url": "https://glygen.org/publication/PubMed/24885040" } ] }, { "title": "The mitochondrial deubiquitinase USP30 opposes parkin-mediated mitophagy.", "journal": "Nature", "date": "2014", "authors": "Bingol B, Tea JS, Phu L, Reichelt M, Bakalarski CE, Song Q, Foreman O, Kirkpatrick DS, Sheng M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "24896179", "url": "https://glygen.org/publication/PubMed/24896179" } ] }, { "title": "tRNA synthetase counteracts c-Myc to develop functional vasculature.", "journal": "eLife", "date": "2014", "authors": "Shi Y, Xu X, Zhang Q, Fu G, Mo Z, Wang GS, Kishi S, Yang XL", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "reference": [ { "type": "PubMed", "id": "24940000", "url": "https://glygen.org/publication/PubMed/24940000" } ] }, { "title": "Wild-type ALK and activating ALK-R1275Q and ALK-F1174L mutations upregulate Myc and initiate tumor formation in murine neural crest progenitor cells.", "journal": "Oncotarget", "date": "2014", "authors": "Montavon G, Jauquier N, Coulon A, Peuchmaur M, Flahaut M, Bourloud KB, Yan P, Delattre O, Sommer L, Joseph JM, Janoueix-Lerosey I, Gross N, Muhlethaler-Mottet A", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "24947326", "url": "https://glygen.org/publication/PubMed/24947326" } ] }, { "title": "A functional interplay between ZNF217 and estrogen receptor alpha exists in luminal breast cancers.", "journal": "Molecular oncology", "date": "2014", "authors": "Nguyen NT, Vendrell JA, Poulard C, Gyorffy B, Goddard-Leon S, Bieche I, Corbo L, Le Romancer M, Bachelot T, Treilleux I, Cohen PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24973012", "url": "https://glygen.org/publication/PubMed/24973012" } ] }, { "title": "Consideration of GREB1 as a potential therapeutic target for hormone-responsive or endocrine-resistant cancers.", "journal": "Expert opinion on therapeutic targets", "date": "2014", "authors": "Hodgkinson KM, Vanderhyden BC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24998469", "url": "https://glygen.org/publication/PubMed/24998469" } ] }, { "title": "Deubiquitination and stabilization of IL-33 by USP21.", "journal": "International journal of clinical and experimental pathology", "date": "2014", "authors": "Tao L, Chen C, Song H, Piccioni M, Shi G, Li B", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "25197364", "url": "https://glygen.org/publication/PubMed/25197364" } ] }, { "title": "Liver is the major source of elevated serum lipocalin-2 levels after bacterial infection or partial hepatectomy: a critical role for IL-6/STAT3.", "journal": "Hepatology (Baltimore, Md.)", "date": "2015", "authors": "Xu MJ, Feng D, Wu H, Wang H, Chan Y, Kolls J, Borregaard N, Porse B, Berger T, Mak TW, Cowland JB, Kong X, Gao B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "25234944", "url": "https://glygen.org/publication/PubMed/25234944" } ] }, { "title": "E1A-dependent trans-activation of the human MYC promoter is mediated by the E2F factor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Hiebert SW, Lipp M, Nevins JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "2524830", "url": "https://glygen.org/publication/PubMed/2524830" } ] }, { "title": "Serum receptor-binding cancer antigen expressed on SiSo cells (RCAS1) as a diagnostic and prognostic marker for non-small cell lung cancer.", "journal": "Tumori", "date": "2014", "authors": "Xu C, Yu LK, Zhang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25296600", "url": "https://glygen.org/publication/PubMed/25296600" } ] }, { "title": "The histone H2A deubiquitinase USP16 interacts with HERC2 and fine-tunes cellular response to DNA damage.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Zhang Z, Yang H, Wang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "25305019", "url": "https://glygen.org/publication/PubMed/25305019" } ] }, { "title": "Deorphanization of the human leukocyte tyrosine kinase (LTK) receptor by a signaling screen of the extracellular proteome.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014", "authors": "Zhang H, Pao LI, Zhou A, Brace AD, Halenbeck R, Hsu AW, Bray TL, Hestir K, Bosch E, Lee E, Wang G, Liu H, Wong BR, Kavanaugh WM, Williams LT", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "25331893", "url": "https://glygen.org/publication/PubMed/25331893" } ] }, { "title": "Heat shock protein 27 phosphorylation state is associated with cancer progression.", "journal": "Frontiers in genetics", "date": "2014", "authors": "Katsogiannou M, Andrieu C, Rocchi P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "25339975", "url": "https://glygen.org/publication/PubMed/25339975" } ] }, { "title": "Revisiting STAT3 signalling in cancer: new and unexpected biological functions.", "journal": "Nature reviews. Cancer", "date": "2014", "authors": "Yu H, Lee H, Herrmann A, Buettner R, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "25342631", "url": "https://glygen.org/publication/PubMed/25342631" } ] }, { "title": "EBAG9 modulates host immune defense against tumor formation and metastasis by regulating cytotoxic activity of T lymphocytes.", "journal": "Oncogenesis", "date": "2014", "authors": "Miyazaki T, Ikeda K, Horie-Inoue K, Kondo T, Takahashi S, Inoue S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25365482", "url": "https://glygen.org/publication/PubMed/25365482" } ] }, { "title": "Treatment Efficacy and Resistance Mechanisms Using the Second-Generation ALK Inhibitor AP26113 in Human NPM-ALK-Positive Anaplastic Large Cell Lymphoma.", "journal": "Molecular cancer research : MCR", "date": "2015", "authors": "Ceccon M, Mologni L, Giudici G, Piazza R, Pirola A, Fontana D, Gambacorti-Passerini C", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "25421750", "url": "https://glygen.org/publication/PubMed/25421750" } ] }, { "title": "CXXC5 regulates differentiation of C2C12 myoblasts into myocytes.", "journal": "Journal of muscle research and cell motility", "date": "2014", "authors": "Li G, Ye X, Peng X, Deng Y, Yuan W, Li Y, Mo X, Wang X, Wan Y, Liu X, Chen T, Jiang Z, Fan X, Wu X, Wang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25433557", "url": "https://glygen.org/publication/PubMed/25433557" } ] }, { "title": "AMBRA1 links autophagy to cell proliferation and tumorigenesis by promoting c-Myc dephosphorylation and degradation.", "journal": "Nature cell biology", "date": "2015", "authors": "Cianfanelli V, Fuoco C, Lorente M, Salazar M, Quondamatteo F, Gherardini PF, De Zio D, Nazio F, Antonioli M, D'Orazio M, Skobo T, Bordi M, Rohde M, Dalla Valle L, Helmer-Citterich M, Gretzmeier C, Dengjel J, Fimia GM, Piacentini M, Di Bartolomeo S, Velasco G, Cecconi F", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" }, { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" } ], "reference": [ { "type": "PubMed", "id": "25438055", "url": "https://glygen.org/publication/PubMed/25438055" } ] }, { "title": "Cohesin modulates transcription of estrogen-responsive genes.", "journal": "Biochimica et biophysica acta", "date": "2015", "authors": "Antony J, Dasgupta T, Rhodes JM, McEwan MV, Print CG, O'Sullivan JM, Horsfield JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25542856", "url": "https://glygen.org/publication/PubMed/25542856" } ] }, { "title": "The deubiquitinating enzyme USP24 is a regulator of the UV damage response.", "journal": "Cell reports", "date": "2015", "authors": "Zhang L, Nemzow L, Chen H, Lubin A, Rong X, Sun Z, Harris TK, Gong F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "25578727", "url": "https://glygen.org/publication/PubMed/25578727" } ] }, { "title": "CXXC5 is a negative-feedback regulator of the Wnt/beta-catenin pathway involved in osteoblast differentiation.", "journal": "Cell death and differentiation", "date": "2015", "authors": "Kim HY, Yoon JY, Yun JH, Cho KW, Lee SH, Rhee YM, Jung HS, Lim HJ, Lee H, Choi J, Heo JN, Lee W, No KT, Min D, Choi KY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25633194", "url": "https://glygen.org/publication/PubMed/25633194" } ] }, { "title": "Two Faces of Cathepsin D: Physiological Guardian Angel and Pathological Demon.", "journal": "Biology and medicine (Aligarh)", "date": "2014", "authors": "Khalkhali-Ellis Z, Hendrix MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25663755", "url": "https://glygen.org/publication/PubMed/25663755" } ] }, { "title": "Expression of RCAS1 correlates with urothelial bladder cancer malignancy.", "journal": "International journal of molecular sciences", "date": "2015", "authors": "Jozwicki W, Brozyna AA, Siekiera J, Slominski AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25674852", "url": "https://glygen.org/publication/PubMed/25674852" } ] }, { "title": "Structure of a biologically active estrogen receptor-coactivator complex on DNA.", "journal": "Molecular cell", "date": "2015", "authors": "Yi P, Wang Z, Feng Q, Pintilie GD, Foulds CE, Lanz RB, Ludtke SJ, Schmid MF, Chiu W, O'Malley BW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25728767", "url": "https://glygen.org/publication/PubMed/25728767" } ] }, { "title": "The nucleolar ubiquitin-specific protease USP36 deubiquitinates and stabilizes c-Myc.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2015", "authors": "Sun XX, He X, Yin L, Komada M, Sears RC, Dai MS", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "reference": [ { "type": "PubMed", "id": "25775507", "url": "https://glygen.org/publication/PubMed/25775507" } ] }, { "title": "miR-191 promotes tumorigenesis of human colorectal cancer through targeting C/EBPbeta.", "journal": "Oncotarget", "date": "2015", "authors": "Zhang XF, Li KK, Gao L, Li SZ, Chen K, Zhang JB, Wang D, Tu RF, Zhang JX, Tao KX, Wang G, Zhang XD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "25784653", "url": "https://glygen.org/publication/PubMed/25784653" } ] }, { "title": "AMBRA1 and BECLIN 1 interplay in the crosstalk between autophagy and cell proliferation.