{ "uniprot_canonical_ac": "P01100-1", "uniprot_ac": "P01100", "uniprot_id": "FOS_HUMAN", "mass": { "chemical_mass": 40695.0, "monoisotopic_mass": 40695.0 }, "refseq": { "ac": "NP_005243", "name": "protein c-Fos", "summary": "The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005243" }, "gene_names": [ { "name": "FOS", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P01100", "id": "P01100" }, { "name": "AP-1; C-FOS; p55", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005243", "id": "NP_005243" }, { "name": "FOS", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005243", "id": "NP_005243" }, { "name": "G0S7", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P01100", "id": "P01100" } ], "protein_names": [ { "name": "Protein c-Fos", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P01100" }, { "name": "Cellular oncogene fos", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01100" }, { "name": "FBJ murine osteosarcoma viral (v-fos) oncogene homolog (oncogene FOS); proto-oncogene c-Fos; activator protein 1; cellular oncogene c-fos; G0/G1 switch regulatory protein 7; FBJ murine osteosarcoma viral oncogene homolog; Fos proto-oncogene, AP-1 trancription factor subunit; transcription factor AP-1 subunit c-Fos", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005243", "id": "NP_005243" }, { "name": "Fos proto-oncogene, AP-1 transcription factor subunit", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01100" }, { "name": "G0/G1 switch regulatory protein 7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01100" }, { "name": "Proto-oncogene c-Fos", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01100" }, { "name": "Transcription factor AP-1 subunit c-Fos", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01100" }, { "name": "protein c-Fos", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005243", "id": "NP_005243" } ], "function": [ { "annotation": "C-FOS is an integral component of the IKZF1 transactivator complex and mediates lenalidomide resistance in multiple myeloma.", "evidence": [ { "database": "RefSeq", "id": "NP_005243", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005243" }, { "database": "PubMed", "id": "37581569", "url": "https://glygen.org/publication/PubMed/37581569" } ] }, { "annotation": "Expression of PVRL4, a molecular target for cancer treatment, is transcriptionally regulated by FOS.", "evidence": [ { "database": "RefSeq", "id": "NP_005243", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005243" }, { "database": "PubMed", "id": "38063270", "url": "https://glygen.org/publication/PubMed/38063270" } ] }, { "annotation": "Molecular profiling of clinical remission in psoriatic arthritis reveals dysregulation of FOS and CCDC50 genes: a gene expression study. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_005243", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005243" }, { "database": "PubMed", "id": "37965313", "url": "https://glygen.org/publication/PubMed/37965313" } ] }, { "annotation": "Nuclear phosphoprotein which forms a tight but non-covalently linked complex with the JUN/AP-1 transcription factor. In the heterodimer, FOS and JUN/AP-1 basic regions each seems to interact with symmetrical DNA half sites. On TGF-beta activation, forms a multimeric SMAD3/SMAD4/JUN/FOS complex at the AP1/SMAD-binding site to regulate TGF-beta-mediated signaling. Has a critical function in regulating the development of cells destined to form and maintain the skeleton. It is thought to have an important role in signal transduction, cell proliferation and differentiation. In growing cells, activates phospholipid synthesis, possibly by activating CDS1 and PI4K2A. This activity requires Tyr-dephosphorylation and association with the endoplasmic reticulum.", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100#function" }, { "database": "PubMed", "id": "22105363", "url": "https://glygen.org/publication/PubMed/22105363" }, { "database": "PubMed", "id": "9732876", "url": "https://glygen.org/publication/PubMed/9732876" }, { "database": "PubMed", "id": "17160021", "url": "https://glygen.org/publication/PubMed/17160021" }, { "database": "PubMed", "id": "7588633", "url": "https://glygen.org/publication/PubMed/7588633" }, { "database": "PubMed", "id": "16055710", "url": "https://glygen.org/publication/PubMed/16055710" } ] }, { "annotation": "Over-expression of cFos by the Transcription Factors NFATc2 and Sp1 in Pancreatic Cancer Cells.", "evidence": [ { "database": "RefSeq", "id": "NP_005243", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005243" }, { "database": "PubMed", "id": "37909980", "url": "https://glygen.org/publication/PubMed/37909980" } ] }, { "annotation": "Protection of c-Fos from autophagic degradation by PRMT1-mediated methylation fosters gastric tumorigenesis. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_005243", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005243" }, { "database": "PubMed", "id": "37564212", "url": "https://glygen.org/publication/PubMed/37564212" } ] }, { "annotation": "The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_005243", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005243" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs746120492", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746120492" }, { "id": "rs746120492", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746120492" }, { "id": "rs746120492", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746120492#frequency_tab" }, { "id": "rs746120492", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746120492" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 114, "end_pos": 114, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TMT->NMT).", "chr_id": "14", "chr_pos": "75280076", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T114", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P01100", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P01100" } ], "glycoeffect": [], "start_pos": 143, "end_pos": 143, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "Q", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "14", "chr_pos": "75280594", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "R143", "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] }, { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] }, { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs764068791", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764068791" }, { "id": "rs764068791", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764068791" }, { "id": "rs764068791", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764068791" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 222, "end_pos": 222, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DLT->NLT).", "chr_id": "14", "chr_pos": "75280945", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D222", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1329156805", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1329156805" }, { "id": "rs1329156805", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1329156805#frequency_tab" }, { "id": "rs1329156805", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1329156805" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 258, "end_pos": 258, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SIS->NIS).", "chr_id": "14", "chr_pos": "75281054", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S258", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs993801161", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs993801161" }, { "id": "rs993801161", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs993801161" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 281, "end_pos": 281, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SGS->NGS).", "chr_id": "14", "chr_pos": "75281123", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S281", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs763177286", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763177286" }, { "id": "rs763177286", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763177286" }, { "id": "rs763177286", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs763177286#frequency_tab" }, { "id": "rs763177286", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763177286" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 362, "end_pos": 362, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SSS->NSS).", "chr_id": "14", "chr_pos": "75281366", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S362", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1283707359", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1283707359" }, { "id": "rs1283707359", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1283707359" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 88, "end_pos": 88, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "14", "chr_pos": "75280026", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S88", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1445858758", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1445858758" }, { "id": "rs1445858758", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1445858758#frequency_tab" }, { "id": "rs1445858758", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1445858758" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 88, "end_pos": 88, "sequence_org": "S", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->L).", "chr_id": "14", "chr_pos": "75279998", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S88", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs775485425", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775485425" }, { "id": "rs775485425", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775485425" }, { "id": "rs775485425", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775485425" }, { "id": "rs775485425", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775485425" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 90, "end_pos": 90, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "14", "chr_pos": "75281000", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T90", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs769692617", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769692617" }, { "id": "rs769692617", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769692617" }, { "id": "rs769692617", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs769692617" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 90, "end_pos": 90, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->P).", "chr_id": "14", "chr_pos": "75280999", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T90", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 106, "end_pos": 106, "sequence_org": "Y", "sequence_mut": "F", "comment": "No effect on Tyr-phosphorylation. Loss of endoplasmic reticulum localization in quiescent cells.", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" }, { "database": "PubMed", "id": "17160021", "url": "https://glygen.org/publication/PubMed/17160021" } ] }, { "start_pos": 10, "end_pos": 10, "sequence_org": "Y", "sequence_mut": "E", "comment": "Loss of activation of phospholipid synthesis; when associated with E-30.", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" }, { "database": "PubMed", "id": "22105363", "url": "https://glygen.org/publication/PubMed/22105363" }, { "database": "PubMed", "id": "17160021", "url": "https://glygen.org/publication/PubMed/17160021" } ] }, { "start_pos": 10, "end_pos": 10, "sequence_org": "Y", "sequence_mut": "F", "comment": "Overall loss of Tyr-phosphorylation, including that of Y-30 phosphorylation. Localizes to the endoplasmic reticulum in quiescent cells. Activates phospholipid synthesis in growing cells.", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" }, { "database": "PubMed", "id": "22105363", "url": "https://glygen.org/publication/PubMed/22105363" }, { "database": "PubMed", "id": "17160021", "url": "https://glygen.org/publication/PubMed/17160021" } ] }, { "start_pos": 128, "end_pos": 128, "sequence_org": "K", "sequence_mut": "R", "comment": "No change in sumoylation.", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" }, { "database": "PubMed", "id": "16055710", "url": "https://glygen.org/publication/PubMed/16055710" } ] }, { "start_pos": 192, "end_pos": 192, "sequence_org": "K", "sequence_mut": "R", "comment": "No change in sumoylation.", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" }, { "database": "PubMed", "id": "16055710", "url": "https://glygen.org/publication/PubMed/16055710" } ] }, { "start_pos": 232, "end_pos": 232, "sequence_org": "T", "sequence_mut": "D", "comment": "Decreased sumoylation levels.", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" }, { "database": "PubMed", "id": "16055710", "url": "https://glygen.org/publication/PubMed/16055710" } ] }, { "start_pos": 265, "end_pos": 265, "sequence_org": "K", "sequence_mut": "R", "comment": "Abolishes sumoylation. No change in nuclear location nor on protein stability. Increased AP1 transactivation activity when heterodimerized with cJUN.", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" }, { "database": "PubMed", "id": "16055710", "url": "https://glygen.org/publication/PubMed/16055710" } ] }, { "start_pos": 30, "end_pos": 30, "sequence_org": "Y", "sequence_mut": "E", "comment": "Loss of activation of phospholipid synthesis; when associated with E-10.", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" }, { "database": "PubMed", "id": "22105363", "url": "https://glygen.org/publication/PubMed/22105363" }, { "database": "PubMed", "id": "17160021", "url": "https://glygen.org/publication/PubMed/17160021" } ] }, { "start_pos": 30, "end_pos": 30, "sequence_org": "Y", "sequence_mut": "F", "comment": "Overall loss of Tyr-phosphorylation, including that of Y-10 phosphorylation. Localizes to the endoplasmic reticulum in quiescent cells. Activates phospholipid synthesis in growing cells.", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" }, { "database": "PubMed", "id": "22105363", "url": "https://glygen.org/publication/PubMed/22105363" }, { "database": "PubMed", "id": "17160021", "url": "https://glygen.org/publication/PubMed/17160021" } ] }, { "start_pos": 325, "end_pos": 325, "sequence_org": "T", "sequence_mut": "D", "comment": "No change in sumoylation levels.", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" }, { "database": "PubMed", "id": "16055710", "url": "https://glygen.org/publication/PubMed/16055710" } ] }, { "start_pos": 331, "end_pos": 331, "sequence_org": "T", "sequence_mut": "D", "comment": "No change in sumoylation levels.", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" }, { "database": "PubMed", "id": "16055710", "url": "https://glygen.org/publication/PubMed/16055710" } ] }, { "start_pos": 337, "end_pos": 337, "sequence_org": "Y", "sequence_mut": "F", "comment": "No effect on Tyr-phosphorylation. Loss of endoplasmic reticulum localization in quiescent cells.", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" }, { "database": "PubMed", "id": "17160021", "url": "https://glygen.org/publication/PubMed/17160021" } ] }, { "start_pos": 362, "end_pos": 362, "sequence_org": "S", "sequence_mut": "A", "comment": "Loss of protein stability. Reduced MOS/MAPK-mediated transforming ability; when associated with A-374.", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" }, { "database": "PubMed", "id": "7588633", "url": "https://glygen.org/publication/PubMed/7588633" }, { "database": "PubMed", "id": "16055710", "url": "https://glygen.org/publication/PubMed/16055710" } ] }, { "start_pos": 362, "end_pos": 362, "sequence_org": "S", "sequence_mut": "D", "comment": "Increased protein stability. Increased MOS/MAPK-mediated transforming ability and no change in sumoylation levels; when associated with D-374.", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" }, { "database": "PubMed", "id": "7588633", "url": "https://glygen.org/publication/PubMed/7588633" }, { "database": "PubMed", "id": "16055710", "url": "https://glygen.org/publication/PubMed/16055710" } ] }, { "start_pos": 374, "end_pos": 374, "sequence_org": "S", "sequence_mut": "A", "comment": "No change in sumoylation levels. Loss of protein stability. Reduced MOS/MAPK-mediated transforming ability; when associated with A-362.", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" }, { "database": "PubMed", "id": "7588633", "url": "https://glygen.org/publication/PubMed/7588633" }, { "database": "PubMed", "id": "16055710", "url": "https://glygen.org/publication/PubMed/16055710" } ] }, { "start_pos": 374, "end_pos": 374, "sequence_org": "S", "sequence_mut": "D", "comment": "Increased protein stability. Increased MOS/MAPK-mediated transforming ability and no change in sumoylation levels; when associated with D-362.", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" }, { "database": "PubMed", "id": "7588633", "url": "https://glygen.org/publication/PubMed/7588633" }, { "database": "PubMed", "id": "16055710", "url": "https://glygen.org/publication/PubMed/16055710" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "89.79", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170345", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170345" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "86.76", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170345", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170345" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "93.45", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170345", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170345" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "97.84", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170345", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170345" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "99.79", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170345", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170345" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "99.16", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170345", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170345" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "91.36", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170345", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170345" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "84.77", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170345", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170345" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "95.43", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170345", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170345" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "99.59", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170345", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170345" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "89.29", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170345", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170345" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "98.29", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170345", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170345" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "96.52", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170345", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170345" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P01100", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01100" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P01100", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01100" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P01100", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01100" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P01100", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01100" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P01100", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01100" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P01100", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01100" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P01100", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01100" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P01100", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01100" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P01100", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01100" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P01100", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01100" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P01100", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01100" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P01100", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01100" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "common_name": "Human" } ], "gene": [ { "name": "FOS", "url": "https://www.uniprot.org/uniprot/P01100", "locus": { "chromosome": "14", "start_pos": 75282230, "end_pos": 75278826, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000170345", "url": "https://www.ensembl.org/id/ENSG00000170345" } ] } } ], "crossref": [ { "id": "ENSG00000170345", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170345", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P01100", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P01100", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd14721", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd14721", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL5029", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL5029", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "FOS", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=FOS", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "2353", "url": "https://www.ncbi.nlm.nih.gov/gene/2353", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "3796", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=3796", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P01100", "url": "https://www.ebi.ac.uk/intact/interactors/id:P01100*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000837", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000837", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR004827", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004827", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046347", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046347", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:2353", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2353", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "164810", "url": "http://www.omim.org/entry/164810", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P01100", "url": "https://www.nextprot.org/entry/NX_P01100", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P01100", "url": "https://oglcnac.org/atlas/detail/P01100", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P01100", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01100", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "FTYPEAE", "url": "https://omabrowser.org/oma/group/FTYPEAE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4614365at2759", "url": "http://www.orthodb.org/?query=4614365at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23351", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23351", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23351:SF4", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23351:SF4", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1A02", "url": "https://www.rcsb.org/structure/1A02", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1FOS", "url": "https://www.rcsb.org/structure/1FOS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1S9K", "url": "https://www.rcsb.org/structure/1S9K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00170", "url": "http://pfam.xfam.org/family/PF00170", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P01100", "url": "https://pharos.nih.gov/targets/P01100", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P01100", "url": "http://purl.obolibrary.org/obo/PR_P01100", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-450341", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450341", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9768919", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9768919", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_005243", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005243", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "G3V289", "url": "https://www.uniprot.org/uniprot/G3V289", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G3V289-1", "url": "https://www.uniprot.org/uniprot/G3V289-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G3V2V7", "url": "https://www.uniprot.org/uniprot/G3V2V7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G3V2V7-1", "url": "https://www.uniprot.org/uniprot/G3V2V7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G3V5J9", "url": "https://www.uniprot.org/uniprot/G3V5J9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G3V5J9-1", "url": "https://www.uniprot.org/uniprot/G3V5J9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G3V5N7", "url": "https://www.uniprot.org/uniprot/G3V5N7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G3V5N7-1", "url": "https://www.uniprot.org/uniprot/G3V5N7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G3V5N9", "url": "https://www.uniprot.org/uniprot/G3V5N9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G3V5N9-1", "url": "https://www.uniprot.org/uniprot/G3V5N9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YJM3", "url": "https://www.uniprot.org/uniprot/H0YJM3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YJM3-1", "url": "https://www.uniprot.org/uniprot/H0YJM3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01100-1", "url": "https://www.uniprot.org/uniprot/P01100-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01100-2", "url": "https://www.uniprot.org/uniprot/P01100-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01100-3", "url": "https://www.uniprot.org/uniprot/P01100-3", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL", "length": 380, "header": "sp|P01100-1|FOS_HUMAN Isoform 1 of Protein c-Fos OS=Homo sapiens OX=9606 GN=FOS PE=1 SV=1 CANONICAL=P01100-1" }, "isoforms": [ { "isoform_ac": "G3V289-1", "url": "", "sequence": { "sequence": "MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQVRNSSVLFLGMWGLGGKQPRRCRSPVQRMKPLMGLAAHP", "length": 170, "header": "tr|G3V289-1|G3V289_HUMAN Computationally mapped isoform of Fos proto-oncogene, AP-1 transcription factor subunit OS=Homo sapiens OX=9606 GN=FOS PE=1 SV=1 CANONICAL=P01100-1" }, "locus": { "chromosome": "14", "start_pos": 75280245, "end_pos": 75278983, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000554617.1", "url": "https://www.ensembl.org/id/ENST00000554617.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000450519.1", "url": "https://www.ensembl.org/id/ENSP00000450519.1" } ] } }, { "isoform_ac": "G3V2V7-1", "url": "", "sequence": { "sequence": "MAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL", "length": 232, "header": "tr|G3V2V7-1|G3V2V7_HUMAN Computationally mapped isoform of Protein c-Fos OS=Homo sapiens OX=9606 GN=FOS PE=1 SV=1 CANONICAL=P01100-1" }, "locus": { "chromosome": "14", "start_pos": 75281421, "end_pos": 75280611, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000555347.1", "url": "https://www.ensembl.org/id/ENST00000555347.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000450886.1", "url": "https://www.ensembl.org/id/ENSP00000450886.1" } ] } }, { "isoform_ac": "G3V5J9-1", "url": "", "sequence": { "sequence": "MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAVGTLWVAPF", "length": 176, "header": "tr|G3V5J9-1|G3V5J9_HUMAN Computationally mapped isoform of Protein c-Fos OS=Homo sapiens OX=9606 GN=FOS PE=1 SV=1 CANONICAL=P01100-1" }, "locus": { "chromosome": "14", "start_pos": 75280694, "end_pos": 75278983, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000555242.1", "url": "https://www.ensembl.org/id/ENST00000555242.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000452386.1", "url": "https://www.ensembl.org/id/ENSP00000452386.1" } ] } }, { "isoform_ac": "G3V5N7-1", "url": "", "sequence": { "sequence": "MTGGRAQSIGRRGKVEQETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDM", "length": 142, "header": "tr|G3V5N7-1|G3V5N7_HUMAN Computationally mapped isoform of Protein c-Fos OS=Homo sapiens OX=9606 GN=FOS PE=1 SV=1 CANONICAL=P01100-1" }, "locus": { "chromosome": "14", "start_pos": 75281157, "end_pos": 75280078, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000555672.1", "url": "https://www.ensembl.org/id/ENST00000555672.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000452440.1", "url": "https://www.ensembl.org/id/ENSP00000452440.1" } ] } }, { "isoform_ac": "G3V5N9-1", "url": "", "sequence": { "sequence": "MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQCQLHSHGHCHLDQSGPAVAGAARPRLLRGPIADQSPSPFRSPRPLRWGLLQGWRCEDHDRRPSAEHWQEGQGGTVISRRRREKENPKGKE", "length": 137, "header": "tr|G3V5N9-1|G3V5N9_HUMAN Computationally mapped isoform of Fos proto-oncogene, AP-1 transcription factor subunit OS=Homo sapiens OX=9606 GN=FOS PE=1 SV=1 CANONICAL=P01100-1" }, "locus": { "chromosome": "14", "start_pos": 75280606, "end_pos": 75278983, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000554212.5", "url": "https://www.ensembl.org/id/ENST00000554212.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000452443.1", "url": "https://www.ensembl.org/id/ENSP00000452443.1" } ] } }, { "isoform_ac": "H0YJM3-1", "url": "", "sequence": { "sequence": "RLLRGPIADQSPSPFRSPRPLRWGLLQGWRCEDHDRRPSAEHWQEGQGGTEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQA", "length": 83, "header": "tr|H0YJM3-1|H0YJM3_HUMAN Computationally mapped isoform of Protein c-Fos OS=Homo sapiens OX=9606 GN=FOS PE=3 SV=1 CANONICAL=P01100-1" }, "locus": { "chromosome": "14", "start_pos": 75280667, "end_pos": 75279978, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000557139.1", "url": "https://www.ensembl.org/id/ENST00000557139.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000451786.1", "url": "https://www.ensembl.org/id/ENSP00000451786.1" } ] } }, { "isoform_ac": "P01100-1", "url": "", "sequence": { "sequence": "MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL", "length": 380, "header": "sp|P01100-1|FOS_HUMAN Isoform 1 of Protein c-Fos OS=Homo sapiens OX=9606 GN=FOS PE=1 SV=1 CANONICAL=P01100-1" }, "locus": { "chromosome": "14", "start_pos": 75281421, "end_pos": 75278983, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000303562.9", "url": "https://www.ensembl.org/id/ENST00000303562.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000306245.4", "url": "https://www.ensembl.org/id/ENSP00000306245.4" } ] } }, { "isoform_ac": "P01100-2", "url": "", "sequence": { "sequence": "MTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL", "length": 266, "header": "sp|P01100-2|FOS_HUMAN Isoform 2 of Protein c-Fos OS=Homo sapiens OX=9606 GN=FOS PE=1 SV=1 CANONICAL=P01100-1" }, "locus": { "chromosome": "14", "start_pos": 75281421, "end_pos": 75280078, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000555686.1", "url": "https://www.ensembl.org/id/ENST00000555686.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000452590.1", "url": "https://www.ensembl.org/id/ENSP00000452590.1" } ] } }, { "isoform_ac": "P01100-3", "url": "", "sequence": { "sequence": "MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL", "length": 344, "header": "sp|P01100-3|FOS_HUMAN Isoform 3 of Protein c-Fos OS=Homo sapiens OX=9606 GN=FOS PE=1 SV=1 CANONICAL=P01100-1" }, "locus": { "chromosome": "14", "start_pos": 75281421, "end_pos": 75278983, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000535987.5", "url": "https://www.ensembl.org/id/ENST00000535987.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000442268.1", "url": "https://www.ensembl.org/id/ENSP00000442268.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 278, "start_aa": "Ser", "end_pos": 278, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser278", "evidence": [ { "id": "P01100", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01100" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "30515991", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30515991" }, { "id": "15327282", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15327282" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "P01100", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P01100" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 283, "start_aa": "Ser", "end_pos": 283, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser283", "evidence": [ { "id": "P01100", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01100" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "30515991", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30515991" }, { "id": "15327282", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15327282" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "P01100", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P01100" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 56, "start_aa": "Ser", "end_pos": 56, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser56", "evidence": [ { "id": "P01100", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01100" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "30515991", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30515991" }, { "id": "15327282", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15327282" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "P01100", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P01100" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 57, "start_aa": "Ser", "end_pos": 57, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser57", "evidence": [ { "id": "P01100", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01100" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "30515991", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30515991" }, { "id": "15327282", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15327282" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "P01100", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P01100" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 83, "start_aa": "Ser", "end_pos": 83, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser83", "evidence": [ { "id": "P01100", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01100" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "30515991", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30515991" }, { "id": "15327282", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15327282" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "P01100", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P01100" } ] }, { "glytoucan_ac": "G70994MS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 83, "start_aa": "Ser", "end_pos": 83, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser83", "evidence": [ { "id": "GLY_000142", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000142" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 84, "start_aa": "Ser", "end_pos": 84, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser84", "evidence": [ { "id": "P01100", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01100" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "30515991", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30515991" }, { "id": "15327282", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15327282" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "P01100", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P01100" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 88, "start_aa": "Ser", "end_pos": 88, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser88", "evidence": [ { "id": "P01100", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01100" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "30515991", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30515991" }, { "id": "15327282", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15327282" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "P01100", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P01100" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 90, "start_aa": "Thr", "end_pos": 90, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr90", "evidence": [ { "id": "P01100", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01100" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "30515991", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30515991" }, { "id": "15327282", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15327282" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "P01100", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P01100" } ] } ], "phosphorylation": [ { "start_pos": 10, "end_pos": 10, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by SRC", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" }, { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" }, { "database": "PubMed", "id": "22105363", "url": "https://glygen.org/publication/PubMed/22105363" }, { "database": "PubMed", "id": "17160021", "url": "https://glygen.org/publication/PubMed/17160021" } ], "site_lbl": "Tyr10" }, { "start_pos": 114, "end_pos": 114, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr114" }, { "start_pos": 232, "end_pos": 232, "kinase_uniprot_canonical_ac": "P27361-1", "kinase_gene_name": "MAPK3", "residue": "Thr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P01100", "url": "http://phospho.elm.eu.org/byAccession/P01100.html" }, { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" }, { "database": "PubMed", "id": "7816602", "url": "https://glygen.org/publication/PubMed/7816602" } ], "site_lbl": "Thr232" }, { "start_pos": 232, "end_pos": 232, "kinase_uniprot_canonical_ac": "P28482-1", "kinase_gene_name": "MAPK1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" }, { "database": "PubMed", "id": "7816602", "url": "https://glygen.org/publication/PubMed/7816602" }, { "database": "phospho.ELM", "id": "P01100", "url": "http://phospho.elm.eu.org/byAccession/P01100.html" } ], "site_lbl": "Thr232" }, { "start_pos": 232, "end_pos": 232, "kinase_uniprot_canonical_ac": "Q13164-1", "kinase_gene_name": "MAPK7", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" }, { "database": "PubMed", "id": "17018293", "url": "https://glygen.org/publication/PubMed/17018293" } ], "site_lbl": "Thr232" }, { "start_pos": 232, "end_pos": 232, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" }, { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" }, { "database": "PubMed", "id": "17018293", "url": "https://glygen.org/publication/PubMed/17018293" }, { "database": "PubMed", "id": "18822310", "url": "https://glygen.org/publication/PubMed/18822310" }, { "database": "PubMed", "id": "23667255", "url": "https://glygen.org/publication/PubMed/23667255" }, { "database": "PubMed", "id": "29422527", "url": "https://glygen.org/publication/PubMed/29422527" }, { "database": "PubMed", "id": "30312728", "url": "https://glygen.org/publication/PubMed/30312728" }, { "database": "PubMed", "id": "7816602", "url": "https://glygen.org/publication/PubMed/7816602" }, { "database": "PubMed", "id": "8072547", "url": "https://glygen.org/publication/PubMed/8072547" } ], "site_lbl": "Thr232" }, { "start_pos": 30, "end_pos": 30, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by SRC", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" }, { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" }, { "database": "PubMed", "id": "22105363", "url": "https://glygen.org/publication/PubMed/22105363" }, { "database": "PubMed", "id": "17160021", "url": "https://glygen.org/publication/PubMed/17160021" } ], "site_lbl": "Tyr30" }, { "start_pos": 325, "end_pos": 325, "kinase_uniprot_canonical_ac": "P27361-1", "kinase_gene_name": "MAPK3", "residue": "Thr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P01100", "url": "http://phospho.elm.eu.org/byAccession/P01100.html" }, { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" }, { "database": "PubMed", "id": "12972619", "url": "https://glygen.org/publication/PubMed/12972619" } ], "site_lbl": "Thr325" }, { "start_pos": 325, "end_pos": 325, "kinase_uniprot_canonical_ac": "P28482-1", "kinase_gene_name": "MAPK1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" }, { "database": "PubMed", "id": "12972619", "url": "https://glygen.org/publication/PubMed/12972619" }, { "database": "PubMed", "id": "12134156", "url": "https://glygen.org/publication/PubMed/12134156" } ], "site_lbl": "Thr325" }, { "start_pos": 325, "end_pos": 325, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by MAPK1 and MAPK3", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" }, { "database": "PRO", "id": "P01100", "url": "http://purl.obolibrary.org/obo/P01100" }, { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" }, { "database": "PubMed", "id": "12134156", "url": "https://glygen.org/publication/PubMed/12134156" }, { "database": "PubMed", "id": "18822310", "url": "https://glygen.org/publication/PubMed/18822310" }, { "database": "PubMed", "id": "21552553", "url": "https://glygen.org/publication/PubMed/21552553" }, { "database": "PubMed", "id": "23667255", "url": "https://glygen.org/publication/PubMed/23667255" }, { "database": "PubMed", "id": "29422527", "url": "https://glygen.org/publication/PubMed/29422527" }, { "database": "PubMed", "id": "29535732", "url": "https://glygen.org/publication/PubMed/29535732" } ], "site_lbl": "Thr325" }, { "start_pos": 32, "end_pos": 32, "kinase_uniprot_canonical_ac": "Q13164-1", "kinase_gene_name": "MAPK7", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" }, { "database": "PubMed", "id": "17018293", "url": "https://glygen.org/publication/PubMed/17018293" } ], "site_lbl": "Ser32" }, { "start_pos": 32, "end_pos": 32, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" }, { "database": "PubMed", "id": "17018293", "url": "https://glygen.org/publication/PubMed/17018293" } ], "site_lbl": "Ser32" }, { "start_pos": 331, "end_pos": 331, "kinase_uniprot_canonical_ac": "P27361-1", "kinase_gene_name": "MAPK3", "residue": "Thr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P01100", "url": "http://phospho.elm.eu.org/byAccession/P01100.html" }, { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" }, { "database": "PubMed", "id": "12972619", "url": "https://glygen.org/publication/PubMed/12972619" } ], "site_lbl": "Thr331" }, { "start_pos": 331, "end_pos": 331, "kinase_uniprot_canonical_ac": "P28482-1", "kinase_gene_name": "MAPK1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" }, { "database": "PubMed", "id": "12972619", "url": "https://glygen.org/publication/PubMed/12972619" }, { "database": "PubMed", "id": "12134156", "url": "https://glygen.org/publication/PubMed/12134156" } ], "site_lbl": "Thr331" }, { "start_pos": 331, "end_pos": 331, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by MAPK1 and MAPK3", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" }, { "database": "PRO", "id": "P01100", "url": "http://purl.obolibrary.org/obo/P01100" }, { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" }, { "database": "PubMed", "id": "12134156", "url": "https://glygen.org/publication/PubMed/12134156" }, { "database": "PubMed", "id": "18822310", "url": "https://glygen.org/publication/PubMed/18822310" }, { "database": "PubMed", "id": "23667255", "url": "https://glygen.org/publication/PubMed/23667255" }, { "database": "PubMed", "id": "29422527", "url": "https://glygen.org/publication/PubMed/29422527" } ], "site_lbl": "Thr331" }, { "start_pos": 362, "end_pos": 362, "kinase_uniprot_canonical_ac": "O75676-1", "kinase_gene_name": "RPS6KA4", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" }, { "database": "PubMed", "id": "22187936", "url": "https://glygen.org/publication/PubMed/22187936" }, { "database": "PubMed", "id": "8248197", "url": "https://glygen.org/publication/PubMed/8248197" } ], "site_lbl": "Ser362" }, { "start_pos": 362, "end_pos": 362, "kinase_uniprot_canonical_ac": "P17612-1", "kinase_gene_name": "PRKACA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" }, { "database": "PubMed", "id": "1545828", "url": "https://glygen.org/publication/PubMed/1545828" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "8248197", "url": "https://glygen.org/publication/PubMed/8248197" } ], "site_lbl": "Ser362" }, { "start_pos": 362, "end_pos": 362, "kinase_uniprot_canonical_ac": "Q15418-1", "kinase_gene_name": "RPS6KA1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" }, { "database": "PubMed", "id": "1545828", "url": "https://glygen.org/publication/PubMed/1545828" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "8248197", "url": "https://glygen.org/publication/PubMed/8248197" } ], "site_lbl": "Ser362" }, { "start_pos": 362, "end_pos": 362, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by MAPK1, MAPK3 and RPS6KA3", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" }, { "database": "phospho.ELM", "id": "P01100", "url": "http://phospho.elm.eu.org/byAccession/P01100.html" }, { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" }, { "database": "PubMed", "id": "1545828", "url": "https://glygen.org/publication/PubMed/1545828" }, { "database": "PubMed", "id": "11585927", "url": "https://glygen.org/publication/PubMed/11585927" }, { "database": "PubMed", "id": "9920881", "url": "https://glygen.org/publication/PubMed/9920881" }, { "database": "PubMed", "id": "8248197", "url": "https://glygen.org/publication/PubMed/8248197" }, { "database": "PRO", "id": "P01100", "url": "http://purl.obolibrary.org/obo/P01100" }, { "database": "PubMed", "id": "12134156", "url": "https://glygen.org/publication/PubMed/12134156" }, { "database": "PubMed", "id": "15719069", "url": "https://glygen.org/publication/PubMed/15719069" }, { "database": "PubMed", "id": "21219922", "url": "https://glygen.org/publication/PubMed/21219922" }, { "database": "PubMed", "id": "21552553", "url": "https://glygen.org/publication/PubMed/21552553" }, { "database": "PubMed", "id": "23400877", "url": "https://glygen.org/publication/PubMed/23400877" }, { "database": "PubMed", "id": "26725323", "url": "https://glygen.org/publication/PubMed/26725323" }, { "database": "PubMed", "id": "7588633", "url": "https://glygen.org/publication/PubMed/7588633" } ], "site_lbl": "Ser362" }, { "start_pos": 374, "end_pos": 374, "kinase_uniprot_canonical_ac": "P27361-1", "kinase_gene_name": "MAPK3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" }, { "database": "PubMed", "id": "12972619", "url": "https://glygen.org/publication/PubMed/12972619" } ], "site_lbl": "Ser374" }, { "start_pos": 374, "end_pos": 374, "kinase_uniprot_canonical_ac": "P28482-1", "kinase_gene_name": "MAPK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "8248197", "url": "https://glygen.org/publication/PubMed/8248197" }, { "database": "PubMed", "id": "12134156", "url": "https://glygen.org/publication/PubMed/12134156" }, { "database": "PubMed", "id": "12972619", "url": "https://glygen.org/publication/PubMed/12972619" } ], "site_lbl": "Ser374" }, { "start_pos": 374, "end_pos": 374, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by MAPK1 and MAPK3", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" }, { "database": "phospho.ELM", "id": "P01100", "url": "http://phospho.elm.eu.org/byAccession/P01100.html" }, { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" }, { "database": "PubMed", "id": "8248197", "url": "https://glygen.org/publication/PubMed/8248197" }, { "database": "PRO", "id": "P01100", "url": "http://purl.obolibrary.org/obo/P01100" }, { "database": "PubMed", "id": "12134156", "url": "https://glygen.org/publication/PubMed/12134156" }, { "database": "PubMed", "id": "18822310", "url": "https://glygen.org/publication/PubMed/18822310" }, { "database": "PubMed", "id": "21219922", "url": "https://glygen.org/publication/PubMed/21219922" }, { "database": "PubMed", "id": "23400877", "url": "https://glygen.org/publication/PubMed/23400877" }, { "database": "PubMed", "id": "23667255", "url": "https://glygen.org/publication/PubMed/23667255" }, { "database": "PubMed", "id": "26725323", "url": "https://glygen.org/publication/PubMed/26725323" }, { "database": "PubMed", "id": "27486656", "url": "https://glygen.org/publication/PubMed/27486656" }, { "database": "PubMed", "id": "29422527", "url": "https://glygen.org/publication/PubMed/29422527" }, { "database": "PubMed", "id": "7588633", "url": "https://glygen.org/publication/PubMed/7588633" } ], "site_lbl": "Ser374" }, { "start_pos": 70, "end_pos": 70, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" }, { "database": "PubMed", "id": "18822310", "url": "https://glygen.org/publication/PubMed/18822310" } ], "site_lbl": "Ser70" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Constitutive activation of Stat3 signaling confers resistance to apoptosis in human U266 myeloma cells.", "journal": "Immunity", "date": "1999", "authors": "Catlett-Falcone R, Landowski TH, Oshiro MM, Turkson J, Levitzki A, Savino R, Ciliberto G, Moscinski L, Fernandez-Luna JL, Nunez G, Dalton WS, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10023775", "url": "https://glygen.org/publication/PubMed/10023775" } ] }, { "title": "Tyrosine phosphorylation of SLP-76 is downstream of Syk following stimulation of the collagen receptor in platelets.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Gross BS, Lee JR, Clements JL, Turner M, Tybulewicz VL, Findell PR, Koretzky GA, Watson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "10026222", "url": "https://glygen.org/publication/PubMed/10026222" } ] }, { "title": "Akt promotes cell survival by phosphorylating and inhibiting a Forkhead transcription factor.", "journal": "Cell", "date": "1999", "authors": "Brunet A, Bonni A, Zigmond MJ, Lin MZ, Juo P, Hu LS, Anderson MJ, Arden KC, Blenis J, Greenberg ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "10102273", "url": "https://glygen.org/publication/PubMed/10102273" } ] }, { "title": "The EGR family of transcription-regulatory factors: progress at the interface of molecular and systems neuroscience.", "journal": "Trends in neurosciences", "date": "1999", "authors": "O'Donovan KJ, Tourtellotte WG, Millbrandt J, Baraban JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "10203854", "url": "https://glygen.org/publication/PubMed/10203854" } ] }, { "title": "Crystal structure of the interleukin-4/receptor alpha chain complex reveals a mosaic binding interface.", "journal": "Cell", "date": "1999", "authors": "Hage T, Sebald W, Reinemer P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10219247", "url": "https://glygen.org/publication/PubMed/10219247" } ] }, { "title": "Non-transcriptional action of oestradiol and progestin triggers DNA synthesis.", "journal": "The EMBO journal", "date": "1999", "authors": "Castoria G, Barone MV, Di Domenico M, Bilancio A, Ametrano D, Migliaccio A, Auricchio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "10228164", "url": "https://glygen.org/publication/PubMed/10228164" } ] }, { "title": "Oligomerization is required for p53 to be efficiently ubiquitinated by MDM2.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Maki CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "10347217", "url": "https://glygen.org/publication/PubMed/10347217" } ] }, { "title": "Regulation of the germline immunoglobulin Cgamma1 promoter by CD40 ligand and IL-4: dual role for tandem NF-kappaB binding sites.", "journal": "Molecular immunology", "date": "1999", "authors": "Warren WD, Roberts KL, Linehan LA, Berton MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10369418", "url": "https://glygen.org/publication/PubMed/10369418" } ] }, { "title": "Staurosporine enhances cAMP-induced expression of neural-specific gene VGF and tyrosine hydroxylase.", "journal": "Neuroscience letters", "date": "1999", "authors": "Nagasaki K, Sasaki K, Maass N, Tsukada T, Hanzawa H, Yamaguchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "10381005", "url": "https://glygen.org/publication/PubMed/10381005" } ] }, { "title": "Tyrosine phosphorylation of Vav stimulates IL-6 production in mast cells by a Rac/c-Jun N-terminal kinase-dependent pathway.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Song JS, Haleem-Smith H, Arudchandran R, Gomez J, Scott PM, Mill JF, Tan TH, Rivera J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "10395673", "url": "https://glygen.org/publication/PubMed/10395673" } ] }, { "title": "Serotonin-inducible transcription of interleukin-1alpha in uterine smooth muscle cells requires an AP-1 site: cloning and partial characterization of the rat IL-1alpha promoter.", "journal": "Molecular and cellular endocrinology", "date": "1999", "authors": "Huang TT, Vinci JM, Lan L, Jeffrey JJ, Wilcox BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "10432220", "url": "https://glygen.org/publication/PubMed/10432220" } ] }, { "title": "Estrogen induction of the cyclin D1 promoter: involvement of a cAMP response-like element.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Sabbah M, Courilleau D, Mester J, Redeuilh G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "10500157", "url": "https://glygen.org/publication/PubMed/10500157" } ] }, { "title": "Functional synergism of STAT6 with either NF-kappa B or PU.1 to mediate IL-4-induced activation of IgE germline gene transcription.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Stutz AM, Woisetschlager M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10510379", "url": "https://glygen.org/publication/PubMed/10510379" } ] }, { "title": "Phosphorylation of Shc by Src family kinases is necessary for stem cell factor receptor/c-kit mediated activation of the Ras/MAP kinase pathway and c-fos induction.", "journal": "Oncogene", "date": "1999", "authors": "Lennartsson J, Blume-Jensen P, Hermanson M, Ponten E, Carlberg M, Ronnstrand L", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "10523831", "url": "https://glygen.org/publication/PubMed/10523831" } ] }, { "title": "Mechanisms of transcriptional activation of bcl-2 gene expression by 17beta-estradiol in breast cancer cells.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Dong L, Wang W, Wang F, Stoner M, Reed JC, Harigai M, Samudio I, Kladde MP, Vyhlidal C, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "10542244", "url": "https://glygen.org/publication/PubMed/10542244" } ] }, { "title": "Accumulation of cyclin B1 requires E2F and cyclin-A-dependent rearrangement of the anaphase-promoting complex.", "journal": "Nature", "date": "1999", "authors": "Lukas C, Sorensen CS, Kramer E, Santoni-Rugiu E, Lindeneg C, Peters JM, Bartek J, Lukas J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "10548110", "url": "https://glygen.org/publication/PubMed/10548110" } ] }, { "title": "Activation of eotaxin gene transcription by NF-kappa B and STAT6 in human airway epithelial cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Matsukura S, Stellato C, Plitt JR, Bickel C, Miura K, Georas SN, Casolaro V, Schleimer RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10586089", "url": "https://glygen.org/publication/PubMed/10586089" } ] }, { "title": "Helix-loop-helix proteins: regulators of transcription in eucaryotic organisms.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Massari ME, Murre C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "10611221", "url": "https://glygen.org/publication/PubMed/10611221" } ] }, { "title": "Interaction of the Ras-related protein associated with diabetes rad and the putative tumor metastasis suppressor NM23 provides a novel mechanism of GTPase regulation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Zhu J, Tseng YH, Kantor JD, Rhodes CJ, Zetter BR, Moyers JS, Kahn CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "10611312", "url": "https://glygen.org/publication/PubMed/10611312" } ] }, { "title": "Reciprocal Id expression and myelin gene regulation in Schwann cells.", "journal": "Molecular and cellular neurosciences", "date": "1999", "authors": "Thatikunta P, Qin W, Christy BA, Tennekoon GI, Rutkowski JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "10656257", "url": "https://glygen.org/publication/PubMed/10656257" } ] }, { "title": "Mdm2 is a RING finger-dependent ubiquitin protein ligase for itself and p53.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Fang S, Jensen JP, Ludwig RL, Vousden KH, Weissman AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "10722742", "url": "https://glygen.org/publication/PubMed/10722742" } ] }, { "title": "A novel activation function for NAB proteins in EGR-dependent transcription of the luteinizing hormone beta gene.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Sevetson BR, Svaren J, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "10734128", "url": "https://glygen.org/publication/PubMed/10734128" } ] }, { "title": "Immunolocalization of human p14(ARF) to the granular component of the interphase nucleolus.", "journal": "Experimental cell research", "date": "2000", "authors": "Lindstrom MS, Klangby U, Inoue R, Pisa P, Wiman KG, Asker CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "10772813", "url": "https://glygen.org/publication/PubMed/10772813" } ] }, { "title": "Full promoter sequence of human early growth response factor-1 (Egr-1): demonstration of a fifth functional serum response element.", "journal": "DNA sequence : the journal of DNA sequencing and mapping", "date": "2000", "authors": "Schwachtgen JL, Campbell CJ, Braddock M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "10826704", "url": "https://glygen.org/publication/PubMed/10826704" } ] }, { "title": "Transcriptional activation of transforming growth factor alpha by estradiol: requirement for both a GC-rich site and an estrogen response element half-site.", "journal": "Journal of molecular endocrinology", "date": "2000", "authors": "Vyhlidal C, Samudio I, Kladde MP, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "10828826", "url": "https://glygen.org/publication/PubMed/10828826" } ] }, { "title": "Phosphorylation at serine 10, a major phosphorylation site of p27(Kip1), increases its protein stability.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Ishida N, Kitagawa M, Hatakeyama S, Nakayama K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "10831586", "url": "https://glygen.org/publication/PubMed/10831586" } ] }, { "title": "Signal transducer and activator of transcription 3 activates CCAAT enhancer-binding protein delta gene transcription in G0 growth-arrested mouse mammary epithelial cells and in involuting mouse mammary gland.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Hutt JA, O'Rourke JP, DeWille J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10867011", "url": "https://glygen.org/publication/PubMed/10867011" } ] }, { "title": "c-Jun inhibits transforming growth factor beta-mediated transcription by repressing Smad3 transcriptional activity.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Dennler S, Prunier C, Ferrand N, Gauthier JM, Atfi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "10871633", "url": "https://glygen.org/publication/PubMed/10871633" } ] }, { "title": "CREB: a stimulus-induced transcription factor activated by a diverse array of extracellular signals.", "journal": "Annual review of biochemistry", "date": "1999", "authors": "Shaywitz AJ, Greenberg ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "10872467", "url": "https://glygen.org/publication/PubMed/10872467" } ] }, { "title": "Promoter analysis and chromosomal mapping of human EBAG9 gene.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Ikeda K, Sato M, Tsutsumi O, Tsuchiya F, Tsuneizumi M, Emi M, Imoto I, Inazawa J, Muramatsu M, Inoue S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "10873660", "url": "https://glygen.org/publication/PubMed/10873660" } ] }, { "title": "p38 MAPK signalling cascades: ancient roles and new functions.", "journal": "BioEssays : news and reviews in molecular, cellular and developmental biology", "date": "2000", "authors": "Martin-Blanco E", "evidence": [ { "database": "Reactome", "id": "R-HSA-450341", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450341" } ], "reference": [ { "type": "PubMed", "id": "10878576", "url": "https://glygen.org/publication/PubMed/10878576" } ] }, { "title": "VGF: a novel role for this neuronal and neuroendocrine polypeptide in the regulation of energy balance.", "journal": "Frontiers in neuroendocrinology", "date": "2000", "authors": "Salton SR, Ferri GL, Hahm S, Snyder SE, Wilson AJ, Possenti R, Levi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "10882540", "url": "https://glygen.org/publication/PubMed/10882540" } ] }, { "title": "EGR1 target genes in prostate carcinoma cells identified by microarray analysis.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Svaren J, Ehrig T, Abdulkadir SA, Ehrengruber MU, Watson MA, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "10984481", "url": "https://glygen.org/publication/PubMed/10984481" } ] }, { "title": "p53 and c-Jun functionally synergize in the regulation of the DNA repair gene hMSH2 in response to UV.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Scherer SJ, Maier SM, Seifert M, Hanselmann RG, Zang KD, Muller-Hermelink HK, Angel P, Welter C, Schartl M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "10984493", "url": "https://glygen.org/publication/PubMed/10984493" } ] }, { "title": "Structural basis for relief of autoinhibition of the Dbl homology domain of proto-oncogene Vav by tyrosine phosphorylation.", "journal": "Cell", "date": "2000", "authors": "Aghazadeh B, Lowry WE, Huang XY, Rosen MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "11007481", "url": "https://glygen.org/publication/PubMed/11007481" } ] }, { "title": "Synergistic, p160 coactivator-dependent enhancement of estrogen receptor function by CARM1 and p300.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Chen D, Huang SM, Stallcup MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11010967", "url": "https://glygen.org/publication/PubMed/11010967" } ] }, { "title": "The human transcriptional repressor protein NAB1: expression and biological activity.", "journal": "Biochimica et biophysica acta", "date": "2000", "authors": "Thiel G, Kaufmann K, Magin A, Lietz M, Bach K, Cramer M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "11018254", "url": "https://glygen.org/publication/PubMed/11018254" } ] }, { "title": "Regulation of Id gene expression during embryonic stem cell-derived hematopoietic differentiation.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Nogueira MM, Mitjavila-Garcia MT, Le Pesteur F, Filippi MD, Vainchenker W, Dubart Kupperschmitt A, Sainteny F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "11027551", "url": "https://glygen.org/publication/PubMed/11027551" } ] }, { "title": "MYB oncogene amplification in hereditary BRCA1 breast cancer.", "journal": "Cancer research", "date": "2000", "authors": "Kauraniemi P, Hedenfalk I, Persson K, Duggan DJ, Tanner M, Johannsson O, Olsson H, Trent JM, Isola J, Borg A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11034064", "url": "https://glygen.org/publication/PubMed/11034064" } ] }, { "title": "Characterization of IL-4 and IL-13 signals dependent on the human IL-13 receptor alpha chain 1: redundancy of requirement of tyrosine residue for STAT3 activation.", "journal": "International immunology", "date": "2000", "authors": "Umeshita-Suyama R, Sugimoto R, Akaiwa M, Arima K, Yu B, Wada M, Kuwano M, Nakajima K, Hamasaki N, Izuhara K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11058569", "url": "https://glygen.org/publication/PubMed/11058569" } ] }, { "title": "A stat-responsive element in the promoter of the episialin/MUC1 gene is involved in its overexpression in carcinoma cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Gaemers IC, Vos HL, Volders HH, van der Valk SW, Hilkens J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11084045", "url": "https://glygen.org/publication/PubMed/11084045" } ] }, { "title": "PDZK1 and GREB1 are estrogen-regulated genes expressed in hormone-responsive breast cancer.", "journal": "Cancer research", "date": "2000", "authors": "Ghosh MG, Thompson DA, Weigel RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11103799", "url": "https://glygen.org/publication/PubMed/11103799" } ] }, { "title": "Direct regulation of pituitary proopiomelanocortin by STAT3 provides a novel mechanism for immuno-neuroendocrine interfacing.", "journal": "The Journal of clinical investigation", "date": "2000", "authors": "Bousquet C, Zatelli MC, Melmed S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11104795", "url": "https://glygen.org/publication/PubMed/11104795" } ] }, { "title": "Interleukin-6-induced tethering of STAT3 to the LAP/C/EBPbeta promoter suggests a new mechanism of transcriptional regulation by STAT3.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Niehof M, Streetz K, Rakemann T, Bischoff SC, Manns MP, Horn F, Trautwein C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "11114305", "url": "https://glygen.org/publication/PubMed/11114305" } ] }, { "title": "Suppression of signal transducer and activator of transcription 3-dependent B lymphocyte terminal differentiation by BCL-6.", "journal": "The Journal of experimental medicine", "date": "2000", "authors": "Reljic R, Wagner SD, Peakman LJ, Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11120780", "url": "https://glygen.org/publication/PubMed/11120780" } ] }, { "title": "Cofactor dynamics and sufficiency in estrogen receptor-regulated transcription.", "journal": "Cell", "date": "2000", "authors": "Shang Y, Hu X, DiRenzo J, Lazar MA, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11136970", "url": "https://glygen.org/publication/PubMed/11136970" } ] }, { "title": "Estrogen receptor-mediated activation of the serum response element in MCF-7 cells through MAPK-dependent phosphorylation of Elk-1.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Duan R, Xie W, Burghardt RC, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "11145955", "url": "https://glygen.org/publication/PubMed/11145955" } ] }, { "title": "Transcriptional activation of cathepsin D gene expression by 17beta-estradiol: mechanism of aryl hydrocarbon receptor-mediated inhibition.", "journal": "Molecular and cellular endocrinology", "date": "2001", "authors": "Wang F, Samudio I, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11165043", "url": "https://glygen.org/publication/PubMed/11165043" } ] }, { "title": "Reduction in cyclin D1/Cdk4/retinoblastoma protein signaling by CRE-decoy oligonucleotide.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Park YG, Park S, Lim SO, Lee MS, Ryu CK, Kim I, Cho-Chung YS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "11243864", "url": "https://glygen.org/publication/PubMed/11243864" } ] }, { "title": "Thrombin regulates vascular smooth muscle cell growth and heat shock proteins via the JAK-STAT pathway.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Madamanchi NR, Li S, Patterson C, Runge MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11278437", "url": "https://glygen.org/publication/PubMed/11278437" } ] }, { "title": "The mechanism of PAK activation. Autophosphorylation events in both regulatory and kinase domains control activity.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Chong C, Tan L, Lim L, Manser E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "11278486", "url": "https://glygen.org/publication/PubMed/11278486" } ] }, { "title": "Co-operative effect of c-Src tyrosine kinase and Stat3 in activation of hepatocyte growth factor expression in mammary carcinoma cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Hung W, Elliott B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11278729", "url": "https://glygen.org/publication/PubMed/11278729" } ] }, { "title": "Regulation of growth and tumorigenicity of breast cancer cells by the low molecular weight GTPase Rad and nm23.", "journal": "Cancer research", "date": "2001", "authors": "Tseng YH, Vicent D, Zhu J, Niu Y, Adeyinka A, Moyers JS, Watson PH, Kahn CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "11280768", "url": "https://glygen.org/publication/PubMed/11280768" } ] }, { "title": "Mitogen-activated protein kinase kinase 4 metastasis suppressor gene expression is inversely related to histological pattern in advancing human prostatic cancers.", "journal": "Cancer research", "date": "2001", "authors": "Kim HL, Vander Griend DJ, Yang X, Benson DA, Dubauskas Z, Yoshida BA, Chekmareva MA, Ichikawa Y, Sokoloff MH, Zhan P, Karrison T, Lin A, Stadler WM, Ichikawa T, Rubin MA, Rinker-Schaeffer CW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "11306453", "url": "https://glygen.org/publication/PubMed/11306453" } ] }, { "title": "ERK induces p35, a neuron-specific activator of Cdk5, through induction of Egr1.", "journal": "Nature cell biology", "date": "2001", "authors": "Harada T, Morooka T, Ogawa S, Nishida E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "11331872", "url": "https://glygen.org/publication/PubMed/11331872" } ] }, { "title": "A conserved cyclin-binding domain determines functional interplay between anaphase-promoting complex-Cdh1 and cyclin A-Cdk2 during cell cycle progression.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Sorensen CS, Lukas C, Kramer ER, Peters JM, Bartek J, Lukas J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "11340163", "url": "https://glygen.org/publication/PubMed/11340163" } ] }, { "title": "Vav1 regulates phospholipase cgamma activation and calcium responses in mast cells.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Manetz TS, Gonzalez-Espinosa C, Arudchandran R, Xirasagar S, Tybulewicz V, Rivera J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "11340169", "url": "https://glygen.org/publication/PubMed/11340169" } ] }, { "title": "Selective targeting of newly synthesized Arc mRNA to active synapses requires NMDA receptor activation.", "journal": "Neuron", "date": "2001", "authors": "Steward O, Worley PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "11343657", "url": "https://glygen.org/publication/PubMed/11343657" } ] }, { "title": "Transcriptional activation of genes by 17 beta-estradiol through estrogen receptor-Sp1 interactions.", "journal": "Vitamins and hormones", "date": "2001", "authors": "Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11345900", "url": "https://glygen.org/publication/PubMed/11345900" } ] }, { "title": "Identification of a p53 response element in the promoter region of the hMSH2 gene required for expression in A2780 ovarian cancer cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Warnick CT, Dabbas B, Ford CD, Strait KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "11350971", "url": "https://glygen.org/publication/PubMed/11350971" } ] }, { "title": "c-Jun and c-Fos cooperate with STAT3 in IL-6-induced transactivation of the IL-6 respone element (IRE).", "journal": "Cytokine", "date": "2001", "authors": "Schuringa JJ, Timmer H, Luttickhuizen D, Vellenga E, Kruijer W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11356008", "url": "https://glygen.org/publication/PubMed/11356008" } ] }, { "title": "Stat3-mediated Myc expression is required for Src transformation and PDGF-induced mitogenesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Bowman T, Broome MA, Sinibaldi D, Wharton W, Pledger WJ, Sedivy JM, Irby R, Yeatman T, Courtneidge SA, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11404481", "url": "https://glygen.org/publication/PubMed/11404481" } ] }, { "title": "Estrogen regulation of cyclin D1 gene expression in ZR-75 breast cancer cells involves multiple enhancer elements.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Castro-Rivera E, Samudio I, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11410592", "url": "https://glygen.org/publication/PubMed/11410592" } ] }, { "title": "Estrogen receptor interaction with estrogen response elements.", "journal": "Nucleic acids research", "date": "2001", "authors": "Klinge CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11452016", "url": "https://glygen.org/publication/PubMed/11452016" } ] }, { "title": "Cooperation between STAT3 and c-jun suppresses Fas transcription.", "journal": "Molecular cell", "date": "2001", "authors": "Ivanov VN, Bhoumik A, Krasilnikov M, Raz R, Owen-Schaub LB, Levy D, Horvath CM, Ronai Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11463377", "url": "https://glygen.org/publication/PubMed/11463377" } ] }, { "title": "Use of chromatin immunoprecipitation to clone novel E2F target promoters.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Weinmann AS, Bartley SM, Zhang T, Zhang MQ, Farnham PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "11564866", "url": "https://glygen.org/publication/PubMed/11564866" } ] }, { "title": "Frequent and early loss of the EGR1 corepressor NAB2 in human prostate carcinoma.", "journal": "Human pathology", "date": "2001", "authors": "Abdulkadir SA, Carbone JM, Naughton CK, Humphrey PA, Catalona WJ, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "11567222", "url": "https://glygen.org/publication/PubMed/11567222" } ] }, { "title": "Selective coactivation of estrogen-dependent transcription by CITED1 CBP/p300-binding protein.", "journal": "Genes & development", "date": "2001", "authors": "Yahata T, Shao W, Endoh H, Hur J, Coser KR, Sun H, Ueda Y, Kato S, Isselbacher KJ, Brown M, Shioda T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11581164", "url": "https://glygen.org/publication/PubMed/11581164" } ] }, { "title": "Characterization of regulatory events associated with membrane targeting of p90 ribosomal S6 kinase 1.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Richards SA, Dreisbach VC, Murphy LO, Blenis J", "evidence": [ { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" } ], "reference": [ { "type": "PubMed", "id": "11585927", "url": "https://glygen.org/publication/PubMed/11585927" } ] }, { "title": "Synergism between ERalpha transactivation function 1 (AF-1) and AF-2 mediated by steroid receptor coactivator protein-1: requirement for the AF-1 alpha-helical core and for a direct interaction between the N- and C-terminal domains.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2001", "authors": "Metivier R, Penot G, Flouriot G, Pakdel F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11682626", "url": "https://glygen.org/publication/PubMed/11682626" } ] }, { "title": "PI3-kinase in concert with Src promotes the S-phase entry of oestradiol-stimulated MCF-7 cells.", "journal": "The EMBO journal", "date": "2001", "authors": "Castoria G, Migliaccio A, Bilancio A, Di Domenico M, de Falco A, Lombardi M, Fiorentino R, Varricchio L, Barone MV, Auricchio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "11689445", "url": "https://glygen.org/publication/PubMed/11689445" } ] }, { "title": "p27 cytoplasmic localization is regulated by phosphorylation on Ser10 and is not a prerequisite for its proteolysis.", "journal": "The EMBO journal", "date": "2001", "authors": "Rodier G, Montagnoli A, Di Marcotullio L, Coulombe P, Draetta GF, Pagano M, Meloche S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "11726503", "url": "https://glygen.org/publication/PubMed/11726503" } ] }, { "title": "NGF-dependent and tissue-specific transcription of vgf is regulated by a CREB-p300 and bHLH factor interaction.", "journal": "FEBS letters", "date": "2002", "authors": "Mandolesi G, Gargano S, Pennuto M, Illi B, Molfetta R, Soucek L, Mosca L, Levi A, Jucker R, Nasi S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "11755530", "url": "https://glygen.org/publication/PubMed/11755530" } ] }, { "title": "Pak1 kinase homodimers are autoinhibited in trans and dissociated upon activation by Cdc42 and Rac1.", "journal": "Molecular cell", "date": "2002", "authors": "Parrini MC, Lei M, Harrison SC, Mayer BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "11804587", "url": "https://glygen.org/publication/PubMed/11804587" } ] }, { "title": "The regulation and function of the Id proteins in lymphocyte development.", "journal": "Oncogene", "date": "2001", "authors": "Rivera R, Murre C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "11840323", "url": "https://glygen.org/publication/PubMed/11840323" } ] }, { "title": "Expression of FKHR, FKHRL1, and AFX genes in the rodent ovary: evidence for regulation by IGF-I, estrogen, and the gonadotropins.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2002", "authors": "Richards JS, Sharma SC, Falender AE, Lo YH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "11875118", "url": "https://glygen.org/publication/PubMed/11875118" } ] }, { "title": "Phosphorylation of p27Kip1 on serine 10 is required for its binding to CRM1 and nuclear export.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Ishida N, Hara T, Kamura T, Yoshida M, Nakayama K, Nakayama KI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "11889117", "url": "https://glygen.org/publication/PubMed/11889117" } ] }, { "title": "The GTP binding proteins Gem and Rad are negative regulators of the Rho-Rho kinase pathway.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Ward Y, Yap SF, Ravichandran V, Matsumura F, Ito M, Spinelli B, Kelly K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "11956230", "url": "https://glygen.org/publication/PubMed/11956230" } ] }, { "title": "Constitutive Stat3 activity up-regulates VEGF expression and tumor angiogenesis.", "journal": "Oncogene", "date": "2002", "authors": "Niu G, Wright KL, Huang M, Song L, Haura E, Turkson J, Zhang S, Wang T, Sinibaldi D, Coppola D, Heller R, Ellis LM, Karras J, Bromberg J, Pardoll D, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11960372", "url": "https://glygen.org/publication/PubMed/11960372" } ] }, { "title": "p53 Binds and activates the xeroderma pigmentosum DDB2 gene in humans but not mice.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Tan T, Chu G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "11971958", "url": "https://glygen.org/publication/PubMed/11971958" } ] }, { "title": "AP-1 as a regulator of cell life and death.", "journal": "Nature cell biology", "date": "2002", "authors": "Shaulian E, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "11988758", "url": "https://glygen.org/publication/PubMed/11988758" } ] }, { "title": "Cyclin K as a direct transcriptional target of the p53 tumor suppressor.", "journal": "Neoplasia (New York, N.Y.)", "date": "2002", "authors": "Mori T, Anazawa Y, Matsui K, Fukuda S, Nakamura Y, Arakawa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "11988847", "url": "https://glygen.org/publication/PubMed/11988847" } ] }, { "title": "Estrogen alters thresholds for B cell apoptosis and activation.", "journal": "The Journal of clinical investigation", "date": "2002", "authors": "Grimaldi CM, Cleary J, Dagtas AS, Moussai D, Diamond B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "12070310", "url": "https://glygen.org/publication/PubMed/12070310" } ] }, { "title": "A growth factor-dependent nuclear kinase phosphorylates p27(Kip1) and regulates cell cycle progression.", "journal": "The EMBO journal", "date": "2002", "authors": "Boehm M, Yoshimoto T, Crook MF, Nallamshetty S, True A, Nabel GJ, Nabel EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "12093740", "url": "https://glygen.org/publication/PubMed/12093740" } ] }, { "title": "Molecular interpretation of ERK signal duration by immediate early gene products.", "journal": "Nature cell biology", "date": "2002", "authors": "Murphy LO, Smith S, Chen RH, Fingar DC, Blenis J", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" }, { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" }, { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" } ], "reference": [ { "type": "PubMed", "id": "12134156", "url": "https://glygen.org/publication/PubMed/12134156" } ] }, { "title": "Phosphorylation-dependent scaffolding role of JSAP1/JIP3 in the ASK1-JNK signaling pathway. A new mode of regulation of the MAP kinase cascade.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Matsuura H, Nishitoh H, Takeda K, Matsuzawa A, Amagasa T, Ito M, Yoshioka K, Ichijo H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "12189133", "url": "https://glygen.org/publication/PubMed/12189133" } ] }, { "title": "Evidence of functional modulation of the MEKK/JNK/cJun signaling cascade by the low density lipoprotein receptor-related protein (LRP).", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Lutz C, Nimpf J, Jenny M, Boecklinger K, Enzinger C, Utermann G, Baier-Bitterlich G, Baier G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "12193592", "url": "https://glygen.org/publication/PubMed/12193592" } ] }, { "title": "IL-13 signal transduction in human monocytes: phosphorylation of receptor components, association with Jaks, and phosphorylation/activation of Stats.", "journal": "Journal of leukocyte biology", "date": "2002", "authors": "Roy B, Bhattacharjee A, Xu B, Ford D, Maizel AL, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12223527", "url": "https://glygen.org/publication/PubMed/12223527" } ] }, { "title": "Expression of the suppressor of cytokine signaling-5 (SOCS5) negatively regulates IL-4-dependent STAT6 activation and Th2 differentiation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Seki Y, Hayashi K, Matsumoto A, Seki N, Tsukada J, Ransom J, Naka T, Kishimoto T, Yoshimura A, Kubo M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12242343", "url": "https://glygen.org/publication/PubMed/12242343" } ] }, { "title": "Corepressor-dependent silencing of chromosomal regions encoding neuronal genes.", "journal": "Science (New York, N.Y.)", "date": "2002", "authors": "Lunyak VV, Burgess R, Prefontaine GG, Nelson C, Sze SH, Chenoweth J, Schwartz P, Pevzner PA, Glass C, Mandel G, Rosenfeld MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "12399542", "url": "https://glygen.org/publication/PubMed/12399542" } ] }, { "title": "Acetylation of p53 inhibits its ubiquitination by Mdm2.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Li M, Luo J, Brooks CL, Gu W", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "12421820", "url": "https://glygen.org/publication/PubMed/12421820" } ] }, { "title": "Histone methyltransferase activity associated with a human multiprotein complex containing the Enhancer of Zeste protein.", "journal": "Genes & development", "date": "2002", "authors": "Kuzmichev A, Nishioka K, Erdjument-Bromage H, Tempst P, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "12435631", "url": "https://glygen.org/publication/PubMed/12435631" } ] }, { "title": "Crosstalk between CARM1 methylation and CBP acetylation on histone H3.", "journal": "Current biology : CB", "date": "2002", "authors": "Daujat S, Bauer UM, Shah V, Turner B, Berger S, Kouzarides T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "12498683", "url": "https://glygen.org/publication/PubMed/12498683" } ] }, { "title": "Synthesis of serotonin by a second tryptophan hydroxylase isoform.", "journal": "Science (New York, N.Y.)", "date": "2003", "authors": "Walther DJ, Peter JU, Bashammakh S, Hortnagl H, Voits M, Fink H, Bader M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "12511643", "url": "https://glygen.org/publication/PubMed/12511643" } ] }, { "title": "Independent and cooperative activation of chromosomal c-fos promoter by STAT3.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Yang E, Lerner L, Besser D, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12600988", "url": "https://glygen.org/publication/PubMed/12600988" } ] }, { "title": "Two domains of the progesterone receptor interact with the estrogen receptor and are required for progesterone activation of the c-Src/Erk pathway in mammalian cells.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Ballare C, Uhrig M, Bechtold T, Sancho E, Di Domenico M, Migliaccio A, Auricchio F, Beato M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "12612073", "url": "https://glygen.org/publication/PubMed/12612073" } ] }, { "title": "Vav1: a key signal transducer downstream of the TCR.", "journal": "Immunological reviews", "date": "2003", "authors": "Tybulewicz VL, Ardouin L, Prisco A, Reynolds LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "12670394", "url": "https://glygen.org/publication/PubMed/12670394" } ] }, { "title": "Regulation of PRAK subcellular location by p38 MAP kinases.", "journal": "Molecular biology of the cell", "date": "2003", "authors": "New L, Jiang Y, Han J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "12808055", "url": "https://glygen.org/publication/PubMed/12808055" } ] }, { "title": "The cell cycle: a review of regulation, deregulation and therapeutic targets in cancer.", "journal": "Cell proliferation", "date": "2003", "authors": "Vermeulen K, Van Bockstaele DR, Berneman ZN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "12814430", "url": "https://glygen.org/publication/PubMed/12814430" } ] }, { "title": "STATs dimerize in the absence of phosphorylation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Braunstein J, Brutsaert S, Olson R, Schindler C", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12832402", "url": "https://glygen.org/publication/PubMed/12832402" } ] }, { "title": "Phosphorylation of p90 ribosomal S6 kinase (RSK) regulates extracellular signal-regulated kinase docking and RSK activity.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Roux PP, Richards SA, Blenis J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "12832467", "url": "https://glygen.org/publication/PubMed/12832467" } ] }, { "title": "Estrogens down-regulate p27Kip1 in breast cancer cells through Skp2 and through nuclear export mediated by the ERK pathway.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Foster JS, Fernando RI, Ishida N, Nakayama KI, Wimalasena J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "12904306", "url": "https://glygen.org/publication/PubMed/12904306" } ] }, { "title": "Profiling of estrogen up- and down-regulated gene expression in human breast cancer cells: insights into gene networks and pathways underlying estrogenic control of proliferation and cell phenotype.", "journal": "Endocrinology", "date": "2003", "authors": "Frasor J, Danes JM, Komm B, Chang KC, Lyttle CR, Katzenellenbogen BS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "12959972", "url": "https://glygen.org/publication/PubMed/12959972" } ] }, { "title": "Phosphorylation of the carboxyl-terminal transactivation domain of c-Fos by extracellular signal-regulated kinase mediates the transcriptional activation of AP-1 and cellular transformation induced by platelet-derived growth factor.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Monje P, Marinissen MJ, Gutkind JS", "evidence": [ { "database": "iPTMnet", "id": "P01100-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100-1" } ], "reference": [ { "type": "PubMed", "id": "12972619", "url": "https://glygen.org/publication/PubMed/12972619" } ] }, { "title": "Expression of the MAPK kinases MKK-4 and MKK-7 in rheumatoid arthritis and their role as key regulators of JNK.", "journal": "Arthritis and rheumatism", "date": "2003", "authors": "Sundarrajan M, Boyle DL, Chabaud-Riou M, Hammaker D, Firestein GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "13130464", "url": "https://glygen.org/publication/PubMed/13130464" } ] }, { "title": "NGF induces the expression of the VGF gene through a cAMP response element.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "1992", "authors": "Hawley RJ, Scheibe RJ, Wagner JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "1377233", "url": "https://glygen.org/publication/PubMed/1377233" } ] }, { "title": "HdmX stimulates Hdm2-mediated ubiquitination and degradation of p53.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Linares LK, Hengstermann A, Ciechanover A, Muller S, Scheffner M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "14507994", "url": "https://glygen.org/publication/PubMed/14507994" } ] }, { "title": "Local regulation of fat metabolism in peripheral nerves.", "journal": "Genes & development", "date": "2003", "authors": "Verheijen MH, Chrast R, Burrola P, Lemke G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "14522948", "url": "https://glygen.org/publication/PubMed/14522948" } ] }, { "title": "EZH2 is downstream of the pRB-E2F pathway, essential for proliferation and amplified in cancer.", "journal": "The EMBO journal", "date": "2003", "authors": "Bracken AP, Pasini D, Capra M, Prosperini E, Colli E, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "14532106", "url": "https://glygen.org/publication/PubMed/14532106" } ] }, { "title": "Disruption of the nonneuronal tph1 gene demonstrates the importance of peripheral serotonin in cardiac function.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Cote F, Thevenot E, Fligny C, Fromes Y, Darmon M, Ripoche MA, Bayard E, Hanoun N, Saurini F, Lechat P, Dandolo L, Hamon M, Mallet J, Vodjdani G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "14597720", "url": "https://glygen.org/publication/PubMed/14597720" } ] }, { "title": "Acetylation and methylation in nuclear receptor gene activation.", "journal": "Methods in enzymology", "date": "2003", "authors": "Xu W, Cho H, Evans RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "14631847", "url": "https://glygen.org/publication/PubMed/14631847" } ] }, { "title": "IL-4 and IL-13 induce SOCS-1 gene expression in A549 cells by three functional STAT6-binding motifs located upstream of the transcription initiation site.