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2015", "authors": "Cianfanelli V, D'Orazio M, Cecconi F", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" }, { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" } ], "reference": [ { "type": "PubMed", "id": "25803737", "url": "https://glygen.org/publication/PubMed/25803737" } ] }, { "title": "The Nucleolar Protein GLTSCR2 Is an Upstream Negative Regulator of the Oncogenic Nucleophosmin-MYC Axis.", "journal": "The American journal of pathology", "date": "2015", "authors": "Kim JY, Cho YE, Park JH", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "reference": [ { "type": "PubMed", "id": "25956029", "url": "https://glygen.org/publication/PubMed/25956029" } ] }, { "title": "The Dishevelled-binding protein CXXC5 negatively regulates cutaneous wound healing.", "journal": "The Journal of experimental medicine", "date": "2015", "authors": "Lee SH, Kim MY, Kim HY, Lee YM, Kim H, Nam KA, Roh MR, Min do S, Chung KY, Choi KY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26056233", "url": "https://glygen.org/publication/PubMed/26056233" } ] }, { "title": "Progesterone receptor modulates ERalpha action in breast cancer.", "journal": "Nature", "date": "2015", "authors": "Mohammed H, Russell IA, Stark R, Rueda OM, Hickey TE, Tarulli GA, Serandour AA, Birrell SN, Bruna A, Saadi A, Menon S, Hadfield J, Pugh M, Raj GV, Brown GD, D'Santos C, Robinson JL, Silva G, Launchbury R, Perou CM, Stingl J, Caldas C, Tilley WD, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26153859", "url": "https://glygen.org/publication/PubMed/26153859" } ] }, { "title": "MiR-26b/KPNA2 axis inhibits epithelial ovarian carcinoma proliferation and metastasis through downregulating OCT4.", "journal": "Oncotarget", "date": "2015", "authors": "Lin J, Zhang L, Huang H, Huang Y, Huang L, Wang J, Huang S, He L, Zhou Y, Jia W, Yun J, Luo R, Zheng M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26204489", "url": "https://glygen.org/publication/PubMed/26204489" } ] }, { "title": "Perturbation biology nominates upstream-downstream drug combinations in RAF inhibitor resistant melanoma cells.", "journal": "eLife", "date": "2015-08-18", "authors": "Korkut Anil, Wang Weiqing, Demir Emek, Aksoy B\u00fclent Arman, Jing Xiaohong, Molinelli Evan J, Babur \u00d6zg\u00fcn, Bemis Debra L, Onur Sumer Selcuk, Solit David B, Pratilas Christine A, Sander Chris", "evidence": [ { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" } ], "reference": [ { "type": "PubMed", "id": "26284497", "url": "https://glygen.org/publication/PubMed/26284497" } ] }, { "title": "FAM150A and FAM150B are activating ligands for anaplastic lymphoma kinase.", "journal": "eLife", "date": "2015", "authors": "Guan J, Umapathy G, Yamazaki Y, Wolfstetter G, Mendoza P, Pfeifer K, Mohammed A, Hugosson F, Zhang H, Hsu AW, Halenbeck R, Hallberg B, Palmer RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "26418745", "url": "https://glygen.org/publication/PubMed/26418745" } ] }, { "title": "CXXC5 plays a role as a transcription activator for myelin genes on oligodendrocyte differentiation.", "journal": "Glia", "date": "2016", "authors": "Kim MY, Kim HY, Hong J, Kim D, Lee H, Cheong E, Lee Y, Roth J, Kim DG, Min do S, Choi KY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26462610", "url": "https://glygen.org/publication/PubMed/26462610" } ] }, { "title": "ALK F1174V mutation confers sensitivity while ALK I1171 mutation confers resistance to alectinib. The importance of serial biopsy post progression.", "journal": "Lung cancer (Amsterdam, Netherlands)", "date": "2016", "authors": "Ou SH, Milliken JC, Azada MC, Miller VA, Ali SM, Klempner SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "26464158", "url": "https://glygen.org/publication/PubMed/26464158" } ] }, { "title": "Trefoil factor family peptides--friends or foes?", "journal": "Biomolecular concepts", "date": "2015", "authors": "Busch M, Dunker N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26479350", "url": "https://glygen.org/publication/PubMed/26479350" } ] }, { "title": "Augmentor alpha and beta (FAM150) are ligands of the receptor tyrosine kinases ALK and LTK: Hierarchy and specificity of ligand-receptor interactions.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2015", "authors": "Reshetnyak AV, Murray PB, Shi X, Mo ES, Mohanty J, Tome F, Bai H, Gunel M, Lax I, Schlessinger J", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "26630010", "url": "https://glygen.org/publication/PubMed/26630010" } ] }, { "title": "Myc oncoproteins are phosphorylated by casein kinase II.", "journal": "The EMBO journal", "date": "1989", "authors": "Luscher B, Kuenzel EA, Krebs EG, Eisenman RN", "evidence": [ { "database": "iPTMnet", "id": "P01106-2", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106-2" } ], "reference": [ { "type": "PubMed", "id": "2663470", "url": "https://glygen.org/publication/PubMed/2663470" } ] }, { "title": "Alectinib in ALK-positive, crizotinib-resistant, non-small-cell lung cancer: a single-group, multicentre, phase 2 trial.", "journal": "The Lancet. Oncology", "date": "2016", "authors": "Shaw AT, Gandhi L, Gadgeel S, Riely GJ, Cetnar J, West H, Camidge DR, Socinski MA, Chiappori A, Mekhail T, Chao BH, Borghaei H, Gold KA, Zeaiter A, Bordogna W, Balas B, Puig O, Henschel V, Ou SI", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "26708155", "url": "https://glygen.org/publication/PubMed/26708155" } ] }, { "title": "Steroid Receptors Reprogram FoxA1 Occupancy through Dynamic Chromatin Transitions.", "journal": "Cell", "date": "2016", "authors": "Swinstead EE, Miranda TB, Paakinaho V, Baek S, Goldstein I, Hawkins M, Karpova TS, Ball D, Mazza D, Lavis LD, Grimm JB, Morisaki T, Grontved L, Presman DM, Hager GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "27062924", "url": "https://glygen.org/publication/PubMed/27062924" } ] }, { "title": "Nuclear factor E2F mediates basic transcription and trans-activation by E1a of the human MYC promoter.", "journal": "Genes & development", "date": "1989", "authors": "Thalmeier K, Synovzik H, Mertz R, Winnacker EL, Lipp M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "2721961", "url": "https://glygen.org/publication/PubMed/2721961" } ] }, { "title": "O-linked GlcNAcylation elevated by HPV E6 mediates viral oncogenesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2016", "authors": "Zeng Q, Zhao RX, Chen J, Li Y, Li XD, Liu XL, Zhang WM, Quan CS, Wang YS, Zhai YX, Wang JW, Youssef M, Cui R, Liang J, Genovese N, Chow LT, Li YL, Xu ZX", "evidence": [ { "database": "O-GlcNAc Database", "id": "P01106", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01106" } ], "reference": [ { "type": "PubMed", "id": "27482104", "url": "https://glygen.org/publication/PubMed/27482104" } ] }, { "title": "Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms.", "journal": "Cancer cell", "date": "2016", "authors": "Buren S, Gomes AL, Teijeiro A, Fawal MA, Yilmaz M, Tummala KS, Perez M, Rodriguez-Justo M, Campos-Olivas R, Megias D, Djouder N", "evidence": [ { "database": "O-GlcNAc Database", "id": "P01106", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01106" } ], "reference": [ { "type": "PubMed", "id": "27505673", "url": "https://glygen.org/publication/PubMed/27505673" } ] }, { "title": "The Potent ALK Inhibitor Brigatinib (AP26113) Overcomes Mechanisms of Resistance to First- and Second-Generation ALK Inhibitors in Preclinical Models.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2016", "authors": "Zhang S, Anjum R, Squillace R, Nadworny S, Zhou T, Keats J, Ning Y, Wardwell SD, Miller D, Song Y, Eichinger L, Moran L, Huang WS, Liu S, Zou D, Wang Y, Mohemmad Q, Jang HG, Ye E, Narasimhan N, Wang F, Miret J, Zhu X, Clackson T, Dalgarno D, Shakespeare WC, Rivera VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "27780853", "url": "https://glygen.org/publication/PubMed/27780853" } ] }, { "title": "Estradiol-Estrogen Receptor alpha Mediates the Expression of the CXXC5 Gene through the Estrogen Response Element-Dependent Signaling Pathway.", "journal": "Scientific reports", "date": "2016", "authors": "Yasar P, Ayaz G, Muyan M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "27886276", "url": "https://glygen.org/publication/PubMed/27886276" } ] }, { "title": "Membrane and Nuclear Estrogen Receptor Alpha Actions: From Tissue Specificity to Medical Implications.", "journal": "Physiological reviews", "date": "2017", "authors": "Arnal JF, Lenfant F, Metivier R, Flouriot G, Henrion D, Adlanmerini M, Fontaine C, Gourdy P, Chambon P, Katzenellenbogen B, Katzenellenbogen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "28539435", "url": "https://glygen.org/publication/PubMed/28539435" } ] }, { "title": "Hyper-O-GlcNAcylation induces cisplatin resistance via regulation of p53 and c-Myc in human lung carcinoma.", "journal": "Scientific reports", "date": "2017", "authors": "Luanpitpong S, Angsutararux P, Samart P, Chanthra N, Chanvorachote P, Issaragrisil S", "evidence": [ { "database": "O-GlcNAc Database", "id": "P01106", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01106" } ], "reference": [ { "type": "PubMed", "id": "28878262", "url": "https://glygen.org/publication/PubMed/28878262" } ] }, { "title": "Estrogen-responsive element of the human pS2 gene is an imperfectly palindromic sequence.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Berry M, Nunez AM, Chambon P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "2919170", "url": "https://glygen.org/publication/PubMed/2919170" } ] }, { "title": "Biological and Genetic Features of Neuroblastoma and Their Clinical Importance.", "journal": "Current pediatric reviews", "date": "2018", "authors": "Aygun N", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "29380702", "url": "https://glygen.org/publication/PubMed/29380702" } ] }, { "title": "C/EBPalpha overrides epigenetic reprogramming by oncogenic transcription factors in acute myeloid leukemia.", "journal": "Blood advances", "date": "2018", "authors": "Loke J, Chin PS, Keane P, Pickin A, Assi SA, Ptasinska A, Imperato MR, Cockerill PN, Bonifer C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "29431622", "url": "https://glygen.org/publication/PubMed/29431622" } ] }, { "title": "NRF2 addiction in cancer cells.", "journal": "Cancer science", "date": "2018", "authors": "Kitamura H, Motohashi H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9818749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818749" } ], "reference": [ { "type": "PubMed", "id": "29450944", "url": "https://glygen.org/publication/PubMed/29450944" } ] }, { "title": "Role and targeting of anaplastic lymphoma kinase in cancer.", "journal": "Molecular cancer", "date": "2018", "authors": "Della Corte CM, Viscardi G, Di Liello R, Fasano M, Martinelli E, Troiani T, Ciardiello F, Morgillo F", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "29455642", "url": "https://glygen.org/publication/PubMed/29455642" } ] }, { "title": "Synergy between the KEAP1/NRF2 and PI3K Pathways Drives Non-Small-Cell Lung Cancer with an Altered Immune Microenvironment.", "journal": "Cell metabolism", "date": "2018", "authors": "Best SA, De Souza DP, Kersbergen A, Policheni AN, Dayalan S, Tull D, Rathi V, Gray DH, Ritchie ME, McConville MJ, Sutherland KD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9818749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818749" } ], "reference": [ { "type": "PubMed", "id": "29526543", "url": "https://glygen.org/publication/PubMed/29526543" } ] }, { "title": "The Eukaryotic Proteome Is Shaped by E3 Ubiquitin Ligases Targeting C-Terminal Degrons.", "journal": "Cell", "date": "2018", "authors": "Koren I, Timms RT, Kula T, Xu Q, Li MZ, Elledge SJ", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "reference": [ { "type": "PubMed", "id": "29779948", "url": "https://glygen.org/publication/PubMed/29779948" } ] }, { "title": "STAT3: a multifaceted oncoprotein.", "journal": "Growth factors (Chur, Switzerland)", "date": "2018", "authors": "Guanizo AC, Fernando CD, Garama DJ, Gough DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "29873274", "url": "https://glygen.org/publication/PubMed/29873274" } ] }, { "title": "Structural and clinical consequences of activation loop mutations in class III receptor tyrosine kinases.", "journal": "Pharmacology & therapeutics", "date": "2018", "authors": "Klug LR, Kent JD, Heinrich MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "29964125", "url": "https://glygen.org/publication/PubMed/29964125" } ] }, { "title": "Identification of a biologically active fragment of ALK and LTK-Ligand 2 (augmentor-alpha).", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2018", "authors": "Reshetnyak AV, Mohanty J, Tome F, Puleo DE, Plotnikov AN, Ahmed M, Kaur N, Poliakov A, Cinnaiyan AM, Lax I, Schlessinger J", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "30061385", "url": "https://glygen.org/publication/PubMed/30061385" } ] }, { "title": "Parallel study on protein O-GlcNAcylation in prostate cancer cell with a sensitive microarray biochip.", "journal": "Analytical biochemistry", "date": "2018", "authors": "Lei L, Xie J, Yu J, Li Y, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P01106", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01106" } ], "reference": [ { "type": "PubMed", "id": "30086259", "url": "https://glygen.org/publication/PubMed/30086259" } ] }, { "title": "O-GlcNAcylation is required for mutant KRAS-induced lung tumorigenesis.", "journal": "The Journal of clinical investigation", "date": "2018", "authors": "Taparra K, Wang H, Malek R, Lafargue A, Barbhuiya MA, Wang X, Simons BW, Ballew M, Nugent K, Groves J, Williams RD, Shiraishi T, Verdone J, Yildirir G, Henry R, Zhang B, Wong J, Wang KK, Nelkin BD, Pienta KJ, Felsher D, Zachara NE, Tran PT", "evidence": [ { "database": "O-GlcNAc Database", "id": "P01106", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01106" } ], "reference": [ { "type": "PubMed", "id": "30130254", "url": "https://glygen.org/publication/PubMed/30130254" } ] }, { "title": "Transcriptional regulation of c-myc oncogene expression by estrogen in hormone-responsive human breast cancer cells.