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2003", "authors": "Hebenstreit D, Luft P, Schmiedlechner A, Regl G, Frischauf AM, Aberger F, Duschl A, Horejs-Hoeck J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "14634100", "url": "https://glygen.org/publication/PubMed/14634100" } ] }, { "title": "17beta-estradiol inhibits oxidative stress-induced apoptosis in keratinocytes by promoting Bcl-2 expression.", "journal": "The Journal of investigative dermatology", "date": "2003", "authors": "Kanda N, Watanabe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "14675202", "url": "https://glygen.org/publication/PubMed/14675202" } ] }, { "title": "Estrogen receptor-alpha directs ordered, cyclical, and combinatorial recruitment of cofactors on a natural target promoter.", "journal": "Cell", "date": "2003", "authors": "Metivier R, Penot G, Hubner MR, Reid G, Brand H, Kos M, Gannon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "14675539", "url": "https://glygen.org/publication/PubMed/14675539" } ] }, { "title": "Identification of an autoregulatory feedback pathway involving interleukin-1alpha in induction of constitutive NF-kappaB activation in pancreatic cancer cells.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Niu J, Li Z, Peng B, Chiao PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "14679213", "url": "https://glygen.org/publication/PubMed/14679213" } ] }, { "title": "Identification of a novel basic helix-loop-helix-PAS factor, NXF, reveals a Sim2 competitive, positive regulatory role in dendritic-cytoskeleton modulator drebrin gene expression.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Ooe N, Saito K, Mikami N, Nakatuka I, Kaneko H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9768919", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9768919" } ], "reference": [ { "type": "PubMed", "id": "14701734", "url": "https://glygen.org/publication/PubMed/14701734" } ] }, { "title": "Stat3 enhances vimentin gene expression by binding to the antisilencer element and interacting with the repressor protein, ZBP-89.", "journal": "Oncogene", "date": "2004", "authors": "Wu Y, Diab I, Zhang X, Izmailova ES, Zehner ZE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "14712222", "url": "https://glygen.org/publication/PubMed/14712222" } ] }, { "title": "Muscarinic acetylcholine receptor stimulation induces expression of the activity-regulated cytoskeleton-associated gene (ARC).", "journal": "Brain research. Molecular brain research", "date": "2004", "authors": "Teber I, Kohling R, Speckmann EJ, Barnekow A, Kremerskothen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "14969744", "url": "https://glygen.org/publication/PubMed/14969744" } ] }, { "title": "Genome-wide identification of high-affinity estrogen response elements in human and mouse.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2004", "authors": "Bourdeau V, Deschenes J, Metivier R, Nagai Y, Nguyen D, Bretschneider N, Gannon F, White JH, Mader S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15001666", "url": "https://glygen.org/publication/PubMed/15001666" } ] }, { "title": "The G protein-coupled receptor GPR30 mediates c-fos up-regulation by 17beta-estradiol and phytoestrogens in breast cancer cells.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Maggiolini M, Vivacqua A, Fasanella G, Recchia AG, Sisci D, Pezzi V, Montanaro D, Musti AM, Picard D, Ando S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "15090535", "url": "https://glygen.org/publication/PubMed/15090535" } ] }, { "title": "Rho kinase regulates schwann cell myelination and formation of associated axonal domains.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2004", "authors": "Melendez-Vasquez CV, Einheber S, Salzer JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "15102911", "url": "https://glygen.org/publication/PubMed/15102911" } ] }, { "title": "Stat3 activation regulates the expression of matrix metalloproteinase-2 and tumor invasion and metastasis.", "journal": "Oncogene", "date": "2004", "authors": "Xie TX, Wei D, Liu M, Gao AC, Ali-Osman F, Sawaya R, Huang S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15116091", "url": "https://glygen.org/publication/PubMed/15116091" } ] }, { "title": "Neurotrophins regulate Schwann cell migration by activating divergent signaling pathways dependent on Rho GTPases.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Yamauchi J, Chan JR, Shooter EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "15161978", "url": "https://glygen.org/publication/PubMed/15161978" } ] }, { "title": "17beta-estradiol stimulates the growth of human keratinocytes by inducing cyclin D2 expression.", "journal": "The Journal of investigative dermatology", "date": "2004", "authors": "Kanda N, Watanabe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "15245432", "url": "https://glygen.org/publication/PubMed/15245432" } ] }, { "title": "STAT-1 is activated by IL-4 and IL-13 in multiple cell types.", "journal": "Molecular immunology", "date": "2004", "authors": "Wang IM, Lin H, Goldman SJ, Kobayashi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15261459", "url": "https://glygen.org/publication/PubMed/15261459" } ] }, { "title": "Cellular control of gene expression by T-type cyclin/CDK9 complexes.", "journal": "Gene", "date": "2004", "authors": "Garriga J, Grana X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15276198", "url": "https://glygen.org/publication/PubMed/15276198" } ] }, { "title": "Estrogens and progesterone promote persistent CCND1 gene activation during G1 by inducing transcriptional derepression via c-Jun/c-Fos/estrogen receptor (progesterone receptor) complex assembly to a distal regulatory element and recruitment of cyclin D1 to its own gene promoter.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Cicatiello L, Addeo R, Sasso A, Altucci L, Petrizzi VB, Borgo R, Cancemi M, Caporali S, Caristi S, Scafoglio C, Teti D, Bresciani F, Perillo B, Weisz A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15282324", "url": "https://glygen.org/publication/PubMed/15282324" } ] }, { "title": "Catalysis and function of the p38 alpha.MK2a signaling complex.", "journal": "Biochemistry", "date": "2004", "authors": "Lukas SM, Kroe RR, Wildeson J, Peet GW, Frego L, Davidson W, Ingraham RH, Pargellis CA, Labadia ME, Werneburg BG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "15287722", "url": "https://glygen.org/publication/PubMed/15287722" } ] }, { "title": "Role of atypical protein kinase C in estradiol-triggered G1/S progression of MCF-7 cells.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Castoria G, Migliaccio A, Di Domenico M, Lombardi M, de Falco A, Varricchio L, Bilancio A, Barone MV, Auricchio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "15314172", "url": "https://glygen.org/publication/PubMed/15314172" } ] }, { "title": "Parallel identification of O-GlcNAc-modified proteins from cell lysates.", "journal": "Journal of the American Chemical Society", "date": "2004", "authors": "Tai HC, Khidekel N, Ficarro SB, Peters EC, Hsieh-Wilson LC", "evidence": [ { "database": "O-GlcNAc Database", "id": "P01100", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01100" } ], "reference": [ { "type": "PubMed", "id": "15327282", "url": "https://glygen.org/publication/PubMed/15327282" } ] }, { "title": "Transcriptional complexes engaged by apo-estrogen receptor-alpha isoforms have divergent outcomes.", "journal": "The EMBO journal", "date": "2004", "authors": "Metivier R, Penot G, Carmouche RP, Hubner MR, Reid G, Denger S, Manu D, Brand H, Kos M, Benes V, Gannon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15343269", "url": "https://glygen.org/publication/PubMed/15343269" } ] }, { "title": "Discovery of estrogen receptor alpha target genes and response elements in breast tumor cells.", "journal": "Genome biology", "date": "2004", "authors": "Lin CY, Strom A, Vega VB, Kong SL, Yeo AL, Thomsen JS, Chan WC, Doray B, Bangarusamy DK, Ramasamy A, Vergara LA, Tang S, Chong A, Bajic VB, Miller LD, Gustafsson JA, Liu ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15345050", "url": "https://glygen.org/publication/PubMed/15345050" } ] }, { "title": "Egr-1 is activated by 17beta-estradiol in MCF-7 cells by mitogen-activated protein kinase-dependent phosphorylation of ELK-1.", "journal": "Journal of cellular biochemistry", "date": "2004", "authors": "Chen CC, Lee WR, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "15449318", "url": "https://glygen.org/publication/PubMed/15449318" } ] }, { "title": "Alteration of a cyclic AMP-dependent protein kinase phosphorylation site in the c-Fos protein augments its transforming potential.", "journal": "Molecular and cellular biology", "date": "1992", "authors": "Tratner I, Ofir R, Verma IM", "evidence": [ { "database": "iPTMnet", "id": "P01100-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100-1" } ], "reference": [ { "type": "PubMed", "id": "1545828", "url": "https://glygen.org/publication/PubMed/1545828" } ] }, { "title": "Global gene expression analysis of estrogen receptor transcription factor cross talk in breast cancer: identification of estrogen-induced/activator protein-1-dependent genes.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2005", "authors": "DeNardo DG, Kim HT, Hilsenbeck S, Cuba V, Tsimelzon A, Brown PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15514030", "url": "https://glygen.org/publication/PubMed/15514030" } ] }, { "title": "Ternary complex factor-serum response factor complex-regulated gene activity is required for cellular proliferation and inhibition of apoptotic cell death.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Vickers ER, Kasza A, Kurnaz IA, Seifert A, Zeef LA, O'donnell A, Hayes A, Sharrocks AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "15542842", "url": "https://glygen.org/publication/PubMed/15542842" } ] }, { "title": "PAK and other Rho-associated kinases--effectors with surprisingly diverse mechanisms of regulation.", "journal": "The Biochemical journal", "date": "2005", "authors": "Zhao ZS, Manser E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "15548136", "url": "https://glygen.org/publication/PubMed/15548136" } ] }, { "title": "MAPKAP kinase 3pK phosphorylates and regulates chromatin association of the polycomb group protein Bmi1.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Voncken JW, Niessen H, Neufeld B, Rennefahrt U, Dahlmans V, Kubben N, Holzer B, Ludwig S, Rapp UR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "15563468", "url": "https://glygen.org/publication/PubMed/15563468" } ] }, { "title": "AP-1 subunits: quarrel and harmony among siblings.", "journal": "Journal of cell science", "date": "2004", "authors": "Hess J, Angel P, Schorpp-Kistner M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "15564374", "url": "https://glygen.org/publication/PubMed/15564374" } ] }, { "title": "STAT6 transcription factor binding sites with mismatches within the canonical 5'-TTC...GAA-3' motif involved in regulation of delta- and mu-opioid receptors.", "journal": "Journal of neurochemistry", "date": "2004", "authors": "Borner C, Woltje M, Hollt V, Kraus J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15584925", "url": "https://glygen.org/publication/PubMed/15584925" } ] }, { "title": "Defining the CREB regulon: a genome-wide analysis of transcription factor regulatory regions.", "journal": "Cell", "date": "2004", "authors": "Impey S, McCorkle SR, Cha-Molstad H, Dwyer JM, Yochum GS, Boss JM, McWeeney S, Dunn JJ, Mandel G, Goodman RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "15620361", "url": "https://glygen.org/publication/PubMed/15620361" } ] }, { "title": "Regulatory elements in the promoter region of vgf, a nerve growth factor-inducible gene.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1992", "authors": "Possenti R, Di Rocco G, Nasi S, Levi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "1570299", "url": "https://glygen.org/publication/PubMed/1570299" } ] }, { "title": "Integration of the extranuclear and nuclear actions of estrogen.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2005", "authors": "Levin ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "15705661", "url": "https://glygen.org/publication/PubMed/15705661" } ] }, { "title": "Essential role of RSK2 in c-Fos-dependent osteosarcoma development.", "journal": "The Journal of clinical investigation", "date": "2005", "authors": "David JP, Mehic D, Bakiri L, Schilling AF, Mandic V, Priemel M, Idarraga MH, Reschke MO, Hoffmann O, Amling M, Wagner EF", "evidence": [ { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" } ], "reference": [ { "type": "PubMed", "id": "15719069", "url": "https://glygen.org/publication/PubMed/15719069" } ] }, { "title": "Serum/glucocorticoid-inducible kinase can phosphorylate the cyclic AMP response element binding protein, CREB.", "journal": "FEBS letters", "date": "2005", "authors": "David S, Kalb RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "15733869", "url": "https://glygen.org/publication/PubMed/15733869" } ] }, { "title": "Histone methyltransferases G9a and GLP form heteromeric complexes and are both crucial for methylation of euchromatin at H3-K9.", "journal": "Genes & development", "date": "2005", "authors": "Tachibana M, Ueda J, Fukuda M, Takeda N, Ohta T, Iwanari H, Sakihama T, Kodama T, Hamakubo T, Shinkai Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "15774718", "url": "https://glygen.org/publication/PubMed/15774718" } ] }, { "title": "Identification of the mismatch repair genes PMS2 and MLH1 as p53 target genes by using serial analysis of binding elements.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Chen J, Sadowski I", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "15781865", "url": "https://glygen.org/publication/PubMed/15781865" } ] }, { "title": "Aberrant Stat3 signaling by interleukin-4 in malignant glioma cells: involvement of IL-13Ralpha2.", "journal": "Cancer research", "date": "2005", "authors": "Rahaman SO, Vogelbaum MA, Haque SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15805299", "url": "https://glygen.org/publication/PubMed/15805299" } ] }, { "title": "Regulation of cholesterol/lipid biosynthetic genes by Egr2/Krox20 during peripheral nerve myelination.", "journal": "Journal of neurochemistry", "date": "2005", "authors": "Leblanc SE, Srinivasan R, Ferri C, Mager GM, Gillian-Daniel AL, Wrabetz L, Svaren J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "15836632", "url": "https://glygen.org/publication/PubMed/15836632" } ] }, { "title": "Conserved docking site is essential for activation of mammalian MAP kinase kinases by specific MAP kinase kinase kinases.", "journal": "Molecular cell", "date": "2005", "authors": "Takekawa M, Tatebayashi K, Saito H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "15866172", "url": "https://glygen.org/publication/PubMed/15866172" } ] }, { "title": "Gene expression alterations of human peripheral blood monocytes induced by medium-term treatment with the TH2-cytokines interleukin-4 and -13.", "journal": "Cytokine", "date": "2005", "authors": "Chaitidis P, O'Donnell V, Kuban RJ, Bermudez-Fajardo A, Ungethuem U, Kuhn H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15869882", "url": "https://glygen.org/publication/PubMed/15869882" } ] }, { "title": "SRF mediates activity-induced gene expression and synaptic plasticity but not neuronal viability.", "journal": "Nature neuroscience", "date": "2005", "authors": "Ramanan N, Shen Y, Sarsfield S, Lemberger T, Schutz G, Linden DJ, Ginty DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "15880109", "url": "https://glygen.org/publication/PubMed/15880109" } ] }, { "title": "Estrogen-induced G1/S transition of G0-arrested estrogen-dependent breast cancer cells is regulated by mitochondrial oxidant signaling.", "journal": "Oncogene", "date": "2005", "authors": "Felty Q, Singh KP, Roy D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "15897899", "url": "https://glygen.org/publication/PubMed/15897899" } ] }, { "title": "Nuclear interaction of EGFR and STAT3 in the activation of the iNOS/NO pathway.", "journal": "Cancer cell", "date": "2005", "authors": "Lo HW, Hsu SC, Ali-Seyed M, Gunduz M, Xia W, Wei Y, Bartholomeusz G, Shih JY, Hung MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15950906", "url": "https://glygen.org/publication/PubMed/15950906" } ] }, { "title": "GREB 1 is a critical regulator of hormone dependent breast cancer growth.", "journal": "Breast cancer research and treatment", "date": "2005", "authors": "Rae JM, Johnson MD, Scheys JO, Cordero KE, Larios JM, Lippman ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15986123", "url": "https://glygen.org/publication/PubMed/15986123" } ] }, { "title": "Targeting Stat3 blocks both HIF-1 and VEGF expression induced by multiple oncogenic growth signaling pathways.", "journal": "Oncogene", "date": "2005", "authors": "Xu Q, Briggs J, Park S, Niu G, Kortylewski M, Zhang S, Gritsko T, Turkson J, Kay H, Semenza GL, Cheng JQ, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16007214", "url": "https://glygen.org/publication/PubMed/16007214" } ] }, { "title": "Chromosome-wide mapping of estrogen receptor binding reveals long-range regulation requiring the forkhead protein FoxA1.", "journal": "Cell", "date": "2005", "authors": "Carroll JS, Liu XS, Brodsky AS, Li W, Meyer CA, Szary AJ, Eeckhoute J, Shao W, Hestermann EV, Geistlinger TR, Fox EA, Silver PA, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16009131", "url": "https://glygen.org/publication/PubMed/16009131" } ] }, { "title": "Id family of helix-loop-helix proteins in cancer.", "journal": "Nature reviews. Cancer", "date": "2005", "authors": "Perk J, Iavarone A, Benezra R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "16034366", "url": "https://glygen.org/publication/PubMed/16034366" } ] }, { "title": "Cathepsin D: newly discovered functions of a long-standing aspartic protease in cancer and apoptosis.", "journal": "Cancer letters", "date": "2006", "authors": "Liaudet-Coopman E, Beaujouin M, Derocq D, Garcia M, Glondu-Lassis M, Laurent-Matha V, Prebois C, Rochefort H, Vignon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16046058", "url": "https://glygen.org/publication/PubMed/16046058" } ] }, { "title": "STAT3-mediated transcription of Bcl-2, Mcl-1 and c-IAP2 prevents apoptosis in polyamine-depleted cells.", "journal": "The Biochemical journal", "date": "2005", "authors": "Bhattacharya S, Ray RM, Johnson LR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16048438", "url": "https://glygen.org/publication/PubMed/16048438" } ] }, { "title": "Down-regulation of c-Fos/c-Jun AP-1 dimer activity by sumoylation.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Bossis G, Malnou CE, Farras R, Andermarcher E, Hipskind R, Rodriguez M, Schmidt D, Muller S, Jariel-Encontre I, Piechaczyk M", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "reference": [ { "type": "PubMed", "id": "16055710", "url": "https://glygen.org/publication/PubMed/16055710" } ] }, { "title": "From the Cover: Location analysis of estrogen receptor alpha target promoters reveals that FOXA1 defines a domain of the estrogen response.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Laganiere J, Deblois G, Lefebvre C, Bataille AR, Robert F, Giguere V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16087863", "url": "https://glygen.org/publication/PubMed/16087863" } ] }, { "title": "Role of Stat3 in regulating p53 expression and function.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Niu G, Wright KL, Ma Y, Wright GM, Huang M, Irby R, Briggs J, Karras J, Cress WD, Pardoll D, Jove R, Chen J, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16107692", "url": "https://glygen.org/publication/PubMed/16107692" } ] }, { "title": "Downstream targets of growth factor and oestrogen signalling and endocrine resistance: the potential roles of c-Myc, cyclin D1 and cyclin E.", "journal": "Endocrine-related cancer", "date": "2005", "authors": "Butt AJ, McNeil CM, Musgrove EA, Sutherland RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16113099", "url": "https://glygen.org/publication/PubMed/16113099" } ] }, { "title": "Nab proteins are essential for peripheral nervous system myelination.", "journal": "Nature neuroscience", "date": "2005", "authors": "Le N, Nagarajan R, Wang JY, Svaren J, LaPash C, Araki T, Schmidt RE, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "16136673", "url": "https://glygen.org/publication/PubMed/16136673" } ] }, { "title": "Essential function for the kinase TAK1 in innate and adaptive immune responses.", "journal": "Nature immunology", "date": "2005", "authors": "Sato S, Sanjo H, Takeda K, Ninomiya-Tsuji J, Yamamoto M, Kawai T, Matsumoto K, Takeuchi O, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "16186825", "url": "https://glygen.org/publication/PubMed/16186825" } ] }, { "title": "BMP enhances transcriptional responses to NGF during PC12 cell differentiation.", "journal": "Neurochemical research", "date": "2005", "authors": "Lonn P, Zaia K, Israelsson C, Althini S, Usoskin D, Kylberg A, Ebendal T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "16187211", "url": "https://glygen.org/publication/PubMed/16187211" } ] }, { "title": "The Fos family of transcription factors and their role in tumourigenesis.", "journal": "European journal of cancer (Oxford, England : 1990)", "date": "2005", "authors": "Milde-Langosch K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "16199154", "url": "https://glygen.org/publication/PubMed/16199154" } ] }, { "title": "Requirement of STAT3 activation for maximal collagenase-1 (MMP-1) induction by epidermal growth factor and malignant characteristics in T24 bladder cancer cells.", "journal": "Oncogene", "date": "2006", "authors": "Itoh M, Murata T, Suzuki T, Shindoh M, Nakajima K, Imai K, Yoshida K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16205632", "url": "https://glygen.org/publication/PubMed/16205632" } ] }, { "title": "A prohormone convertase cleavage site within a predicted alpha-helix mediates sorting of the neuronal and endocrine polypeptide VGF into the regulated secretory pathway.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Garcia AL, Han SK, Janssen WG, Khaing ZZ, Ito T, Glucksman MJ, Benson DL, Salton SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "16221685", "url": "https://glygen.org/publication/PubMed/16221685" } ] }, { "title": "Essential role of STAT3 in cytokine-driven NF-kappaB-mediated serum amyloid A gene expression.