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Dubik D, Shiu RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3045126", "url": "https://glygen.org/publication/PubMed/3045126" } ] }, { "title": "The Transcriptional Regulator Sin3A Contributes to the Oncogenic Potential of STAT3.", "journal": "Cancer research", "date": "2019", "authors": "Gambi G, Di Simone E, Basso V, Ricci L, Wang R, Verma A, Elemento O, Ponzoni M, Inghirami G, Icardi L, Mondino A", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "30692217", "url": "https://glygen.org/publication/PubMed/30692217" } ] }, { "title": "TRAF3 regulates the oncogenic proteins Pim2 and c-Myc to restrain survival in normal and malignant B cells.", "journal": "Scientific reports", "date": "2019", "authors": "Whillock AL, Mambetsariev N, Lin WW, Stunz LL, Bishop GA", "evidence": [ { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" } ], "reference": [ { "type": "PubMed", "id": "31501481", "url": "https://glygen.org/publication/PubMed/31501481" } ] }, { "title": "Diverse Resistance Mechanisms to the Third-Generation ALK Inhibitor Lorlatinib in ALK-Rearranged Lung Cancer.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2020", "authors": "Recondo G, Mezquita L, Facchinetti F, Planchard D, Gazzah A, Bigot L, Rizvi AZ, Frias RL, Thiery JP, Scoazec JY, Sourisseau T, Howarth K, Deas O, Samofalova D, Galissant J, Tesson P, Braye F, Naltet C, Lavaud P, Mahjoubi L, Abou Lovergne A, Vassal G, Bahleda R, Hollebecque A, Nicotra C, Ngo-Camus M, Michiels S, Lacroix L, Richon C, Auger N, De Baere T, Tselikas L, Solary E, Angevin E, Eggermont AM, Andre F, Massard C, Olaussen KA, Soria JC, Besse B, Friboulet L", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "31585938", "url": "https://glygen.org/publication/PubMed/31585938" } ] }, { "title": "TGF-beta1 Increases GDNF Production by Upregulating the Expression of GDNF and Furin in Human Granulosa-Lutein Cells.", "journal": "Cells", "date": "2020", "authors": "Yin J, Chang HM, Yi Y, Yao Y, Leung PCK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "31936902", "url": "https://glygen.org/publication/PubMed/31936902" } ] }, { "title": "The Role of the Pentose Phosphate Pathway in Diabetes and Cancer.", "journal": "Frontiers in endocrinology", "date": "2020", "authors": "Ge T, Yang J, Zhou S, Wang Y, Li Y, Tong X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9818749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818749" } ], "reference": [ { "type": "PubMed", "id": "32582032", "url": "https://glygen.org/publication/PubMed/32582032" } ] }, { "title": "NRF2, a Transcription Factor for Stress Response and Beyond.", "journal": "International journal of molecular sciences", "date": "2020", "authors": "He F, Ru X, Wen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9818749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818749" } ], "reference": [ { "type": "PubMed", "id": "32640524", "url": "https://glygen.org/publication/PubMed/32640524" } ] }, { "title": "Oxidative Stress in Cancer.", "journal": "Cancer cell", "date": "2020", "authors": "Hayes JD, Dinkova-Kostova AT, Tew KD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9818749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818749" } ], "reference": [ { "type": "PubMed", "id": "32649885", "url": "https://glygen.org/publication/PubMed/32649885" } ] }, { "title": "A novel TRPM7/O-GlcNAc axis mediates tumour cell motility and metastasis by stabilising c-Myc and caveolin-1 in lung carcinoma.", "journal": "British journal of cancer", "date": "2020", "authors": "Luanpitpong S, Rodboon N, Samart P, Vinayanuwattikun C, Klamkhlai S, Chanvorachote P, Rojanasakul Y, Issaragrisil S", "evidence": [ { "database": "O-GlcNAc Database", "id": "P01106", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01106" } ], "reference": [ { "type": "PubMed", "id": "32684624", "url": "https://glygen.org/publication/PubMed/32684624" } ] }, { "title": "A non-AUG translational initiation in c-myc exon 1 generates an N-terminally distinct protein whose synthesis is disrupted in Burkitt's lymphomas.", "journal": "Cell", "date": "1988", "authors": "Hann SR, King MW, Bentley DL, Anderson CW, Eisenman RN", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" }, { "database": "RefSeq", "id": "NP_002458", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002458" } ], "reference": [ { "type": "PubMed", "id": "3277717", "url": "https://glygen.org/publication/PubMed/3277717" } ] }, { "title": "A transcriptional arrest mechanism involved in controlling constitutive levels of mouse c-myb mRNA.", "journal": "Oncogene", "date": "1988", "authors": "Watson RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3281094", "url": "https://glygen.org/publication/PubMed/3281094" } ] }, { "title": "Metabolic sensor O-GlcNAcylation regulates megakaryopoiesis and thrombopoiesis through c-Myc stabilization and integrin perturbation.", "journal": "Stem cells (Dayton, Ohio)", "date": "2021", "authors": "Luanpitpong S, Poohadsuan J, Klaihmon P, Kang X, Tangkiettrakul K, Issaragrisil S", "evidence": [ { "database": "O-GlcNAc Database", "id": "P01106", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01106" } ], "reference": [ { "type": "PubMed", "id": "33544938", "url": "https://glygen.org/publication/PubMed/33544938" } ] }, { "title": "c-MYC-directed NRF2 drives malignant progression of head and neck cancer via glucose-6-phosphate dehydrogenase and transketolase activation.", "journal": "Theranostics", "date": "2021", "authors": "Tang YC, Hsiao JR, Jiang SS, Chang JY, Chu PY, Liu KJ, Fang HL, Lin LM, Chen HH, Huang YW, Chen YT, Tsai FY, Lin SF, Chuang YJ, Kuo CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9818749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818749" } ], "reference": [ { "type": "PubMed", "id": "33859744", "url": "https://glygen.org/publication/PubMed/33859744" } ] }, { "title": "The 9aaTAD Activation Domains in the Yamanaka Transcription Factors Oct4, Sox2, Myc, and Klf4.", "journal": "Stem. Cell. Rev. Rep.", "date": "2021", "authors": "Piskacek Martin, Otasevic Tomas, Repko Martin, Knight Andrea", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "reference": [ { "type": "PubMed", "id": "34342803", "url": "https://glygen.org/publication/PubMed/34342803" } ] }, { "title": "Structural basis of cytokine-mediated activation of ALK family receptors.", "journal": "Nature", "date": "2021", "authors": "De Munck S, Provost M, Kurikawa M, Omori I, Mukohyama J, Felix J, Bloch Y, Abdel-Wahab O, Bazan JF, Yoshimi A, Savvides SN", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "34646012", "url": "https://glygen.org/publication/PubMed/34646012" } ] }, { "title": "Inhibiting Hyper-O-GlcNAcylation of c-Myc accelerate diabetic wound healing by alleviating keratinocyte dysfunction.", "journal": "Burns & trauma", "date": "2021", "authors": "Zhang J, Yang P, Liu D, Gao M, Wang J, Yu T, Zhang X, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P01106", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01106" } ], "reference": [ { "type": "PubMed", "id": "34646892", "url": "https://glygen.org/publication/PubMed/34646892" } ] }, { "title": "Mechanism for the activation of the anaplastic lymphoma kinase receptor.", "journal": "Nature", "date": "2021", "authors": "Reshetnyak AV, Rossi P, Myasnikov AG, Sowaileh M, Mohanty J, Nourse A, Miller DJ, Lax I, Schlessinger J, Kalodimos CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "34819673", "url": "https://glygen.org/publication/PubMed/34819673" } ] }, { "title": "Differential expression of c-myb mRNA in murine B lymphomas by a block to transcription elongation.", "journal": "Science (New York, N.Y.)", "date": "1987", "authors": "Bender TP, Thompson CB, Kuehl WM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3498214", "url": "https://glygen.org/publication/PubMed/3498214" } ] }, { "title": "SLC35B4 Stabilizes c-MYC Protein by O-GlcNAcylation in HCC.", "journal": "Frontiers in pharmacology", "date": "2022", "authors": "Jiang T, Yang J, Yang H, Chen W, Ji K, Xu Y, Yu L", "evidence": [ { "database": "O-GlcNAc Database", "id": "P01106", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01106" } ], "reference": [ { "type": "PubMed", "id": "35308201", "url": "https://glygen.org/publication/PubMed/35308201" } ] }, { "title": "Novel promoter upstream of the human c-myc gene and regulation of c-myc expression in B-cell lymphomas.", "journal": "Mol. Cell. Biol.", "date": "1986", "authors": "Bentley D L, Groudine M", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "reference": [ { "type": "PubMed", "id": "3540591", "url": "https://glygen.org/publication/PubMed/3540591" } ] }, { "title": "Stimulation of c-myc oncogene expression associated with estrogen-induced proliferation of human breast cancer cells.", "journal": "Cancer research", "date": "1987", "authors": "Dubik D, Dembinski TC, Shiu RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3677090", "url": "https://glygen.org/publication/PubMed/3677090" } ] }, { "title": "OGT Binding Peptide-Tagged Strategy Increases Protein O-GlcNAcylation Level in E. coli.", "journal": "Molecules (Basel, Switzerland)", "date": "2023-02-24", "authors": "Li Yang, Yang Zelan, Chen Jia, Chen Yihao, Jiang Chengji, Zhong Tao, Su Yanting, Liang Yi, Sun Hui", "evidence": [ { "database": "O-GlcNAc Database", "id": "P01106", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01106" } ], "reference": [ { "type": "PubMed", "id": "36903375", "url": "https://glygen.org/publication/PubMed/36903375" } ] }, { "title": "Identification of a diketopiperazine-based O-GlcNAc transferase inhibitor sensitizing hepatocellular carcinoma to CDK9 inhibition.", "journal": "The FEBS journal", "date": "2023-09", "authors": "Shan Xiaoqun, Jiang Rong, Gou