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2005", "authors": "Hagihara K, Nishikawa T, Sugamata Y, Song J, Isobe T, Taga T, Yoshizaki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16236134", "url": "https://glygen.org/publication/PubMed/16236134" } ] }, { "title": "The G protein-coupled receptor GPR30 mediates the proliferative effects induced by 17beta-estradiol and hydroxytamoxifen in endometrial cancer cells.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2006", "authors": "Vivacqua A, Bonofiglio D, Recchia AG, Musti AM, Picard D, Ando S, Maggiolini M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "16239258", "url": "https://glygen.org/publication/PubMed/16239258" } ] }, { "title": "Egr-1 induces the expression of its corepressor nab2 by activation of the nab2 promoter thereby establishing a negative feedback loop.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Kumbrink J, Gerlinger M, Johnson JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "16260776", "url": "https://glygen.org/publication/PubMed/16260776" } ] }, { "title": "The neuroplasticity-associated arc gene is a direct transcriptional target of early growth response (Egr) transcription factors.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Li L, Carter J, Gao X, Whitehead J, Tourtellotte WG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "16287845", "url": "https://glygen.org/publication/PubMed/16287845" } ] }, { "title": "Mechanism of estrogen activation of c-myc oncogene expression.", "journal": "Oncogene", "date": "1992", "authors": "Dubik D, Shiu RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "1630819", "url": "https://glygen.org/publication/PubMed/1630819" } ] }, { "title": "Involvement of MINK, a Ste20 family kinase, in Ras oncogene-induced growth arrest in human ovarian surface epithelial cells.", "journal": "Molecular cell", "date": "2005", "authors": "Nicke B, Bastien J, Khanna SJ, Warne PH, Cowling V, Cook SJ, Peters G, Delpuech O, Schulze A, Berns K, Mullenders J, Beijersbergen RL, Bernards R, Ganesan TS, Downward J, Hancock DC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "16337592", "url": "https://glygen.org/publication/PubMed/16337592" } ] }, { "title": "Immediate-early gene-encoded protein Arc is associated with synaptic delivery of GluR4-containing AMPA receptors during in vitro classical conditioning.", "journal": "Journal of neurophysiology", "date": "2006", "authors": "Mokin M, Lindahl JS, Keifer J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "16339507", "url": "https://glygen.org/publication/PubMed/16339507" } ] }, { "title": "Persistent activation of stat3 signaling induces survivin gene expression and confers resistance to apoptosis in human breast cancer cells.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2006", "authors": "Gritsko T, Williams A, Turkson J, Kaneko S, Bowman T, Huang M, Nam S, Eweis I, Diaz N, Sullivan D, Yoder S, Enkemann S, Eschrich S, Lee JH, Beam CA, Cheng J, Minton S, Muro-Cacho CA, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16397018", "url": "https://glygen.org/publication/PubMed/16397018" } ] }, { "title": "Late developmental stage-specific role of tryptophan hydroxylase 1 in brain serotonin levels.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2006", "authors": "Nakamura K, Sugawara Y, Sawabe K, Ohashi A, Tsurui H, Xiu Y, Ohtsuji M, Lin QS, Nishimura H, Hasegawa H, Hirose S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "16407550", "url": "https://glygen.org/publication/PubMed/16407550" } ] }, { "title": "DNA damage signaling and p53-dependent senescence after prolonged beta-interferon stimulation.", "journal": "Molecular biology of the cell", "date": "2006", "authors": "Moiseeva O, Mallette FA, Mukhopadhyay UK, Moores A, Ferbeyre G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "16436515", "url": "https://glygen.org/publication/PubMed/16436515" } ] }, { "title": "SOCS1: a potent and multifaceted regulator of cytokines and cell-mediated inflammation.", "journal": "Tissue antigens", "date": "2006", "authors": "Davey GM, Heath WR, Starr R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16451196", "url": "https://glygen.org/publication/PubMed/16451196" } ] }, { "title": "Activity-dependent regulation of MEF2 transcription factors suppresses excitatory synapse number.", "journal": "Science (New York, N.Y.)", "date": "2006", "authors": "Flavell SW, Cowan CW, Kim TK, Greer PL, Lin Y, Paradis S, Griffith EC, Hu LS, Chen C, Greenberg ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "16484497", "url": "https://glygen.org/publication/PubMed/16484497" } ] }, { "title": "Cyclin D1 is transcriptionally regulated by and required for transformation by activated signal transducer and activator of transcription 3.", "journal": "Cancer research", "date": "2006", "authors": "Leslie K, Lang C, Devgan G, Azare J, Berishaj M, Gerald W, Kim YB, Paz K, Darnell JE, Albanese C, Sakamaki T, Pestell R, Bromberg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16510571", "url": "https://glygen.org/publication/PubMed/16510571" } ] }, { "title": "Signaling mechanisms, interaction partners, and target genes of STAT6.", "journal": "Cytokine & growth factor reviews", "date": "2006", "authors": "Hebenstreit D, Wirnsberger G, Horejs-Hoeck J, Duschl A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16540365", "url": "https://glygen.org/publication/PubMed/16540365" } ] }, { "title": "NAB2 represses transcription by interacting with the CHD4 subunit of the nucleosome remodeling and deacetylase (NuRD) complex.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Srinivasan R, Mager GM, Ward RM, Mayer J, Svaren J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "16574654", "url": "https://glygen.org/publication/PubMed/16574654" } ] }, { "title": "Retrovirus-mediated gene transfer of a human c-fos cDNA into mouse bone marrow stromal cells.", "journal": "Oncogene", "date": "1991", "authors": "Roux P, Verrier B, Klein B, Niccolino M, Marty L, Alexandre C, Piechaczyk M", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "reference": [ { "type": "PubMed", "id": "1658710", "url": "https://glygen.org/publication/PubMed/1658710" } ] }, { "title": "Loss of SOCS3 in T helper cells resulted in reduced immune responses and hyperproduction of interleukin 10 and transforming growth factor-beta 1.", "journal": "The Journal of experimental medicine", "date": "2006", "authors": "Kinjyo I, Inoue H, Hamano S, Fukuyama S, Yoshimura T, Koga K, Takaki H, Himeno K, Takaesu G, Kobayashi T, Yoshimura A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16606674", "url": "https://glygen.org/publication/PubMed/16606674" } ] }, { "title": "The MAP kinase ERK5 binds to and phosphorylates p90 RSK.", "journal": "Archives of biochemistry and biophysics", "date": "2006", "authors": "Ranganathan A, Pearson GW, Chrestensen CA, Sturgill TW, Cobb MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "16626623", "url": "https://glygen.org/publication/PubMed/16626623" } ] }, { "title": "AMPA receptors regulate transcription of the plasticity-related immediate-early gene Arc.", "journal": "Nature neuroscience", "date": "2006", "authors": "Rao VR, Pintchovski SA, Chin J, Peebles CL, Mitra S, Finkbeiner S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "16732277", "url": "https://glygen.org/publication/PubMed/16732277" } ] }, { "title": "Coupling mitochondrial respiratory chain to cell death: an essential role of mitochondrial complex I in the interferon-beta and retinoic acid-induced cancer cell death.", "journal": "Cell death and differentiation", "date": "2007", "authors": "Huang G, Chen Y, Lu H, Cao X", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "16826196", "url": "https://glygen.org/publication/PubMed/16826196" } ] }, { "title": "17beta-estradiol, genistein, and 4-hydroxytamoxifen induce the proliferation of thyroid cancer cells through the g protein-coupled receptor GPR30.", "journal": "Molecular pharmacology", "date": "2006", "authors": "Vivacqua A, Bonofiglio D, Albanito L, Madeo A, Rago V, Carpino A, Musti AM, Picard D, Ando S, Maggiolini M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "16835357", "url": "https://glygen.org/publication/PubMed/16835357" } ] }, { "title": "A cell-type-specific transcriptional network required for estrogen regulation of cyclin D1 and cell cycle progression in breast cancer.", "journal": "Genes & development", "date": "2006", "authors": "Eeckhoute J, Carroll JS, Geistlinger TR, Torres-Arzayus MI, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16980581", "url": "https://glygen.org/publication/PubMed/16980581" } ] }, { "title": "Genome-wide analysis of estrogen receptor binding sites.", "journal": "Nature genetics", "date": "2006", "authors": "Carroll JS, Meyer CA, Song J, Li W, Geistlinger TR, Eeckhoute J, Brodsky AS, Keeton EK, Fertuck KC, Hall GF, Wang Q, Bekiranov S, Sementchenko V, Fox EA, Silver PA, Gingeras TR, Liu XS, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17013392", "url": "https://glygen.org/publication/PubMed/17013392" } ] }, { "title": "Spatiotemporal regulation of c-Fos by ERK5 and the E3 ubiquitin ligase UBR1, and its biological role.", "journal": "Molecular cell", "date": "2006", "authors": "Sasaki T, Kojima H, Kishimoto R, Ikeda A, Kunimoto H, Nakajima K", "evidence": [ { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" } ], "reference": [ { "type": "PubMed", "id": "17018293", "url": "https://glygen.org/publication/PubMed/17018293" } ] }, { "title": "Arc/Arg3.1 is essential for the consolidation of synaptic plasticity and memories.", "journal": "Neuron", "date": "2006", "authors": "Plath N, Ohana O, Dammermann B, Errington ML, Schmitz D, Gross C, Mao X, Engelsberg A, Mahlke C, Welzl H, Kobalz U, Stawrakakis A, Fernandez E, Waltereit R, Bick-Sander A, Therstappen E, Cooke SF, Blanquet V, Wurst W, Salmen B, Bosl MR, Lipp HP, Grant SG, Bliss TV, Wolfer DP, Kuhl D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "17088210", "url": "https://glygen.org/publication/PubMed/17088210" } ] }, { "title": "Arc/Arg3.1 interacts with the endocytic machinery to regulate AMPA receptor trafficking.", "journal": "Neuron", "date": "2006", "authors": "Chowdhury S, Shepherd JD, Okuno H, Lyford G, Petralia RS, Plath N, Kuhl D, Huganir RL, Worley PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "17088211", "url": "https://glygen.org/publication/PubMed/17088211" } ] }, { "title": "Increased expression of the immediate-early gene arc/arg3.1 reduces AMPA receptor-mediated synaptic transmission.", "journal": "Neuron", "date": "2006", "authors": "Rial Verde EM, Lee-Osbourne J, Worley PF, Malinow R, Cline HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "17088212", "url": "https://glygen.org/publication/PubMed/17088212" } ] }, { "title": "N-Terminal c-Fos tyrosine phosphorylation regulates c-Fos/ER association and c-Fos-dependent phospholipid synthesis activation.", "journal": "Oncogene", "date": "2007", "authors": "Portal MM, Ferrero GO, Caputto BL", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" }, { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" } ], "reference": [ { "type": "PubMed", "id": "17160021", "url": "https://glygen.org/publication/PubMed/17160021" } ] }, { "title": "pRB family proteins are required for H3K27 trimethylation and Polycomb repression complexes binding to and silencing p16INK4alpha tumor suppressor gene.", "journal": "Genes & development", "date": "2007", "authors": "Kotake Y, Cao R, Viatour P, Sage J, Zhang Y, Xiong Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17210787", "url": "https://glygen.org/publication/PubMed/17210787" } ] }, { "title": "PRAK is essential for ras-induced senescence and tumor suppression.", "journal": "Cell", "date": "2007", "authors": "Sun P, Yoshizuka N, New L, Moser BA, Li Y, Liao R, Xie C, Chen J, Deng Q, Yamout M, Dong MQ, Frangou CG, Yates JR 3rd, Wright PE, Han J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17254968", "url": "https://glygen.org/publication/PubMed/17254968" } ] }, { "title": "Crystal structure of the p38 alpha-MAPKAP kinase 2 heterodimer.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "ter Haar E, Prabhakar P, Liu X, Lepre C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17255097", "url": "https://glygen.org/publication/PubMed/17255097" } ] }, { "title": "Cooperative demethylation by JMJD2C and LSD1 promotes androgen receptor-dependent gene expression.", "journal": "Nature cell biology", "date": "2007", "authors": "Wissmann M, Yin N, Muller JM, Greschik H, Fodor BD, Jenuwein T, Vogler C, Schneider R, Gunther T, Buettner R, Metzger E, Schule R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17277772", "url": "https://glygen.org/publication/PubMed/17277772" } ] }, { "title": "G protein-coupled receptor 30 (GPR30) mediates gene expression changes and growth response to 17beta-estradiol and selective GPR30 ligand G-1 in ovarian cancer cells.", "journal": "Cancer research", "date": "2007", "authors": "Albanito L, Madeo A, Lappano R, Vivacqua A, Rago V, Carpino A, Oprea TI, Prossnitz ER, Musti AM, Ando S, Maggiolini M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "17308128", "url": "https://glygen.org/publication/PubMed/17308128" } ] }, { "title": "Bypass of senescence by the polycomb group protein CBX8 through direct binding to the INK4A-ARF locus.", "journal": "The EMBO journal", "date": "2007", "authors": "Dietrich N, Bracken AP, Trinh E, Schjerling CK, Koseki H, Rappsilber J, Helin K, Hansen KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17332741", "url": "https://glygen.org/publication/PubMed/17332741" } ] }, { "title": "The Polycomb group proteins bind throughout the INK4A-ARF locus and are disassociated in senescent cells.", "journal": "Genes & development", "date": "2007", "authors": "Bracken AP, Kleine-Kohlbrecher D, Dietrich N, Pasini D, Gargiulo G, Beekman C, Theilgaard-Monch K, Minucci S, Porse BT, Marine JC, Hansen KH, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17344414", "url": "https://glygen.org/publication/PubMed/17344414" } ] }, { "title": "Molecular basis of MAPK-activated protein kinase 2:p38 assembly.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "White A, Pargellis CA, Studts JM, Werneburg BG, Farmer BT 2nd", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17395714", "url": "https://glygen.org/publication/PubMed/17395714" } ] }, { "title": "Diverse effects of Stat1 on the regulation of hsp90alpha gene under heat shock.", "journal": "Journal of cellular biochemistry", "date": "2007", "authors": "Chen XS, Zhang Y, Wang JS, Li XY, Cheng XK, Zhang Y, Wu NH, Shen YF", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "17427945", "url": "https://glygen.org/publication/PubMed/17427945" } ] }, { "title": "IL-13 induces expression of CD36 in human monocytes through PPARgamma activation.", "journal": "European journal of immunology", "date": "2007", "authors": "Berry A, Balard P, Coste A, Olagnier D, Lagane C, Authier H, Benoit-Vical F, Lepert JC, Seguela JP, Magnaval JF, Chambon P, Metzger D, Desvergne B, Wahli W, Auwerx J, Pipy B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "17458857", "url": "https://glygen.org/publication/PubMed/17458857" } ] }, { "title": "Regulation of GREB1 transcription by estrogen receptor alpha through a multipartite enhancer spread over 20 kb of upstream flanking sequences.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Deschenes J, Bourdeau V, White JH, Mader S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17463000", "url": "https://glygen.org/publication/PubMed/17463000" } ] }, { "title": "The DEAD-box p68/p72 proteins and the noncoding RNA steroid receptor activator SRA: eclectic regulators of disparate biological functions.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2007", "authors": "Caretti G, Lei EP, Sartorelli V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17495528", "url": "https://glygen.org/publication/PubMed/17495528" } ] }, { "title": "Novel estrogen receptor-alpha binding sites and estradiol target genes identified by chromatin immunoprecipitation cloning in breast cancer.", "journal": "Cancer research", "date": "2007", "authors": "Lin Z, Reierstad S, Huang CC, Bulun SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17510434", "url": "https://glygen.org/publication/PubMed/17510434" } ] }, { "title": "GEFs and GAPs: critical elements in the control of small G proteins.", "journal": "Cell", "date": "2007", "authors": "Bos JL, Rehmann H, Wittinghofer A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "17540168", "url": "https://glygen.org/publication/PubMed/17540168" } ] }, { "title": "Fra-1 and Stat3 synergistically regulate activation of human MMP-9 gene.", "journal": "Molecular immunology", "date": "2008", "authors": "Song Y, Qian L, Song S, Chen L, Zhang Y, Yuan G, Zhang H, Xia Q, Hu M, Yu M, Shi M, Jiang Z, Guo N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "17572495", "url": "https://glygen.org/publication/PubMed/17572495" } ] }, { "title": "The EJC factor eIF4AIII modulates synaptic strength and neuronal protein expression.", "journal": "Cell", "date": "2007", "authors": "Giorgi C, Yeo GW, Stone ME, Katz DB, Burge C, Turrigiano G, Moore MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "17632064", "url": "https://glygen.org/publication/PubMed/17632064" } ] }, { "title": "The AP-1 transcription factor regulates breast cancer cell growth via cyclins and E2F factors.", "journal": "Oncogene", "date": "2008", "authors": "Shen Q, Uray IP, Li Y, Krisko TI, Strecker TE, Kim HT, Brown PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17637753", "url": "https://glygen.org/publication/PubMed/17637753" } ] }, { "title": "Long-range activation of GREB1 by estrogen receptor via three distal consensus estrogen-responsive elements in breast cancer cells.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2007", "authors": "Sun J, Nawaz Z, Slingerland JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17666587", "url": "https://glygen.org/publication/PubMed/17666587" } ] }, { "title": "Mechanism of and requirement for estrogen-regulated MYB expression in estrogen-receptor-positive breast cancer cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Drabsch Y, Hugo H, Zhang R, Dowhan DH, Miao YR, Gewirtz AM, Barry SC, Ramsay RG, Gonda TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17690249", "url": "https://glygen.org/publication/PubMed/17690249" } ] }, { "title": "Ubc9 fusion-directed SUMOylation identifies constitutive and inducible SUMOylation.", "journal": "Nucleic acids research", "date": "2007", "authors": "Jakobs A, Himstedt F, Funk M, Korn B, Gaestel M, Niedenthal R", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "reference": [ { "type": "PubMed", "id": "17709345", "url": "https://glygen.org/publication/PubMed/17709345" } ] }, { "title": "Pro-inflammatory cytokines increase reactive oxygen species through mitochondria and NADPH oxidase in cultured RPE cells.", "journal": "Experimental eye research", "date": "2007", "authors": "Yang D, Elner SG, Bian ZM, Till GO, Petty HR, Elner VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17765224", "url": "https://glygen.org/publication/PubMed/17765224" } ] }, { "title": "The histone H3 lysine-27 demethylase Jmjd3 links inflammation to inhibition of polycomb-mediated gene silencing.", "journal": "Cell", "date": "2007", "authors": "De Santa F, Totaro MG, Prosperini E, Notarbartolo S, Testa G, Natoli G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17825402", "url": "https://glygen.org/publication/PubMed/17825402" } ] }, { "title": "Targeted deletion of the mitogen-activated protein kinase kinase 4 gene in the nervous system causes severe brain developmental defects and premature death.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Wang X, Nadarajah B, Robinson AC, McColl BW, Jin JW, Dajas-Bailador F, Boot-Handford RP, Tournier C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17875933", "url": "https://glygen.org/publication/PubMed/17875933" } ] }, { "title": "Sustained Arc/Arg3.1 synthesis controls long-term potentiation consolidation through regulation of local actin polymerization in the dentate gyrus in vivo.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2007", "authors": "Messaoudi E, Kanhema T, Soule J, Tiron A, Dagyte G, da Silva B, Bramham CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "17898216", "url": "https://glygen.org/publication/PubMed/17898216" } ] }, { "title": "Rad GTPase deficiency leads to cardiac hypertrophy.", "journal": "Circulation", "date": "2007", "authors": "Chang L, Zhang J, Tseng YH, Xie CQ, Ilany J, Bruning JC, Sun Z, Zhu X, Cui T, Youker KA, Yang Q, Day SM, Kahn CR, Chen YE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "18056528", "url": "https://glygen.org/publication/PubMed/18056528" } ] }, { "title": "Serum- and glucocorticoid-inducible kinase 1 enhances zif268 expression through the mediation of SRF and CREB1 associated with spatial memory formation.", "journal": "Journal of neurochemistry", "date": "2008", "authors": "Tyan SW, Tsai MC, Lin CL, Ma YL, Lee EH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "18088355", "url": "https://glygen.org/publication/PubMed/18088355" } ] }, { "title": "Lyl1 interacts with CREB1 and alters expression of CREB1 target genes.", "journal": "Biochimica et biophysica acta", "date": "2008", "authors": "San-Marina S, Han Y, Suarez Saiz F, Trus MR, Minden MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "18160048", "url": "https://glygen.org/publication/PubMed/18160048" } ] }, { "title": "DNA oxidation as triggered by H3K9me2 demethylation drives estrogen-induced gene expression.", "journal": "Science (New York, N.Y.)", "date": "2008", "authors": "Perillo B, Ombra MN, Bertoni A, Cuozzo C, Sacchetti S, Sasso A, Chiariotti L, Malorni A, Abbondanza C, Avvedimento EV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18187655", "url": "https://glygen.org/publication/PubMed/18187655" } ] }, { "title": "Cohesins localize with CTCF at the KSHV latency control region and at cellular c-myc and H19/Igf2 insulators.", "journal": "The EMBO journal", "date": "2008", "authors": "Stedman W, Kang H, Lin S, Kissil JL, Bartolomei MS, Lieberman PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18219272", "url": "https://glygen.org/publication/PubMed/18219272" } ] }, { "title": "Molecular and structural basis of cytokine receptor pleiotropy in the interleukin-4/13 system.", "journal": "Cell", "date": "2008", "authors": "LaPorte SL, Juo ZS, Vaclavikova J, Colf LA, Qi X, Heller NM, Keegan AD, Garcia KC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18243101", "url": "https://glygen.org/publication/PubMed/18243101" } ] }, { "title": "Genome-wide mapping and characterization of hypomethylated sites in human tissues and breast cancer cell lines.", "journal": "Genome research", "date": "2008", "authors": "Shann YJ, Cheng C, Chiao CH, Chen DT, Li PH, Hsu MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18256232", "url": "https://glygen.org/publication/PubMed/18256232" } ] }, { "title": "Oncogenic BRAF induces senescence and apoptosis through pathways mediated by the secreted protein IGFBP7.", "journal": "Cell", "date": "2008", "authors": "Wajapeyee N, Serra RW, Zhu X, Mahalingam M, Green MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "18267069", "url": "https://glygen.org/publication/PubMed/18267069" } ] }, { "title": "Transient cyclical methylation of promoter DNA.", "journal": "Nature", "date": "2008", "authors": "Kangaspeska S, Stride B, Metivier R, Polycarpou-Schwarz M, Ibberson D, Carmouche RP, Benes V, Gannon F, Reid G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18322535", "url": "https://glygen.org/publication/PubMed/18322535" } ] }, { "title": "Transactivation of Krox-20 and Krox-24 promoters by the HTLV-1 Tax protein through common regulatory elements.", "journal": "Oncogene", "date": "1991", "authors": "Alexandre C, Charnay P, Verrier B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "1833716", "url": "https://glygen.org/publication/PubMed/1833716" } ] }, { "title": "Twist is transcriptionally induced by activation of STAT3 and mediates STAT3 oncogenic function.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Cheng GZ, Zhang WZ, Sun M, Wang Q, Coppola D, Mansour M, Xu LM, Costanzo C, Cheng JQ, Wang LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18353781", "url": "https://glygen.org/publication/PubMed/18353781" } ] }, { "title": "FoxA1 translates epigenetic signatures into enhancer-driven lineage-specific transcription.", "journal": "Cell", "date": "2008", "authors": "Lupien M, Eeckhoute J, Meyer CA, Wang Q, Zhang Y, Li W, Carroll JS, Liu XS, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18358809", "url": "https://glygen.org/publication/PubMed/18358809" } ] }, { "title": "p16(INK4a) translation suppressed by miR-24.", "journal": "PloS one", "date": "2008", "authors": "Lal A, Kim HH, Abdelmohsen K, Kuwano Y, Pullmann R Jr, Srikantan S, Subrahmanyam R, Martindale JL, Yang X, Ahmed F, Navarro F, Dykxhoorn D, Lieberman J, Gorospe M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "18365017", "url": "https://glygen.org/publication/PubMed/18365017" } ] }, { "title": "A brief introduction to FOXOlogy.", "journal": "Oncogene", "date": "2008", "authors": "Burgering BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "18391968", "url": "https://glygen.org/publication/PubMed/18391968" } ] }, { "title": "Interleukin 1alpha-induced NFkappaB activation and chemokine mRNA stabilization diverge at IRAK1.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Hartupee J, Li X, Hamilton T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "18411265", "url": "https://glygen.org/publication/PubMed/18411265" } ] }, { "title": "Regulation of Sox2 by STAT3 initiates commitment to the neural precursor cell fate.", "journal": "Stem cells and development", "date": "2008", "authors": "Foshay KM, Gallicano GI", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18447642", "url": "https://glygen.org/publication/PubMed/18447642" } ] }, { "title": "Motif-specific sampling of phosphoproteomes.", "journal": "Journal of proteome research", "date": "2008", "authors": "Ruse CI, McClatchy DB, Lu B, Cociorva D, Motoyama A, Park SK, Yates JR 3rd", "evidence": [ { "database": "iPTMnet", "id": "P01100-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100-1" } ], "reference": [ { "type": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ] }, { "title": "Active gene repression by the Egr2.NAB complex during peripheral nerve myelination.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Mager GM, Ward RM, Srinivasan R, Jang SW, Wrabetz L, Svaren J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "18456662", "url": "https://glygen.org/publication/PubMed/18456662" } ] }, { "title": "Epidermal growth factor induces G protein-coupled receptor 30 expression in estrogen receptor-negative breast cancer cells.", "journal": "Endocrinology", "date": "2008", "authors": "Albanito L, Sisci D, Aquila S, Brunelli E, Vivacqua A, Madeo A, Lappano R, Pandey DP, Picard D, Mauro L, Ando S, Maggiolini M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "18467441", "url": "https://glygen.org/publication/PubMed/18467441" } ] }, { "title": "Estrogen and MYB in breast cancer: potential for new therapies.", "journal": "Expert opinion on biological therapy", "date": "2008", "authors": "Gonda TJ, Leo P, Ramsay RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18476782", "url": "https://glygen.org/publication/PubMed/18476782" } ] }, { "title": "Disruption of Krox20-Nab interaction in the mouse leads to peripheral neuropathy with biphasic evolution.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2008", "authors": "Desmazieres A, Decker L, Vallat JM, Charnay P, Gilardi-Hebenstreit P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "18524893", "url": "https://glygen.org/publication/PubMed/18524893" } ] }, { "title": "Meta-analysis of human cancer microarrays reveals GATA3 is integral to the estrogen receptor alpha pathway.", "journal": "Molecular cancer", "date": "2008", "authors": "Wilson BJ, Giguere V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18533032", "url": "https://glygen.org/publication/PubMed/18533032" } ] }, { "title": "Chemokine signaling via the CXCR2 receptor reinforces senescence.", "journal": "Cell", "date": "2008", "authors": "Acosta JC, O'Loghlen A, Banito A, Guijarro MV, Augert A, Raguz S, Fumagalli M, Da Costa M, Brown C, Popov N, Takatsu Y, Melamed J, d'Adda di Fagagna F, Bernard D, Hernando E, Gil J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "18555777", "url": "https://glygen.org/publication/PubMed/18555777" } ] }, { "title": "Oncogene-induced senescence relayed by an interleukin-dependent inflammatory network.", "journal": "Cell", "date": "2008", "authors": "Kuilman T, Michaloglou C, Vredeveld LC, Douma S, van Doorn R, Desmet CJ, Aarden LA, Mooi WJ, Peeper DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "18555778", "url": "https://glygen.org/publication/PubMed/18555778" } ] }, { "title": "Nucleotide sequence and regulatory studies of VGF, a nervous system-specific mRNA that is rapidly and relatively selectively induced by nerve growth factor.", "journal": "Journal of neurochemistry", "date": "1991", "authors": "Salton SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "1861162", "url": "https://glygen.org/publication/PubMed/1861162" } ] }, { "title": "Signal transducer and activator of transcription 3 is required for hypoxia-inducible factor-1alpha RNA expression in both tumor cells and tumor-associated myeloid cells.", "journal": "Molecular cancer research : MCR", "date": "2008", "authors": "Niu G, Briggs J, Deng J, Ma Y, Lee H, Kortylewski M, Kujawski M, Kay H, Cress WD, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18644974", "url": "https://glygen.org/publication/PubMed/18644974" } ] }, { "title": "Cathepsin D: a cellular roadmap.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Zaidi N, Maurer A, Nieke S, Kalbacher H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18762174", "url": "https://glygen.org/publication/PubMed/18762174" } ] }, { "title": "Estrogen-induced Bcl-2 expression after spinal cord injury is mediated through phosphoinositide-3-kinase/Akt-dependent CREB activation.", "journal": "Journal of neurotrauma", "date": "2008", "authors": "Yune TY, Park HG, Lee JY, Oh TH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "18785877", "url": "https://glygen.org/publication/PubMed/18785877" } ] }, { "title": "c-Jun expression, activation and function in neural cell death, inflammation and repair.", "journal": "Journal of neurochemistry", "date": "2008", "authors": "Raivich G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "18793328", "url": "https://glygen.org/publication/PubMed/18793328" } ] }, { "title": "Marking time: the dynamic role of chromatin and covalent modification in transcription.", "journal": "The international journal of biochemistry & cell biology", "date": "2009", "authors": "Reid G, Gallais R, Metivier R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18805503", "url": "https://glygen.org/publication/PubMed/18805503" } ] }, { "title": "Arsenic trioxide phosphorylates c-Fos to transactivate p21(WAF1/CIP1) expression.", "journal": "Toxicology and applied pharmacology", "date": "2008", "authors": "Liu ZM, Huang HS", "evidence": [ { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" } ], "reference": [ { "type": "PubMed", "id": "18822310", "url": "https://glygen.org/publication/PubMed/18822310" } ] }, { "title": "CXXC5 is a novel BMP4-regulated modulator of Wnt signaling in neural stem cells.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Andersson T, Sodersten E, Duckworth JK, Cascante A, Fritz N, Sacchetti P, Cervenka I, Bryja V, Hermanson O", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19001364", "url": "https://glygen.org/publication/PubMed/19001364" } ] }, { "title": "Transcriptional regulation of the cyclin D1 gene at a glance.", "journal": "Journal of cell science", "date": "2008", "authors": "Klein EA, Assoian RK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19020303", "url": "https://glygen.org/publication/PubMed/19020303" } ] }, { "title": "CDYL bridges REST and histone methyltransferases for gene repression and suppression of cellular transformation.", "journal": "Molecular cell", "date": "2008", "authors": "Mulligan P, Westbrook TF, Ottinger M, Pavlova N, Chang B, Macia E, Shi YJ, Barretina J, Liu J, Howley PM, Elledge SJ, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "19061646", "url": "https://glygen.org/publication/PubMed/19061646" } ] }, { "title": "The lysine demethylase LSD1 (KDM1) is required for maintenance of global DNA methylation.", "journal": "Nature genetics", "date": "2009", "authors": "Wang J, Hevi S, Kurash JK, Lei H, Gay F, Bajko J, Su H, Sun W, Chang H, Xu G, Gaudet F, Li E, Chen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19098913", "url": "https://glygen.org/publication/PubMed/19098913" } ] }, { "title": "Synaptic activity-responsive element in the Arc/Arg3.1 promoter essential for synapse-to-nucleus signaling in activated neurons.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Kawashima T, Okuno H, Nonaka M, Adachi-Morishima A, Kyo N, Okamura M, Takemoto-Kimura S, Worley PF, Bito H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "19116276", "url": "https://glygen.org/publication/PubMed/19116276" } ] }, { "title": "Mechanism of interferon-gamma mediated down-regulation of interleukin-10 gene expression.", "journal": "Molecular immunology", "date": "2009", "authors": "Schaefer A, Unterberger C, Frankenberger M, Lohrum M, Staples KJ, Werner T, Stunnenberg H, Ziegler-Heitbrock L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "19124156", "url": "https://glygen.org/publication/PubMed/19124156" } ] }, { "title": "p21-activated kinase regulates mast cell degranulation via effects on calcium mobilization and cytoskeletal dynamics.", "journal": "Blood", "date": "2009", "authors": "Allen JD, Jaffer ZM, Park SJ, Burgin S, Hofmann C, Sells MA, Chen S, Derr-Yellin E, Michels EG, McDaniel A, Bessler WK, Ingram DA, Atkinson SJ, Travers JB, Chernoff J, Clapp DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "19124833", "url": "https://glygen.org/publication/PubMed/19124833" } ] }, { "title": "Regulation of the IL-23 and IL-12 balance by Stat3 signaling in the tumor microenvironment.", "journal": "Cancer cell", "date": "2009", "authors": "Kortylewski M, Xin H, Kujawski M, Lee H, Liu Y, Harris T, Drake C, Pardoll D, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "19185846", "url": "https://glygen.org/publication/PubMed/19185846" } ] }, { "title": "The serum response factor and a putative novel transcription factor regulate expression of the immediate-early gene Arc/Arg3.1 in neurons.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2009", "authors": "Pintchovski SA, Peebles CL, Kim HJ, Verdin E, Finkbeiner S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "19193899", "url": "https://glygen.org/publication/PubMed/19193899" } ] }, { "title": "Neuroendocrine regulatory peptide-1 and -2: novel bioactive peptides processed from VGF.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2009", "authors": "Toshinai K, Nakazato M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "19194657", "url": "https://glygen.org/publication/PubMed/19194657" } ] }, { "title": "Breast cancer, estrogen receptor and ligands.", "journal": "Archiv der Pharmazie", "date": "2009", "authors": "Bai Z, Gust R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19274700", "url": "https://glygen.org/publication/PubMed/19274700" } ] }, { "title": "Histone modifications at human enhancers reflect global cell-type-specific gene expression.", "journal": "Nature", "date": "2009", "authors": "Heintzman ND, Hon GC, Hawkins RD, Kheradpour P, Stark A, Harp LF, Ye Z, Lee LK, Stuart RK, Ching CW, Ching KA, Antosiewicz-Bourget JE, Liu H, Zhang X, Green RD, Lobanenkov VV, Stewart R, Thomson JA, Crawford GE, Kellis M, Ren B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19295514", "url": "https://glygen.org/publication/PubMed/19295514" } ] }, { "title": "Genomic responses from the estrogen-responsive element-dependent signaling pathway mediated by estrogen receptor alpha are required to elicit cellular alterations.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Nott SL, Huang Y, Li X, Fluharty BR, Qiu X, Welshons WV, Yeh S, Muyan M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19321454", "url": "https://glygen.org/publication/PubMed/19321454" } ] }, { "title": "E2-mediated cathepsin D (CTSD) activation involves looping of distal enhancer elements.", "journal": "Molecular oncology", "date": "2008", "authors": "Bretschneider N, Kangaspeska S, Seifert M, Reid G, Gannon F, Denger S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19383337", "url": "https://glygen.org/publication/PubMed/19383337" } ] }, { "title": "The RhoU/Wrch1 Rho GTPase gene is a common transcriptional target of both the gp130/STAT3 and Wnt-1 pathways.", "journal": "The Biochemical journal", "date": "2009", "authors": "Schiavone D, Dewilde S, Vallania F, Turkson J, Di Cunto F, Poli V", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "19397496", "url": "https://glygen.org/publication/PubMed/19397496" } ] }, { "title": "The H3K27me3 demethylase JMJD3 contributes to the activation of the INK4A-ARF locus in response to oncogene- and stress-induced senescence.", "journal": "Genes & development", "date": "2009", "authors": "Agger K, Cloos PA, Rudkjaer L, Williams K, Andersen G, Christensen J, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "19451217", "url": "https://glygen.org/publication/PubMed/19451217" } ] }, { "title": "Histone demethylase JMJD3 contributes to epigenetic control of INK4a/ARF by oncogenic RAS.", "journal": "Genes & development", "date": "2009", "authors": "Barradas M, Anderton E, Acosta JC, Li S, Banito A, Rodriguez-Niedenfuhr M, Maertens G, Banck M, Zhou MM, Walsh MJ, Peters G, Gil J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "19451218", "url": "https://glygen.org/publication/PubMed/19451218" } ] }, { "title": "Polycomb mediated epigenetic silencing and replication timing at the INK4a/ARF locus during senescence.", "journal": "PloS one", "date": "2009", "authors": "Agherbi H, Gaussmann-Wenger A, Verthuy C, Chasson L, Serrano M, Djabali M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "19462008", "url": "https://glygen.org/publication/PubMed/19462008" } ] }, { "title": "Mitochondrial dysfunction contributes to oncogene-induced senescence.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Moiseeva O, Bourdeau V, Roux A, Deschenes-Simard X, Ferbeyre G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "19528227", "url": "https://glygen.org/publication/PubMed/19528227" } ] }, { "title": "Stimulating the GPR30 estrogen receptor with a novel tamoxifen analogue activates SF-1 and promotes endometrial cell proliferation.", "journal": "Cancer research", "date": "2009", "authors": "Lin BC, Suzawa M, Blind RD, Tobias SC, Bulun SE, Scanlan TS, Ingraham HA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "19549922", "url": "https://glygen.org/publication/PubMed/19549922" } ] }, { "title": "Dissecting activation of the PAK1 kinase at protrusions in living cells.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Parrini MC, Camonis J, Matsuda M, de Gunzburg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "19574218", "url": "https://glygen.org/publication/PubMed/19574218" } ] }, { "title": "SLP-76 couples Syk to the osteoclast cytoskeleton.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2009", "authors": "Reeve JL, Zou W, Liu Y, Maltzman JS, Ross FP, Teitelbaum SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "19592646", "url": "https://glygen.org/publication/PubMed/19592646" } ] }, { "title": "The DEAD-box protein p72 regulates ERalpha-/oestrogen-dependent transcription and cell growth, and is associated with improved survival in ERalpha-positive breast cancer.", "journal": "Oncogene", "date": "2009", "authors": "Wortham NC, Ahamed E, Nicol SM, Thomas RS, Periyasamy M, Jiang J, Ochocka AM, Shousha S, Huson L, Bray SE, Coombes RC, Ali S, Fuller-Pace FV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19718048", "url": "https://glygen.org/publication/PubMed/19718048" } ] }, { "title": "Cell surface-bound IL-1alpha is an upstream regulator of the senescence-associated IL-6/IL-8 cytokine network.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Orjalo AV, Bhaumik D, Gengler BK, Scott GK, Campisi J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "19805069", "url": "https://glygen.org/publication/PubMed/19805069" } ] }, { "title": "Cell proliferation regulated by estradiol receptor: Therapeutic implications.", "journal": "Steroids", "date": "2010", "authors": "Castoria G, Migliaccio A, Giovannelli P, Auricchio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "19879889", "url": "https://glygen.org/publication/PubMed/19879889" } ] }, { "title": "Adapters in the organization of mast cell signaling.", "journal": "Immunological reviews", "date": "2009", "authors": "Alvarez-Errico D, Lessmann E, Rivera J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "19909365", "url": "https://glygen.org/publication/PubMed/19909365" } ] }, { "title": "Rad as a novel regulator of excitation-contraction coupling and beta-adrenergic signaling in heart.", "journal": "Circulation research", "date": "2010", "authors": "Wang G, Zhu X, Xie W, Han P, Li K, Sun Z, Wang Y, Chen C, Song R, Cao C, Zhang J, Wu C, Liu J, Cheng H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "19926875", "url": "https://glygen.org/publication/PubMed/19926875" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P01100-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "The G protein-coupled receptor GPR30 inhibits proliferation of estrogen receptor-positive breast cancer cells.", "journal": "Cancer research", "date": "2010", "authors": "Ariazi EA, Brailoiu E, Yerrum S, Shupp HA, Slifker MJ, Cunliffe HE, Black MA, Donato AL, Arterburn JB, Oprea TI, Prossnitz ER, Dun NJ, Jordan VC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "20086172", "url": "https://glygen.org/publication/PubMed/20086172" } ] }, { "title": "Structure of the gene encoding VGF, a nervous system-specific mRNA that is rapidly and selectively induced by nerve growth factor in PC12 cells.", "journal": "Molecular and cellular biology", "date": "1991", "authors": "Salton SR, Fischberg DJ, Dong KW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "2017159", "url": "https://glygen.org/publication/PubMed/2017159" } ] }, { "title": "A CTCF-independent role for cohesin in tissue-specific transcription.", "journal": "Genome research", "date": "2010", "authors": "Schmidt D, Schwalie PC, Ross-Innes CS, Hurtado A, Brown GD, Carroll JS, Flicek P, Odom DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20219941", "url": "https://glygen.org/publication/PubMed/20219941" } ] }, { "title": "A novel Wilms tumor 1 (WT1) target gene negatively regulates the WNT signaling pathway.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Kim MS, Yoon SK, Bollig F, Kitagaki J, Hur W, Whye NJ, Wu YP, Rivera MN, Park JY, Kim HS, Malik K, Bell DW, Englert C, Perantoni AO, Lee SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20220130", "url": "https://glygen.org/publication/PubMed/20220130" } ] }, { "title": "RSK-mediated phosphorylation in the C/EBP{beta} leucine zipper regulates DNA binding, dimerization, and growth arrest activity.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Lee S, Shuman JD, Guszczynski T, Sakchaisri K, Sebastian T, Copeland TD, Miller M, Cohen MS, Taunton J, Smart RC, Xiao Z, Yu LR, Veenstra TD, Johnson PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "20351173", "url": "https://glygen.org/publication/PubMed/20351173" } ] }, { "title": "v-Src activates mitogen-responsive transcription factor Egr-1 via serum response elements.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Qureshi SA, Cao XM, Sukhatme VP, Foster DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "2040600", "url": "https://glygen.org/publication/PubMed/2040600" } ] }, { "title": "CCAAT/Enhancer-binding protein beta DNA binding is auto-inhibited by multiple elements that also mediate association with p300/CREB-binding protein (CBP).", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Lee S, Miller M, Shuman JD, Johnson PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "20452968", "url": "https://glygen.org/publication/PubMed/20452968" } ] }, { "title": "Diverse targets of the transcription factor STAT3 contribute to T cell pathogenicity and homeostasis.", "journal": "Immunity", "date": "2010", "authors": "Durant L, Watford WT, Ramos HL, Laurence A, Vahedi G, Wei L, Takahashi H, Sun HW, Kanno Y, Powrie F, O'Shea JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "20493732", "url": "https://glygen.org/publication/PubMed/20493732" } ] }, { "title": "Novel trans-tail regulation of H2B ubiquitylation and H3K4 methylation by the N terminus of histone H2A.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Zheng S, Wyrick JJ, Reese JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20498280", "url": "https://glygen.org/publication/PubMed/20498280" } ] }, { "title": "EGR1, EGR2, and EGR3 activate the expression of their coregulator NAB2 establishing a negative feedback loop in cells of neuroectodermal and epithelial origin.", "journal": "Journal of cellular biochemistry", "date": "2010", "authors": "Kumbrink J, Kirsch KH, Johnson JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "20506119", "url": "https://glygen.org/publication/PubMed/20506119" } ] }, { "title": "5' upstream sequence and genomic structure of the human primary response gene, EGR-1/TIS8.", "journal": "Oncogene", "date": "1991", "authors": "Sakamoto KM, Bardeleben C, Yates KE, Raines MA, Golde DW, Gasson JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "2052361", "url": "https://glygen.org/publication/PubMed/2052361" } ] }, { "title": "Role of EBAG9 protein in coat protein complex I-dependent glycoprotein maturation and secretion processes in tumor cells.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2010", "authors": "Wolf J, Reimer TA, Schuck S, Ruder C, Gerlach K, Muller EC, Otto A, Dorken B, Rehm A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20570965", "url": "https://glygen.org/publication/PubMed/20570965" } ] }, { "title": "The histone demethylase JMJD2B is regulated by estrogen receptor alpha and hypoxia, and is a key mediator of estrogen induced growth.", "journal": "Cancer research", "date": "2010", "authors": "Yang J, Jubb AM, Pike L, Buffa FM, Turley H, Baban D, Leek R, Gatter KC, Ragoussis J, Harris AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20682797", "url": "https://glygen.org/publication/PubMed/20682797" } ] }, { "title": "The early response gene NGFI-C encodes a zinc finger transcriptional activator and is a member of the GCGGGGGCG (GSG) element-binding protein family.", "journal": "Molecular and cellular biology", "date": "1991", "authors": "Crosby SD, Puetz JJ, Simburger KS, Fahrner TJ, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "2072895", "url": "https://glygen.org/publication/PubMed/2072895" } ] }, { "title": "Variants in RET associated with Hirschsprung's disease affect binding of transcription factors and gene expression.", "journal": "Gastroenterology", "date": "2011", "authors": "Sribudiani Y, Metzger M, Osinga J, Rey A, Burns AJ, Thapar N, Hofstra RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9768919", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9768919" } ], "reference": [ { "type": "PubMed", "id": "20977903", "url": "https://glygen.org/publication/PubMed/20977903" } ] }, { "title": "Synaptic activity-responsive element (SARE): A unique genomic structure with an unusual sensitivity to neuronal activity.", "journal": "Communicative & integrative biology", "date": "2010", "authors": "Inoue M, Yagishita-Kyo N, Nonaka M, Kawashima T, Okuno H, Bito H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "21057636", "url": "https://glygen.org/publication/PubMed/21057636" } ] }, { "title": "Identification and characterization of the Egr-1 gene product, a DNA-binding zinc finger protein induced by differentiation and growth signals.", "journal": "Molecular and cellular biology", "date": "1990", "authors": "Cao XM, Koski RA, Gashler A, McKiernan M, Morris CF, Gaffney R, Hay RV, Sukhatme VP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "2109185", "url": "https://glygen.org/publication/PubMed/2109185" } ] }, { "title": "STAT3-induced S1PR1 expression is crucial for persistent STAT3 activation in tumors.", "journal": "Nature medicine", "date": "2010", "authors": "Lee H, Deng J, Kujawski M, Yang C, Liu Y, Herrmann A, Kortylewski M, Horne D, Somlo G, Forman S, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21102457", "url": "https://glygen.org/publication/PubMed/21102457" } ] }, { "title": "Histone H3K27ac separates active from poised enhancers and predicts developmental state.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Creyghton MP, Cheng AW, Welstead GG, Kooistra T, Carey BW, Steine EJ, Hanna J, Lodato MA, Frampton GM, Sharp PA, Boyer LA, Young RA, Jaenisch R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21106759", "url": "https://glygen.org/publication/PubMed/21106759" } ] }, { "title": "FOXA1 is a key determinant of estrogen receptor function and endocrine response.", "journal": "Nature genetics", "date": "2011", "authors": "Hurtado A, Holmes KA, Ross-Innes CS, Schmidt D, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21151129", "url": "https://glygen.org/publication/PubMed/21151129" } ] }, { "title": "Cadmium induces phosphorylation and stabilization of c-Fos in HK-2 renal proximal tubular cells.", "journal": "Toxicology and applied pharmacology", "date": "2011", "authors": "Iwatsuki M, Inageda K, Matsuoka M", "evidence": [ { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" } ], "reference": [ { "type": "PubMed", "id": "21219922", "url": "https://glygen.org/publication/PubMed/21219922" } ] }, { "title": "alphaMbeta(2) integrin activation prevents alternative activation of human and murine macrophages and impedes foam cell formation.", "journal": "Circulation research", "date": "2011", "authors": "Yakubenko VP, Bhattacharjee A, Pluskota E, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21252155", "url": "https://glygen.org/publication/PubMed/21252155" } ] }, { "title": "Activation and function of immediate-early genes in the nervous system.", "journal": "Biochemistry and cell biology = Biochimie et biologie cellulaire", "date": "2011", "authors": "Perez-Cadahia B, Drobic B, Davie JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "21326363", "url": "https://glygen.org/publication/PubMed/21326363" } ] }, { "title": "Identification of cis-elements and transcription factors regulating neuronal activity-dependent transcription of human BDNF gene.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2011", "authors": "Pruunsild P, Sepp M, Orav E, Koppel I, Timmusk T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9768919", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9768919" } ], "reference": [ { "type": "PubMed", "id": "21368041", "url": "https://glygen.org/publication/PubMed/21368041" } ] }, { "title": "Histone demethylase JMJD2B functions as a co-factor of estrogen receptor in breast cancer proliferation and mammary gland development.", "journal": "PloS one", "date": "2011", "authors": "Kawazu M, Saso K, Tong KI, McQuire T, Goto K, Son DO, Wakeham A, Miyagishi M, Mak TW, Okada H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21445275", "url": "https://glygen.org/publication/PubMed/21445275" } ] }, { "title": "ID1 and ID3 represent conserved negative regulators of human embryonic and induced pluripotent stem cell hematopoiesis.", "journal": "Journal of cell science", "date": "2011", "authors": "Hong SH, Lee JH, Lee JB, Ji J, Bhatia M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "21486943", "url": "https://glygen.org/publication/PubMed/21486943" } ] }, { "title": "A role for the immediate early gene product c-fos in imprinting T cells with short-term memory for signal summation.", "journal": "PloS one", "date": "2011", "authors": "Clark CE, Hasan M, Bousso P", "evidence": [ { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" } ], "reference": [ { "type": "PubMed", "id": "21552553", "url": "https://glygen.org/publication/PubMed/21552553" } ] }, { "title": "Intracellular estrogen receptor-binding fragment-associated antigen 9 exerts in vivo tumor-promoting effects via its coiled-coil region.", "journal": "International journal of oncology", "date": "2011", "authors": "Maeyama Y, Otsu M, Kubo S, Yamano T, Iimura Y, Onodera M, Kondo S, Sakiyama Y, Ariga T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21573489", "url": "https://glygen.org/publication/PubMed/21573489" } ] }, { "title": "VGF: an inducible gene product, precursor of a diverse array of neuro-endocrine peptides and tissue-specific disease biomarkers.", "journal": "Journal of chemical neuroanatomy", "date": "2011", "authors": "Ferri GL, Noli B, Brancia C, D'Amato F, Cocco C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "21621608", "url": "https://glygen.org/publication/PubMed/21621608" } ] }, { "title": "TRIM8 regulates Nanog via Hsp90beta-mediated nuclear translocation of STAT3 in embryonic stem cells.", "journal": "Biochimica et biophysica acta", "date": "2011", "authors": "Okumura F, Okumura AJ, Matsumoto M, Nakayama KI, Hatakeyama S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21689689", "url": "https://glygen.org/publication/PubMed/21689689" } ] }, { "title": "STAT3 protein promotes T-cell survival and inhibits interleukin-2 production through up-regulation of Class O Forkhead transcription factors.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Oh HM, Yu CR, Golestaneh N, Amadi-Obi A, Lee YS, Eseonu A, Mahdi RM, Egwuagu CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21730069", "url": "https://glygen.org/publication/PubMed/21730069" } ] }, { "title": "Strong association between c-myb and oestrogen-receptor expression in human breast cancer.", "journal": "Oncogene", "date": "1990", "authors": "Guerin M, Sheng ZM, Andrieu N, Riou G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "2181374", "url": "https://glygen.org/publication/PubMed/2181374" } ] }, { "title": "Activation of interleukin-6 gene expression through the NF-kappa B transcription factor.", "journal": "Molecular and cellular biology", "date": "1990", "authors": "Libermann TA, Baltimore D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "2183031", "url": "https://glygen.org/publication/PubMed/2183031" } ] }, { "title": "Estrogen induces c-myc gene expression via an upstream enhancer activated by the estrogen receptor and the AP-1 transcription factor.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2011", "authors": "Wang C, Mayer JA, Mazumdar A, Fertuck K, Kim H, Brown M, Brown PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21835891", "url": "https://glygen.org/publication/PubMed/21835891" } ] }, { "title": "Cellular reprogramming by the conjoint action of ERalpha, FOXA1, and GATA3 to a ligand-inducible growth state.", "journal": "Molecular systems biology", "date": "2011", "authors": "Kong SL, Li G, Loh SL, Sung WK, Liu ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21878914", "url": "https://glygen.org/publication/PubMed/21878914" } ] }, { "title": "FOXA1: master of steroid receptor function in cancer.", "journal": "The EMBO journal", "date": "2011", "authors": "Augello MA, Hickey TE, Knudsen KE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21934649", "url": "https://glygen.org/publication/PubMed/21934649" } ] }, { "title": "Signal transducers and activators of transcription 3 (STAT3) directly regulates cytokine-induced fascin expression and is required for breast cancer cell migration.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Snyder M, Huang XY, Zhang JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21937440", "url": "https://glygen.org/publication/PubMed/21937440" } ] }, { "title": "Gene regulation by cohesin in cancer: is the ring an unexpected party to proliferation?", "journal": "Molecular cancer research : MCR", "date": "2011", "authors": "Rhodes JM, McEwan M, Horsfield JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21940756", "url": "https://glygen.org/publication/PubMed/21940756" } ] }, { "title": "Control of the senescence-associated secretory phenotype by NF-kappaB promotes senescence and enhances chemosensitivity.", "journal": "Genes & development", "date": "2011", "authors": "Chien Y, Scuoppo C, Wang X, Fang X, Balgley B, Bolden JE, Premsrirut P, Luo W, Chicas A, Lee CS, Kogan SC, Lowe SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "21979375", "url": "https://glygen.org/publication/PubMed/21979375" } ] }, { "title": "Regulation of MDM2 E3 ligase activity by phosphorylation after DNA damage.", "journal": "Molecular and cellular biology", "date": "2011", "authors": "Cheng Q, Cross B, Li B, Chen L, Li Z, Chen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "21986495", "url": "https://glygen.org/publication/PubMed/21986495" } ] }, { "title": "Cytokine induction of tumor necrosis factor receptor 2 is mediated by STAT3 in colon cancer cells.", "journal": "Molecular cancer research : MCR", "date": "2011", "authors": "Hamilton KE, Simmons JG, Ding S, Van Landeghem L, Lund PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21994466", "url": "https://glygen.org/publication/PubMed/21994466" } ] }, { "title": "The Cyclin K/Cdk12 complex maintains genomic stability via regulation of expression of DNA damage response genes.", "journal": "Genes & development", "date": "2011", "authors": "Blazek D, Kohoutek J, Bartholomeeusen K, Johansen E, Hulinkova P, Luo Z, Cimermancic P, Ule J, Peterlin BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "22012619", "url": "https://glygen.org/publication/PubMed/22012619" } ] }, { "title": "Loss of the candidate tumor suppressor BTG3 triggers acute cellular senescence via the ERK-JMJD3-p16(INK4a) signaling axis.", "journal": "Oncogene", "date": "2012", "authors": "Lin TY, Cheng YC, Yang HC, Lin WC, Wang CC, Lai PL, Shieh SY", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "22020331", "url": "https://glygen.org/publication/PubMed/22020331" } ] }, { "title": "Necdin, a negative growth regulator, is a novel STAT3 target gene down-regulated in human cancer.", "journal": "PloS one", "date": "2011", "authors": "Haviland R, Eschrich S, Bloom G, Ma Y, Minton S, Jove R, Cress WD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22046235", "url": "https://glygen.org/publication/PubMed/22046235" } ] }, { "title": "Early growth response 1--a transcription factor in the crossfire of signal transduction cascades.", "journal": "Indian journal of biochemistry & biophysics", "date": "2011", "authors": "Pagel JI, Deindl E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "22053691", "url": "https://glygen.org/publication/PubMed/22053691" } ] }, { "title": "Pioneer transcription factors: establishing competence for gene expression.", "journal": "Genes & development", "date": "2011", "authors": "Zaret KS, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22056668", "url": "https://glygen.org/publication/PubMed/22056668" } ] }, { "title": "Global expression analysis identified a preferentially nerve growth factor-induced transcriptional program regulated by sustained mitogen-activated protein kinase/extracellular signal-regulated kinase (ERK) and AP-1 protein activation during PC12 cell differentiation.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Mullenbrock S, Shah J, Cooper GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "22065583", "url": "https://glygen.org/publication/PubMed/22065583" } ] }, { "title": "The kinase c-Src and the phosphatase TC45 coordinately regulate c-Fos tyrosine phosphorylation and c-Fos phospholipid synthesis activation capacity.", "journal": "Oncogene", "date": "2012", "authors": "Ferrero GO, Velazquez FN, Caputto BL", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" }, { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" } ], "reference": [ { "type": "PubMed", "id": "22105363", "url": "https://glygen.org/publication/PubMed/22105363" } ] }, { "title": "DNA damage signaling triggers degradation of histone methyltransferases through APC/C(Cdh1) in senescent cells.", "journal": "Molecular cell", "date": "2012", "authors": "Takahashi A, Imai Y, Yamakoshi K, Kuninaka S, Ohtani N, Yoshimoto S, Hori S, Tachibana M, Anderton E, Takeuchi T, Shinkai Y, Peters G, Saya H, Hara E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "22178396", "url": "https://glygen.org/publication/PubMed/22178396" } ] }, { "title": "Regulation and function of the RSK family of protein kinases.", "journal": "The Biochemical journal", "date": "2012", "authors": "Romeo Y, Zhang X, Roux PP", "evidence": [ { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" } ], "reference": [ { "type": "PubMed", "id": "22187936", "url": "https://glygen.org/publication/PubMed/22187936" } ] }, { "title": "Roles of STAT3 and ZEB1 proteins in E-cadherin down-regulation and human colorectal cancer epithelial-mesenchymal transition.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Xiong H, Hong J, Du W, Lin YW, Ren LL, Wang YC, Su WY, Wang JL, Cui Y, Wang ZH, Fang JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22205702", "url": "https://glygen.org/publication/PubMed/22205702" } ] }, { "title": "Extensive promoter-centered chromatin interactions provide a topological basis for transcription regulation.", "journal": "Cell", "date": "2012", "authors": "Li G, Ruan X, Auerbach RK, Sandhu KS, Zheng M, Wang P, Poh HM, Goh Y, Lim J, Zhang J, Sim HS, Peh SQ, Mulawadi FH, Ong CT, Orlov YL, Hong S, Zhang Z, Landt S, Raha D, Euskirchen G, Wei CL, Ge W, Wang H, Davis C, Fisher-Aylor KI, Mortazavi A, Gerstein M, Gingeras T, Wold B, Sun Y, Fullwood MJ, Cheung E, Liu E, Sung WK, Snyder M, Ruan Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22265404", "url": "https://glygen.org/publication/PubMed/22265404" } ] }, { "title": "Tyrosine phosphorylation of estradiol receptor by Src regulates its hormone-dependent nuclear export and cell cycle progression in breast cancer cells.", "journal": "Oncogene", "date": "2012", "authors": "Castoria G, Giovannelli P, Lombardi M, De Rosa C, Giraldi T, de Falco A, Barone MV, Abbondanza C, Migliaccio A, Auricchio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "22266855", "url": "https://glygen.org/publication/PubMed/22266855" } ] }, { "title": "The nucleosome remodeling and deacetylase chromatin remodeling (NuRD) complex is required for peripheral nerve myelination.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2012", "authors": "Hung H, Kohnken R, Svaren J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "22302795", "url": "https://glygen.org/publication/PubMed/22302795" } ] }, { "title": "PCGF homologs, CBX proteins, and RYBP define functionally distinct PRC1 family complexes.", "journal": "Molecular cell", "date": "2012", "authors": "Gao Z, Zhang J, Bonasio R, Strino F, Sawai A, Parisi F, Kluger Y, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "22325352", "url": "https://glygen.org/publication/PubMed/22325352" } ] }, { "title": "Regulation of p14ARF expression by miR-24: a potential mechanism compromising the p53 response during retinoblastoma development.", "journal": "BMC cancer", "date": "2012", "authors": "To KH, Pajovic S, Gallie BL, Theriault BL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "22336108", "url": "https://glygen.org/publication/PubMed/22336108" } ] }, { "title": "Localization of human tissue factor antigen by immunostaining with monospecific, polyclonal anti-human tissue factor antibody.", "journal": "Thrombosis research", "date": "1990", "authors": "Fleck RA, Rao LV, Rapaport SI, Varki N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "2237820", "url": "https://glygen.org/publication/PubMed/2237820" } ] }, { "title": "The Jak/STAT pathway.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2012", "authors": "Harrison DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22383755", "url": "https://glygen.org/publication/PubMed/22383755" } ] }, { "title": "Estrogen receptor-alpha recruits P-TEFb to overcome transcriptional pausing in intron 1 of the MYB gene.", "journal": "Nucleic acids research", "date": "2012", "authors": "Mitra P, Pereira LA, Drabsch Y, Ramsay RG, Gonda TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22492511", "url": "https://glygen.org/publication/PubMed/22492511" } ] }, { "title": "Non-overlapping progesterone receptor cistromes contribute to cell-specific transcriptional outcomes.", "journal": "PloS one", "date": "2012", "authors": "Clarke CL, Graham JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22545144", "url": "https://glygen.org/publication/PubMed/22545144" } ] }, { "title": "A polymorphism in the upstream regulatory region of the interleukin-1alpha gene confers differential binding by transcription factors of the AP-1 family.", "journal": "Life sciences", "date": "2012", "authors": "Moerman-Herzog AM, Barger SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "22634325", "url": "https://glygen.org/publication/PubMed/22634325" } ] }, { "title": "The mitochondrial pathway and reactive oxygen species are critical contributors to interferon-alpha/beta-mediated apoptosis in Ubp43-deficient hematopoietic cells.", "journal": "Biochemical and biophysical research communications", "date": "2012", "authors": "Yim HY, Yang Y, Lim JS, Lee MS, Zhang DE, Kim KI", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "22683641", "url": "https://glygen.org/publication/PubMed/22683641" } ] }, { "title": "STAT1 gene expression is enhanced by nuclear EGFR and HER2 via cooperation with STAT3.", "journal": "Molecular carcinogenesis", "date": "2013", "authors": "Han W, Carpenter RL, Cao X, Lo HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22693070", "url": "https://glygen.org/publication/PubMed/22693070" } ] }, { "title": "The elements of human cyclin D1 promoter and regulation involved.", "journal": "Clinical epigenetics", "date": "2011", "authors": "Guo ZY, Hao XH, Tan FF, Pei X, Shang LM, Jiang XL, Yang F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22704330", "url": "https://glygen.org/publication/PubMed/22704330" } ] }, { "title": "Interleukin-10-induced neutrophil gelatinase-associated lipocalin production in macrophages with consequences for tumor growth.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Jung M, Weigert A, Tausendschon M, Mora J, Oren B, Sola A, Hotter G, Muta T, Brune B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22851691", "url": "https://glygen.org/publication/PubMed/22851691" } ] }, { "title": "Interaction of cyclin-dependent kinase 12/CrkRS with cyclin K1 is required for the phosphorylation