Dongmei, Xiang Jin, Zhou Peng, Xia Jie, Wang Kai, Huang Ailong, Tang Ni, Huang Luyi", "evidence": [ { "database": "O-GlcNAc Database", "id": "P01106", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01106" } ], "reference": [ { "type": "PubMed", "id": "37247228", "url": "https://glygen.org/publication/PubMed/37247228" } ] }, { "title": "Isoform-Directed Control of c-Myc Functions: Understanding the Balance from Proliferation to Growth Arrest.", "journal": "International journal of molecular sciences", "date": "2023-12-15", "authors": "Kubickova Agata, De Sanctis Juan Bautista, Hajduch Marian", "evidence": [ { "database": "RefSeq", "id": "NP_002458", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002458" } ], "reference": [ { "type": "PubMed", "id": "38139353", "url": "https://glygen.org/publication/PubMed/38139353" } ] }, { "title": "A recurrent de novo MAX p.Arg60Gln variant causes a syndromic overgrowth disorder through differential expression of c-Myc target genes.", "journal": "American journal of human genetics", "date": "2024-01-04", "authors": "Harris Erica L, Roy Vincent, Montagne Martin, Rose Ailsa M S, Livesey Helen, Reijnders Margot R F, Hobson Emma, Sansbury Francis H, Willemsen Marjolein H, Pfundt Rolph, Warren Daniel, Long Vernon, Carr Ian M, Brunner Han G, Sheridan Eamonn G, Firth Helen V, Lavigne Pierre, Poulter James A", "evidence": [ { "database": "RefSeq", "id": "NP_002458", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002458" } ], "reference": [ { "type": "PubMed", "id": "38141607", "url": "https://glygen.org/publication/PubMed/38141607" } ] }, { "title": "NCAPG2 promotes prostate cancer malignancy and stemness via STAT3/c-MYC signaling.", "journal": "Journal of translational medicine", "date": "2024-01-02", "authors": "Zhang Enchong, Chen Zhengjie, Liu Wangmin, Lin Lin, Wu Lina, Guan Johnny, Wang Jianfeng, Kong Chuize, Bi Jianbin, Zhang Mo", "evidence": [ { "database": "RefSeq", "id": "NP_002458", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002458" } ], "reference": [ { "type": "PubMed", "id": "38166947", "url": "https://glygen.org/publication/PubMed/38166947" } ] }, { "title": "Lysine demethylase 5C inhibits transcription of prefoldin subunit 5 to activate c-Myc signal transduction and colorectal cancer progression.", "journal": "Molecular medicine (Cambridge, Mass.)", "date": "2024-01-12", "authors": "Yu Fulong, Li Liang, Gu Yimei, Wang Song, Zhou Lianbang, Cheng Xiaohu, Jiang Heng, Huang Yang, Zhang Yingfeng, Qian Wenbao, Li Xianghua, Liu Zhining", "evidence": [ { "database": "RefSeq", "id": "NP_002458", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002458" } ], "reference": [ { "type": "PubMed", "id": "38216914", "url": "https://glygen.org/publication/PubMed/38216914" } ] }, { "title": "Ribogenesis boosts controlled by HEATR1-MYC interplay promote transition into brain tumour growth.", "journal": "EMBO reports", "date": "2024-01", "authors": "Diaz Laura R, Gil-Ranedo Jon, Jaworek Karolina J, Nsek Nsikan, Marques Joao Pinheiro, Costa Eleni, Hilton David A, Bieluczyk Hubert, Warrington Oliver, Hanemann C Oliver, Futschik Matthias E, Bossing Torsten, Barros Claudia S", "evidence": [ { "database": "RefSeq", "id": "NP_002458", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002458" } ], "reference": [ { "type": "PubMed", "id": "38225354", "url": "https://glygen.org/publication/PubMed/38225354" } ] }, { "title": "Identification and nucleotide sequence of a human locus homologous to the v-myc oncogene of avian myelocytomatosis virus MC29.", "journal": "Nature", "date": "1983", "authors": "Colby W W, Chen E Y, Smith D H, Levinson A D", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "reference": [ { "type": "PubMed", "id": "6298632", "url": "https://glygen.org/publication/PubMed/6298632" } ] }, { "title": "Nucleotide sequence of cloned cDNA of human c-myc oncogene.", "journal": "Nature", "date": "1983", "authors": "Watt R, Stanton L W, Marcu K B, Gallo R C, Croce C M, Rovera G", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "reference": [ { "type": "PubMed", "id": "6304538", "url": "https://glygen.org/publication/PubMed/6304538" } ] }, { "title": "Nucleotide sequence analysis of human c-myc locus, chicken homologue, and myelocytomatosis virus MC29 transforming gene reveals a highly conserved gene product.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1983", "authors": "Watson D K, Psallidopoulos M C, Samuel K P, Dalla-Favera R, Papas T S", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "reference": [ { "type": "PubMed", "id": "6304729", "url": "https://glygen.org/publication/PubMed/6304729" } ] }, { "title": "Sequence of the murine and human cellular myc oncogenes and two modes of myc transcription resulting from chromosome translocation in B lymphoid tumours.", "journal": "EMBO J.", "date": "1983", "authors": "Bernard O, Cory S, Gerondakis S, Webb E, Adams J M", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "reference": [ { "type": "PubMed", "id": "6321164", "url": "https://glygen.org/publication/PubMed/6321164" } ] }, { "title": "The human c-myc oncogene: structural consequences of translocation into the IgH locus in Burkitt lymphoma.", "journal": "Cell", "date": "1983", "authors": "Battey J, Moulding C, Taub R, Murphy W, Stewart T, Potter H, Lenoir G, Leder P", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "reference": [ { "type": "PubMed", "id": "6414718", "url": "https://glygen.org/publication/PubMed/6414718" } ] }, { "title": "Altered nucleotide sequences of a translocated c-myc gene in Burkitt lymphoma.", "journal": "Nature", "date": "1983", "authors": "Rabbitts TH, Hamlyn PH, Baer R", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "reference": [ { "type": "PubMed", "id": "6419122", "url": "https://glygen.org/publication/PubMed/6419122" } ] }, { "title": "Effect of somatic mutation within translocated c-myc genes in Burkitt's lymphoma.", "journal": "Nature", "date": "1984", "authors": "Rabbitts T H, Forster A, Hamlyn P, Baer R", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "reference": [ { "type": "PubMed", "id": "6547209", "url": "https://glygen.org/publication/PubMed/6547209" } ] }, { "title": "Nucleotide sequence of the human c-myc locus: provocative open reading frame within the first exon.", "journal": "EMBO J.", "date": "1984", "authors": "Gazin C, Dupont de Dinechin S, Hampe A, Masson J M, Martin P, Stehelin D, Galibert F", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "reference": [ { "type": "PubMed", "id": "6714223", "url": "https://glygen.org/publication/PubMed/6714223" } ] }, { "title": "Interferon activation of the transcription factor Stat91 involves dimerization through SH2-phosphotyrosyl peptide interactions.", "journal": "Cell", "date": "1994", "authors": "Shuai K, Horvath CM, Huang LH, Qureshi SA, Cowburn D, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7510216", "url": "https://glygen.org/publication/PubMed/7510216" } ] }, { "title": "Molecular cloning of APRF, a novel IFN-stimulated gene factor 3 p91-related transcription factor involved in the gp130-mediated signaling pathway.", "journal": "Cell", "date": "1994", "authors": "Akira S, Nishio Y, Inoue M, Wang XJ, Wei S, Matsusaka T, Yoshida K, Sudo T, Naruto M, Kishimoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7512451", "url": "https://glygen.org/publication/PubMed/7512451" } ] }, { "title": "IL-13 selectively induces vascular cell adhesion molecule-1 expression in human endothelial cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1995", "authors": "Bochner BS, Klunk DA, Sterbinsky SA, Coffman RL, Schleimer RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7529288", "url": "https://glygen.org/publication/PubMed/7529288" } ] }, { "title": "Transforming p21ras mutants and c-Ets-2 activate the cyclin D1 promoter through distinguishable regions.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Albanese C, Johnson J, Watanabe G, Eklund N, Vu D, Arnold A, Pestell RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "7559524", "url": "https://glygen.org/publication/PubMed/7559524" } ] }, { "title": "Molecular cloning of a new member of the p21-Cdc42/Rac-activated kinase (PAK) family.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Manser E, Chong C, Zhao ZS, Leung T, Michael G, Hall C, Lim L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "7559638", "url": "https://glygen.org/publication/PubMed/7559638" } ] }, { "title": "Signalling downstream of activated mammalian Notch.", "journal": "Nature", "date": "1995", "authors": "Jarriault S, Brou C, Logeat F, Schroeter EH, Kopan R, Israel A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "7566092", "url": "https://glygen.org/publication/PubMed/7566092" } ] }, { "title": "Metabolism of the polyubiquitin degradation signal: structure, mechanism, and role of isopeptidase T.", "journal": "Biochemistry", "date": "1995", "authors": "Wilkinson KD, Tashayev VL, O'Connor LB, Larsen CN, Kasperek E, Pickart CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "7578059", "url": "https://glygen.org/publication/PubMed/7578059" } ] }, { "title": "Disruption of the mouse RBP-J kappa gene results in early embryonic death.", "journal": "Development (Cambridge, England)", "date": "1995", "authors": "Oka C, Nakano T, Wakeham A, de la Pompa JL, Mori C, Sakai T, Okazaki S, Kawaichi M, Shiota K, Mak TW, Honjo T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "7588063", "url": "https://glygen.org/publication/PubMed/7588063" } ] }, { "title": "Cellular targets for activation by the E2F1 transcription factor include DNA synthesis- and G1/S-regulatory genes.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "DeGregori J, Kowalik T, Nevins JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362277", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362277" } ], "reference": [ { "type": "PubMed", "id": "7623816", "url": "https://glygen.org/publication/PubMed/7623816" } ] }, { "title": "Both p16 and p21 families of cyclin-dependent kinase (CDK) inhibitors block the phosphorylation of cyclin-dependent kinases by the CDK-activating kinase.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Aprelikova O, Xiong Y, Liu ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-69656", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69656" } ], "reference": [ { "type": "PubMed", "id": "7629134", "url": "https://glygen.org/publication/PubMed/7629134" } ] }, { "title": "c-Myc is glycosylated at threonine 58, a known phosphorylation site and a mutational hot spot in lymphomas.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Chou TY, Hart GW, Dang CV", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106#ptm_processing" }, { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" }, { "database": "O-GlcNAc Database", "id": "P01106", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01106" } ], "reference": [ { "type": "PubMed", "id": "7642555", "url": "https://glygen.org/publication/PubMed/7642555" } ] }, { "title": "Regulation of the human WEE1Hu CDK tyrosine 15-kinase during the cell cycle.", "journal": "The EMBO journal", "date": "1995", "authors": "Watanabe N, Broome M, Hunter T", "evidence": [ { "database": "Reactome", "id": "R-HSA-69202", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69202" } ], "reference": [ { "type": "PubMed", "id": "7743995", "url": "https://glygen.org/publication/PubMed/7743995" } ] }, { "title": "Glycosylation of the c-Myc transactivation domain.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Chou TY, Dang CV, Hart GW", "evidence": [ { "database": "O-GlcNAc Database", "id": "P01106", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01106" } ], "reference": [ { "type": "PubMed", "id": "7753821", "url": "https://glygen.org/publication/PubMed/7753821" } ] }, { "title": "Direct evidence of a heterotrimeric complex of human interleukin-4 with its receptors.", "journal": "Protein science : a publication of the Protein Society", "date": "1995", "authors": "Hoffman RC, Castner BJ, Gerhart M, Gibson MG, Rasmussen BD, March CJ, Weatherbee J, Tsang M, Gustchina A, Schalk-Hihi C, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7795521", "url": "https://glygen.org/publication/PubMed/7795521" } ] }, { "title": "Components of a Stat recognition code: evidence for two layers of molecular selectivity.", "journal": "Immunity", "date": "1995", "authors": "Schindler U, Wu P, Rothe M, Brasseur M, McKnight SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7796300", "url": "https://glygen.org/publication/PubMed/7796300" } ] }, { "title": "Effects of phosphorylation by CAK on cyclin binding by CDC2 and CDK2.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "Desai D, Wessling HC, Fisher RP, Morgan DO", "evidence": [ { "database": "Reactome", "id": "R-HSA-69202", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69202" } ], "reference": [ { "type": "PubMed", "id": "7799941", "url": "https://glygen.org/publication/PubMed/7799941" } ] }, { "title": "Modulation of cellular thermoresistance and actin filament stability accompanies phosphorylation-induced changes in the oligomeric structure of heat shock protein 27.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "Lavoie JN, Lambert H, Hickey E, Weber LA, Landry J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "7799959", "url": "https://glygen.org/publication/PubMed/7799959" } ] }, { "title": "Autoregulation of the human C/EBP alpha gene by stimulation of upstream stimulatory factor binding.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "Timchenko N, Wilson DR, Taylor LR, Abdelsayed S, Wilde M, Sawadogo M, Darlington GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "7862113", "url": "https://glygen.org/publication/PubMed/7862113" } ] }, { "title": "Transcriptional regulation of the junB promoter: analysis of STAT-mediated signal transduction.", "journal": "Oncogene", "date": "1995", "authors": "Coffer P, Lutticken C, van Puijenbroek A, Klop-de Jonge M, Horn F, Kruijer W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7898939", "url": "https://glygen.org/publication/PubMed/7898939" } ] }, { "title": "Interleukin 13, an interleukin 4-like cytokine that acts on monocytes and B cells, but not on T cells.", "journal": "Immunology today", "date": "1994", "authors": "Zurawski G, de Vries JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7907877", "url": "https://glygen.org/publication/PubMed/7907877" } ] }, { "title": "Characterization of the proximal estrogen-responsive element of human cathepsin D gene.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1994", "authors": "Augereau P, Miralles F, Cavailles V, Gaudelet C, Parker M, Rochefort H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "7935485", "url": "https://glygen.org/publication/PubMed/7935485" } ] }, { "title": "Interaction of proteins with transcriptionally active estrogen receptors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Cavailles V, Dauvois S, Danielian PS, Parker MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "7937828", "url": "https://glygen.org/publication/PubMed/7937828" } ] }, { "title": "Groucho is required for Drosophila neurogenesis, segmentation, and sex determination and interacts directly with hairy-related bHLH proteins.", "journal": "Cell", "date": "1994", "authors": "Paroush Z, Finley RL Jr, Kidd T, Wainwright SM, Ingham PW, Brent R, Ish-Horowicz D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "8001118", "url": "https://glygen.org/publication/PubMed/8001118" } ] }, { "title": "Developmental control of a G1-S transcriptional program in Drosophila.", "journal": "Development (Cambridge, England)", "date": "1994", "authors": "Duronio RJ, O'Farrell PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362277", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362277" } ], "reference": [ { "type": "PubMed", "id": "8050359", "url": "https://glygen.org/publication/PubMed/8050359" } ] }, { "title": "An interleukin-4-induced transcription factor: IL-4 Stat.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Hou J, Schindler U, Henzel WJ, Ho TC, Brasseur M, McKnight SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8085155", "url": "https://glygen.org/publication/PubMed/8085155" } ] }, { "title": "A brain serine/threonine protein kinase activated by Cdc42 and Rac1.", "journal": "Nature", "date": "1994", "authors": "Manser E, Leung T, Salihuddin H, Zhao ZS, Lim L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "8107774", "url": "https://glygen.org/publication/PubMed/8107774" } ] }, { "title": "Estrogen receptor-Sp1 complexes mediate estrogen-induced cathepsin D gene expression in MCF-7 human breast cancer cells.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Krishnan V, Wang X, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8195246", "url": "https://glygen.org/publication/PubMed/8195246" } ] }, { "title": "Estrogen receptor-associated proteins: possible mediators of hormone-induced transcription.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Halachmi S, Marden E, Martin G, MacKay H, Abbondanza C, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8197458", "url": "https://glygen.org/publication/PubMed/8197458" } ] }, { "title": "Point mutations in the c-Myc transactivation domain are common in Burkitt's lymphoma and mouse plasmacytomas.", "journal": "Nature genetics", "date": "1993", "authors": "Bhatia K, Huppi K, Spangler G, Siwarski D, Iyer R, Magrath I", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "reference": [ { "type": "PubMed", "id": "8220424", "url": "https://glygen.org/publication/PubMed/8220424" } ] }, { "title": "Transactivation of gene expression by Myc is inhibited by mutation at the phosphorylation sites Thr-58 and Ser-62.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Gupta S, Seth A, Davis RJ", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" }, { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" } ], "reference": [ { "type": "PubMed", "id": "8386367", "url": "https://glygen.org/publication/PubMed/8386367" } ] }, { "title": "Cathepsin D gene is controlled by a mixed promoter, and estrogens stimulate only TATA-dependent transcription in breast cancer cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Cavailles V, Augereau P, Rochefort H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8419924", "url": "https://glygen.org/publication/PubMed/8419924" } ] }, { "title": "Allele-specific activation of the c-myc gene in an atypical Burkitt's lymphoma carrying the t(2;8) chromosomal translocation 250 kb downstream from c-myc.", "journal": "Gene", "date": "1993", "authors": "Tachibana K, Takayama N, Matsuo K, Kato S, Yamamoto K, Ohyama K, Umezawa A, Takano T", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "reference": [ { "type": "PubMed", "id": "8444346", "url": "https://glygen.org/publication/PubMed/8444346" } ] }, { "title": "Essential role of Stat6 in IL-4 signalling.", "journal": "Nature", "date": "1996", "authors": "Takeda K, Tanaka T, Shi W, Matsumoto M, Minami M, Kashiwamura S, Nakanishi K, Yoshida N, Kishimoto T, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8602263", "url": "https://glygen.org/publication/PubMed/8602263" } ] }, { "title": "STAT3 participates in transcriptional activation of the C-reactive protein gene by interleukin-6.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Zhang D, Sun M, Samols D, Kushner I", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8621622", "url": "https://glygen.org/publication/PubMed/8621622" } ] }, { "title": "Characterization of the transforming activity of p80, a hyperphosphorylated protein in a Ki-1 lymphoma cell line with chromosomal translocation t(2;5).", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Fujimoto J, Shiota M, Iwahara T, Seki N, Satoh H, Mori S, Yamamoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "8633037", "url": "https://glygen.org/publication/PubMed/8633037" } ] }, { "title": "The WRPW motif of the hairy-related basic helix-loop-helix repressor proteins acts as a 4-amino-acid transcription repression and protein-protein interaction domain.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Fisher AL, Ohsako S, Caudy M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "8649374", "url": "https://glygen.org/publication/PubMed/8649374" } ] }, { "title": "Cloning and characterization of a specific interleukin (IL)-13 binding protein structurally related to the IL-5 receptor alpha chain.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Caput D, Laurent P, Kaghad M, Lelias JM, Lefort S, Vita N, Ferrara P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8663118", "url": "https://glygen.org/publication/PubMed/8663118" } ] }, { "title": "The lipopolysaccharide-binding protein is a secretory class 1 acute-phase protein whose gene is transcriptionally activated by APRF/STAT/3 and other cytokine-inducible nuclear proteins.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Schumann RR, Kirschning CJ, Unbehaun A, Aberle HP, Knope HP, Lamping N, Ulevitch RJ, Herrmann F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8668165", "url": "https://glygen.org/publication/PubMed/8668165" } ] }, { "title": "Molecular interaction between TLE1 and the carboxyl-terminal domain of HES-1 containing the WRPW motif.", "journal": "Biochemical and biophysical research communications", "date": "1996", "authors": "Grbavec D, Stifani S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "8687460", "url": "https://glygen.org/publication/PubMed/8687460" } ] }, { "title": "PU.1 (Spi-1) and C/EBP alpha regulate the granulocyte colony-stimulating factor receptor promoter in myeloid cells.", "journal": "Blood", "date": "1996", "authors": "Smith LT, Hohaus S, Gonzalez DA, Dziennis SE, Tenen DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "8695841", "url": "https://glygen.org/publication/PubMed/8695841" } ] }, { "title": "Cdc25 cell-cycle phosphatase as a target of c-myc.", "journal": "Nature", "date": "1996", "authors": "Galaktionov K, Chen X, Beach D", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362277", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362277" } ], "reference": [ { "type": "PubMed", "id": "8700224", "url": "https://glygen.org/publication/PubMed/8700224" } ] }, { "title": "Global and local determinants for the kinetics of interleukin-4/interleukin-4 receptor alpha chain interaction. A biosensor study employing recombinant interleukin-4-binding protein.", "journal": "European journal of biochemistry", "date": "1996", "authors": "Shen BJ, Hage T, Sebald W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8797861", "url": "https://glygen.org/publication/PubMed/8797861" } ] }, { "title": "Requirements for interleukin-4-induced gene expression and functional characterization of Stat6.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Mikita T, Campbell D, Wu P, Williamson K, Schindler U", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8816495", "url": "https://glygen.org/publication/PubMed/8816495" } ] }, { "title": "CCAAT/enhancer-binding protein alpha (C/EBP alpha) inhibits cell proliferation through the p21 (WAF-1/CIP-1/SDI-1) protein.", "journal": "Genes & development", "date": "1996", "authors": "Timchenko NA, Wilde M, Nakanishi M, Smith JR, Darlington GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "8846917", "url": "https://glygen.org/publication/PubMed/8846917" } ] }, { "title": "p300 is a component of an estrogen receptor coactivator complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Hanstein B, Eckner R, DiRenzo J, Halachmi S, Liu H, Searcy B, Kurokawa R, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8876171", "url": "https://glygen.org/publication/PubMed/8876171" } ] }, { "title": "AP2 inhibits cancer cell growth and activates p21WAF1/CIP1 expression.", "journal": "Nature genetics", "date": "1997", "authors": "Zeng YX, Somasundaram K, el-Deiry WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866911", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866911" } ], "reference": [ { "type": "PubMed", "id": "8988173", "url": "https://glygen.org/publication/PubMed/8988173" } ] }, { "title": "Cloning of the human IL-13R alpha1 chain and reconstitution with the IL4R alpha of a functional IL-4/IL-13 receptor complex.", "journal": "FEBS letters", "date": "1997", "authors": "Miloux B, Laurent P, Bonnin O, Lupker J, Caput D, Vita N, Ferrara P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9013879", "url": "https://glygen.org/publication/PubMed/9013879" } ] }, { "title": "CCAAT/enhancer binding protein epsilon is preferentially up-regulated during granulocytic differentiation and its functional versatility is determined by alternative use of promoters and differential splicing.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Yamanaka R, Kim GD, Radomska HS, Lekstrom-Himes J, Smith LT, Antonson P, Tenen DG, Xanthopoulos KG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "9177240", "url": "https://glygen.org/publication/PubMed/9177240" } ] }, { "title": "Identification of a functional imperfect estrogen-responsive element in the 5'-promoter region of the human cathepsin D gene.", "journal": "Biochemistry", "date": "1997", "authors": "Wang F, Porter W, Xing W, Archer TK, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9201922", "url": "https://glygen.org/publication/PubMed/9201922" } ] }, { "title": "Kuzbanian controls proteolytic processing of Notch and mediates lateral inhibition during Drosophila and vertebrate neurogenesis.", "journal": "Cell", "date": "1997", "authors": "Pan D, Rubin GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "9244301", "url": "https://glygen.org/publication/PubMed/9244301" } ] }, { "title": "Isolation and functional analysis of a cDNA for human Jagged2, a gene encoding a ligand for the Notch1 receptor.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Luo B, Aster JC, Hasserjian RP, Kuo F, Sklar J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "9315665", "url": "https://glygen.org/publication/PubMed/9315665" } ] }, { "title": "c-Raf kinase binds to N-terminal domain of c-Myc.", "journal": "FEBS letters", "date": "1997", "authors": "Alexandrov I, Shlyakhova L, Vartanian A, Zajac-Kaye M, Alexandrova N", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" }, { "database": "iPTMnet", "id": "P01106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01106" } ], "reference": [ { "type": "PubMed", "id": "9315742", "url": "https://glygen.org/publication/PubMed/9315742" } ] }, { "title": "Molecular basis of agonism and antagonism in the oestrogen receptor.", "journal": "Nature", "date": "1997", "authors": "Brzozowski AM, Pike AC, Dauter Z, Hubbard RE, Bonn T, Engstrom O, Ohman L, Greene GL, Gustafsson JA, Carlquist M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9338790", "url": "https://glygen.org/publication/PubMed/9338790" } ] }, { "title": "Nucleosome positioning and transcription-associated chromatin alterations on the human estrogen-responsive pS2 promoter.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Sewack GF, Hansen U", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9388265", "url": "https://glygen.org/publication/PubMed/9388265" } ] }, { "title": "The human homolog of rat Jagged1 expressed by marrow stroma inhibits differentiation of 32D cells through interaction with Notch1.", "journal": "Immunity", "date": "1998", "authors": "Li L, Milner LA, Deng Y, Iwata M, Banta A, Graf L, Marcovina S, Friedman C, Trask BJ, Hood L, Torok-Storb B", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "9462510", "url": "https://glygen.org/publication/PubMed/9462510" } ] }, { "title": "Identification of a substrate-targeting domain in cyclin E necessary for phosphorylation of the retinoblastoma protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Kelly BL, Wolfe KG, Roberts JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-69202", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69202" } ], "reference": [ { "type": "PubMed", "id": "9482921", "url": "https://glygen.org/publication/PubMed/9482921" } ] }, { "title": "Cdc6 is regulated by E2F and is essential for DNA replication in mammalian cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Yan Z, DeGregori J, Shohet R, Leone G, Stillman B, Nevins JR, Williams RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362277", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362277" } ], "reference": [ { "type": "PubMed", "id": "9520412", "url": "https://glygen.org/publication/PubMed/9520412" } ] }, { "title": "Interaction of Rac1 with GTPase-activating proteins and putative effectors. A comparison with Cdc42 and RhoA.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Zhang B, Chernoff J, Zheng Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "9535855", "url": "https://glygen.org/publication/PubMed/9535855" } ] }, { "title": "Nuclear access and action of notch in vivo.", "journal": "Cell", "date": "1998", "authors": "Struhl G, Adachi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "9604939", "url": "https://glygen.org/publication/PubMed/9604939" } ] }, { "title": "Functional and physical interactions between the estrogen receptor Sp1 and nuclear aryl hydrocarbon receptor complexes.", "journal": "Nucleic acids research", "date": "1998", "authors": "Wang F, Hoivik D, Pollenz R, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9611253", "url": "https://glygen.org/publication/PubMed/9611253" } ] }, { "title": "Notch-1 signalling requires ligand-induced proteolytic release of intracellular domain.", "journal": "Nature", "date": "1998", "authors": "Schroeter EH, Kisslinger JA, Kopan R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "9620803", "url": "https://glygen.org/publication/PubMed/9620803" } ] }, { "title": "PRAK, a novel protein kinase regulated by the p38 MAP kinase.", "journal": "The EMBO journal", "date": "1998", "authors": "New L, Jiang Y, Zhao M, Liu K, Zhu W, Flood LJ, Kato Y, Parry GC, Han J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "9628874", "url": "https://glygen.org/publication/PubMed/9628874" } ] }, { "title": "Cytoplasmic displacement of cyclin E-cdk2 inhibitors p21Cip1 and p27Kip1 in anchorage-independent cells.", "journal": "Oncogene", "date": "1998", "authors": "Orend G, Hunter T, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-69202", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69202" } ], "reference": [ { "type": "PubMed", "id": "9632134", "url": "https://glygen.org/publication/PubMed/9632134" } ] }, { "title": "Mutational analysis of the STAT6 SH2 domain.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Mikita T, Daniel C, Wu P, Schindler U", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9651359", "url": "https://glygen.org/publication/PubMed/9651359" } ] }, { "title": "Indirect evidence for Delta-dependent intracellular processing of notch in Drosophila embryos.", "journal": "Current biology : CB", "date": "1998", "authors": "Lecourtois M, Schweisguth F", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "9651681", "url": "https://glygen.org/publication/PubMed/9651681" } ] }, { "title": "c-Myc or cyclin D1 mimics estrogen effects on cyclin E-Cdk2 activation and cell cycle reentry.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Prall OW, Rogan EM, Musgrove EA, Watts CK, Sutherland RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9671459", "url": "https://glygen.org/publication/PubMed/9671459" } ] }, { "title": "Insights into the mechanism of heterodimerization from the 1H-NMR solution structure of the c-Myc-Max heterodimeric leucine zipper.", "journal": "J. Mol. Biol.", "date": "1998", "authors": "Lavigne P, Crump M P, Gagn\u00e9 S M, Hodges R S, Kay C M, Sykes B D", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "reference": [ { "type": "PubMed", "id": "9680483", "url": "https://glygen.org/publication/PubMed/9680483" } ] }, { "title": "A histone deacetylase corepressor complex regulates the Notch signal transduction pathway.", "journal": "Genes & development", "date": "1998", "authors": "Kao HY, Ordentlich P, Koyano-Nakagawa N, Tang Z, Downes M, Kintner CR, Evans RM, Kadesch T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "9694793", "url": "https://glygen.org/publication/PubMed/9694793" } ] }, { "title": "The role of IL-13 and its receptor in allergy and inflammatory responses.", "journal": "The Journal of allergy and clinical immunology", "date": "1998", "authors": "de Vries JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9723655", "url": "https://glygen.org/publication/PubMed/9723655" } ] }, { "title": "Identification of c-MYC as a target of the APC pathway.", "journal": "Science (New York, N.Y.)", "date": "1998", "authors": "He TC, Sparks AB, Rago C, Hermeking H, Zawel L, da Costa LT, Morin PJ, Vogelstein B, Kinzler KW", "evidence": [ { "database": "Reactome", "id": "R-HSA-4411364", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4411364" } ], "reference": [ { "type": "PubMed", "id": "9727977", "url": "https://glygen.org/publication/PubMed/9727977" } ] }, { "title": "Upstream stimulatory factors mediate estrogen receptor activation of the cathepsin D promoter.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1998", "authors": "Xing W, Archer TK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9731700", "url": "https://glygen.org/publication/PubMed/9731700" } ] }, { "title": "Interferon-gamma-induced factor binding to the interleukin-4-responsive element of CD23b promoter in human tonsillar mononuclear cells: role in transient up-regulation of the interleukin-4-induced CD23b mRNA.", "journal": "Molecular immunology", "date": "1998", "authors": "Park HJ, So EY, Lee CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9736340", "url": "https://glygen.org/publication/PubMed/9736340" } ] }, { "title": "Cyclin D3: requirement for G1/S transition and high abundance in quiescent tissues suggest a dual role in proliferation and differentiation.", "journal": "Oncogene", "date": "1998", "authors": "Bartkova J, Lukas J, Strauss M, Bartek J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "9747882", "url": "https://glygen.org/publication/PubMed/9747882" } ] }, { "title": "Regulation of cell growth-dependent expression of mammalian CDC6 gene by the cell cycle transcription factor E2F.", "journal": "Oncogene", "date": "1998", "authors": "Ohtani K, Tsujimoto A, Ikeda M, Nakamura M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362277", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362277" } ], "reference": [ { "type": "PubMed", "id": "9778043", "url": "https://glygen.org/publication/PubMed/9778043" } ] }, { "title": "Nucleophosmin-anaplastic lymphoma kinase of large-cell anaplastic lymphoma is a constitutively active tyrosine kinase that utilizes phospholipase C-gamma to mediate its mitogenicity.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Bai RY, Dieter P, Peschel C, Morris SW, Duyster J", "evidence": [ { "database": "Reactome", "id": "R-HSA-201556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556" } ], "reference": [ { "type": "PubMed", "id": "9819383", "url": "https://glygen.org/publication/PubMed/9819383" } ] }, { "title": "Delta-1 activation of notch-1 signaling results in HES-1 transactivation.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Jarriault S, Le Bail O, Hirsinger E, Pourquie O, Logeat F, Strong CF, Brou C, Seidah NG, Isra l A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "9819428", "url": "https://glygen.org/publication/PubMed/9819428" } ] }, { "title": "Induction of 15-lipoxygenase expression by IL-13 requires tyrosine phosphorylation of Jak2 and Tyk2 in human monocytes.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Roy B, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9822675", "url": "https://glygen.org/publication/PubMed/9822675" } ] }, { "title": "STAT3 is required for the gp130-mediated full activation of the c-myc gene.", "journal": "The Journal of experimental medicine", "date": "1999", "authors": "Kiuchi N, Nakajima K, Ichiba M, Fukada T, Narimatsu M, Mizuno K, Hibi M, Hirano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9874564", "url": "https://glygen.org/publication/PubMed/9874564" } ] }, { "title": "Retinoblastoma protein contains a C-terminal motif that targets it for phosphorylation by cyclin-cdk complexes.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Adams PD, Li X, Sellers WR, Baker KB, Leng X, Harper JW, Taya Y, Kaelin WG Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-69202", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69202" } ], "reference": [ { "type": "PubMed", "id": "9891042", "url": "https://glygen.org/publication/PubMed/9891042" } ] } ], "pathway": [ { "id": "hsa:4609", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:4609", "resource": "KEGG Pathway" }, { "id": "R-HSA-1362277", "name": "Transcription of E2F targets under negative control by DREAM complex", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362277", "resource": "Reactome", "description": "Transcription of E2F targets under negative control by DREAM complex" }, { "id": "R-HSA-201556", "name": "Signaling by ALK", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556", "resource": "Reactome", "description": "Signaling by ALK" }, { "id": "R-HSA-2122947", "name": "NOTCH1 Intracellular Domain Regulates Transcription", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947", "resource": "Reactome", "description": "NOTCH1 Intracellular Domain Regulates Transcription" }, { "id": "R-HSA-2173796", "name": "SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796", "resource": "Reactome", "description": "SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription" }, { "id": "R-HSA-2644606", "name": "Constitutive Signaling by NOTCH1 PEST Domain Mutants", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606", "resource": "Reactome", "description": "Constitutive Signaling by NOTCH1 PEST Domain Mutants" }, { "id": "R-HSA-2894862", "name": "Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2894862", "resource": "Reactome", "description": "Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants" }, { "id": "R-HSA-4411364", "name": "Binding of TCF/LEF:CTNNB1 to target gene promoters", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4411364", "resource": "Reactome", "description": "Binding of TCF/LEF:CTNNB1 to target gene promoters" }, { "id": "R-HSA-5687128", "name": "MAPK6/MAPK4 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128", "resource": "Reactome", "description": "MAPK6/MAPK4 signaling" }, { "id": "R-HSA-5689880", "name": "Ub-specific processing proteases", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880", "resource": "Reactome", "description": "Ub-specific processing proteases" }, { "id": "R-HSA-6785807", "name": "Interleukin-4 and Interleukin-13 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807", "resource": "Reactome", "description": "Interleukin-4 and Interleukin-13 signaling" }, { "id": "R-HSA-69202", "name": "Cyclin E associated events during G1/S transition", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69202", "resource": "Reactome", "description": "Cyclin E associated events during G1/S transition" }, { "id": "R-HSA-69656", "name": "Cyclin A:Cdk2-associated events at S phase entry", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69656", "resource": "Reactome", "description": "Cyclin A:Cdk2-associated events at S phase entry" }, { "id": "R-HSA-8866911", "name": "TFAP2 (AP-2) family regulates transcription of cell cycle factors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866911", "resource": "Reactome", "description": "TFAP2 (AP-2) family regulates transcription of cell cycle factors" }, { "id": "R-HSA-8951430", "name": "RUNX3 regulates WNT signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951430", "resource": "Reactome", "description": "RUNX3 regulates WNT signaling" }, { "id": "R-HSA-9018519", "name": "Estrogen-dependent gene expression", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519", "resource": "Reactome", "description": "Estrogen-dependent gene expression" }, { "id": "R-HSA-9616222", "name": "Transcriptional regulation of granulopoiesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222", "resource": "Reactome", "description": "Transcriptional regulation of granulopoiesis" }, { "id": "R-HSA-9818749", "name": "Regulation of NFE2L2 gene expression", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818749", "resource": "Reactome", "description": "Regulation of NFE2L2 gene expression" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A5G2RGQ3-1", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "LDFLRIVENPQAAAMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVASFSPRGDDDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFINIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPIPARGHGGYSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKPCASPDSTAFSPSSDSLLSSAESSPRASPEPLALHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQPPAKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPSAKRAKLDSGRVLKQISNNRKCASPRSSDTEENDKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLVSEKDVLRKRREQLKLKLEQLRNSCP", "length": 452 }, "evidence": [ { "id": "P01106", "url": "https://omabrowser.org/oma/group/P01106/", "database": "OMA" } ], "common_name": "Pig" }, { "uniprot_canonical_ac": "P01108-1", "protein_name": "Myc proto-oncogene protein", "gene_name": "Myc", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MDFLWALETPQTATTMPLNVNFTNRNYDLDYDSVQPYFICDEEENFYHQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVATSFSPREDDDGGGGNFSTADQLEMMTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSTSLSPARGHSVCSTSSLYLQDLTAAASECIDPSVVFPYPLNDSSSPKSCTSSDSTAFSPSSDSLLSSESSPRASPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQTPAKRSESGSSPSRGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRKCSSPRSSDTEENDKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSIQADEHKLTSEKDLLRKRREQLKHKLEQLRNSGA", "length": 454 }, "evidence": [ { "id": "45917533", "url": "http://www.informatics.jax.org/homology/45917533", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P09416-1", "protein_name": "Myc proto-oncogene protein", "gene_name": "Myc", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MNFLWEVENPTVTTMPLNVSFANRNYDLDYDSVQPYFICDEEENFYHQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVATSFSPREDDDGGGGNFSTADQLEMMTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSTSLSPARGHSVCSTSSLYLQDLTAAASECIDPSVVFPYPLNDSSSPKSCTSSDSTAFSSSSDSLLSSESSPRATPEPLVLHEETPPTTSSDSEEEQDDEEEIDVVSVEKRQPPAKRSESGSSPSRGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRKCSSPRSSDTEENDKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQADEHKLISEKDLLRKRREQLKHKLEQLRNSGA", "length": 453 }, "evidence": [ { "id": "45917533", "url": "http://www.informatics.jax.org/homology/45917533", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P15063-1", "protein_name": "Protein B-Myc", "gene_name": "Mycb", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MPLHVSLANGNRDLDYDSVQPYFMCDDEEEDVHQQPPQPPAPSEDIWKKFELLPTPRPSPGHPGLYSPPCEAVAASFSPRDHDGDSFSTADLPELPGDAVKQSFVCDPDDETFVKNIILQDCMWNGFSASAKLVSKLDPYQAVRKEGASVSPAADVEPATPPDCTCNT", "length": 168 }, "evidence": [ { "id": "45917534", "url": "http://www.informatics.jax.org/homology/45917534", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q6P8Z1-1", "protein_name": "Protein B-Myc", "gene_name": "Mycb", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MPLHVSLANGNRDLDYDSVQPYFMCDDEEEDVHHQQPPQPPAPSEDIWKKFELLPTPRPSPGHAGLYSPPCEAVAVSFAPRDHDGDSFSIADLPELPGGDAVKQSFVCDPDDETFVKNIILQDCMWNGFSASAKLVSKLDPYQAVRKEGTGVSLAADVEPATPPDCTCNT", "length": 170 }, "evidence": [ { "id": "45917534", "url": "http://www.informatics.jax.org/homology/45917534", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 40, "go_terms": [ { "name": "regulation of telomere maintenance", "id": "GO:0032204", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032204", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "chromatin remodeling", "id": "GO:0006338", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006338", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "positive regulation of cell population proliferation", "id": "GO:0008284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008284", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "response to gamma radiation", "id": "GO:0010332", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010332", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "positive regulation of gene expression", "id": "GO:0010628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "negative regulation of apoptotic process", "id": "GO:0043066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043066", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "positive regulation of cysteine-type endopeptidase activity involved in apoptotic process", "id": "GO:0043280", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043280", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "MAPK cascade", "id": "GO:0000165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000165", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "intracellular iron ion homeostasis", "id": "GO:0006879", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006879", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "cellular response to xenobiotic stimulus", "id": "GO:0071466", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071466", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "cellular response to hypoxia", "id": "GO:0071456", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071456", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "DNA damage response", "id": "GO:0006974", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006974", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "positive regulation of telomerase activity", "id": "GO:0051973", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051973", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "negative regulation of fibroblast proliferation", "id": "GO:0048147", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048147", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "ERK1 and ERK2 cascade", "id": "GO:0070371", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070371", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "G1/S transition of mitotic cell cycle", "id": "GO:0000082", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000082", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "positive regulation of fibroblast proliferation", "id": "GO:0048146", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048146", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "response to growth factor", "id": "GO:0070848", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070848", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "regulation of gene expression", "id": "GO:0010468", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010468", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "response to xenobiotic stimulus", "id": "GO:0009410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009410", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "cellular response to UV", "id": "GO:0034644", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034644", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "positive regulation of epithelial cell proliferation", "id": "GO:0050679", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050679", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "branching involved in ureteric bud morphogenesis", "id": "GO:0001658", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001658", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "negative regulation of cell division", "id": "GO:0051782", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051782", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "negative regulation of monocyte differentiation", "id": "GO:0045656", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045656", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "protein-DNA complex disassembly", "id": "GO:0032986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032986", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "positive regulation of metanephric cap mesenchymal cell proliferation", "id": "GO:0090096", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090096", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "DNA methylation-dependent heterochromatin formation", "id": "GO:0006346", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006346", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "regulation of cell cycle process", "id": "GO:0010564", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010564", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "positive regulation of mesenchymal cell proliferation", "id": "GO:0002053", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002053", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "positive regulation of miRNA transcription", "id": "GO:1902895", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902895", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "fibroblast apoptotic process", "id": "GO:0044346", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044346", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "chromosome organization", "id": "GO:0051276", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051276", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator", "id": "GO:1902255", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902255", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "negative regulation of stress-activated MAPK cascade", "id": "GO:0032873", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032873", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "regulation of somatic stem cell population maintenance", "id": "GO:1904672", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904672", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 13, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "protein dimerization activity", "id": "GO:0046983", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046983", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "protein-containing complex binding", "id": "GO:0044877", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044877", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "DNA-binding transcription repressor activity, RNA polymerase II-specific", "id": "GO:0001227", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001227", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "DNA-binding transcription activator activity, RNA polymerase II-specific", "id": "GO:0001228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001228", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "E-box binding", "id": "GO:0070888", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070888", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "core promoter sequence-specific DNA binding", "id": "GO:0001046", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001046", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "transcription coregulator binding", "id": "GO:0001221", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001221", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "SCF ubiquitin ligase complex binding", "id": "GO:1905761", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905761", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "DNA-binding transcription factor binding", "id": "GO:0140297", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140297", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "transcription regulator activator activity", "id": "GO:0140537", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140537", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "nucleolus", "id": "GO:0005730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "chromatin", "id": "GO:0000785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000785", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "protein-containing complex", "id": "GO:0032991", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032991", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "RNA polymerase II transcription repressor complex", "id": "GO:0090571", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090571", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" }, { "name": "Myc-Max complex", "id": "GO:0071943", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071943", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 127, "end_pos": 129, "annotation": "n_glycosylation_sequon" }, { "start_pos": 19, "end_pos": 21, "annotation": "n_glycosylation_sequon" }, { "start_pos": 215, "end_pos": 217, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylated by PRKDC (PubMed:1597196). Phosphorylation at Ser-344 by PIM2 leads to the stabilization of MYC (By similarity). Phosphorylation at Ser-77 by CDK2 prevents Ras-induced senescence (PubMed:19966300, PubMed:20713526). Phosphorylated at Ser-77 by DYRK2; this primes the protein for subsequent phosphorylation by GSK3B at Thr-73 (PubMed:22307329). Phosphorylation at Thr-73 and Ser-77 by GSK3 is required for ubiquitination and degradation by the proteasome (PubMed:15103331, PubMed:17558397, PubMed:8386367). Dephosphorylation at Ser-77 by protein phosphatase 2A (PPP2CA) promotes its degradation; interaction with PPP2CA is enhanced by AMBRA1 (PubMed:25803737, PubMed:25438055).", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" }, { "database": "PubMed", "id": "15103331", "url": "https://glygen.org/publication/PubMed/15103331" }, { "database": "PubMed", "id": "17558397", "url": "https://glygen.org/publication/PubMed/17558397" }, { "database": "PubMed", "id": "19966300", "url": "https://glygen.org/publication/PubMed/19966300" }, { "database": "PubMed", "id": "8386367", "url": "https://glygen.org/publication/PubMed/8386367" }, { "database": "PubMed", "id": "20713526", "url": "https://glygen.org/publication/PubMed/20713526" }, { "database": "PubMed", "id": "22307329", "url": "https://glygen.org/publication/PubMed/22307329" }, { "database": "PubMed", "id": "1597196", "url": "https://glygen.org/publication/PubMed/1597196" }, { "database": "PubMed", "id": "25438055", "url": "https://glygen.org/publication/PubMed/25438055" }, { "database": "PubMed", "id": "25803737", "url": "https://glygen.org/publication/PubMed/25803737" } ] }, { "annotation": "Ubiquitinated by the SCF(FBXW7) complex when phosphorylated at Thr-73 and Ser-77, leading to its degradation by the proteasome (PubMed:15103331, PubMed:17558397, PubMed:25775507). In the nucleoplasm, ubiquitination is counteracted by USP28, which interacts with isoform 1 of FBXW7 (FBW7alpha), leading to its deubiquitination and preventing degradation (PubMed:17873522, PubMed:17558397). In the nucleolus, however, ubiquitination is not counteracted by USP28 but by USP36, due to the lack of interaction between isoform 3 of FBXW7 (FBW7gamma) and USP28, explaining the selective MYC degradation in the nucleolus (PubMed:17558397, PubMed:25775507). Also polyubiquitinated by the DCX(TRPC4AP) complex (PubMed:20551172, PubMed:29779948). Ubiquitinated by TRIM6 in a phosphorylation-independent manner (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprot/P01106" }, { "database": "PubMed", "id": "15103331", "url": "https://glygen.org/publication/PubMed/15103331" }, { "database": "PubMed", "id": "17558397", "url": "https://glygen.org/publication/PubMed/17558397" }, { "database": "PubMed", "id": "17873522", "url": "https://glygen.org/publication/PubMed/17873522" }, { "database": "PubMed", "id": "25775507", "url": "https://glygen.org/publication/PubMed/25775507" }, { "database": "PubMed", "id": "20551172", "url": "https://glygen.org/publication/PubMed/20551172" }, { "database": "PubMed", "id": "29779948", "url": "https://glygen.org/publication/PubMed/29779948" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 73 ], "snv_sites": [ 26, 73, 136, 216, 217, 227, 453 ], "glycation_sites": [], "phosphorylation_sites": [ 21, 23, 73, 77, 79, 86, 88, 176, 217, 308, 329, 344, 358, 359, 363, 365 ], "sequon_annotation_sites": [ { "start_pos": 127, "end_pos": 129 }, { "start_pos": 19, "end_pos": 21 }, { "start_pos": 215, "end_pos": 217 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 23 }, { "field": "total_sites", "count": 16 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 639 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }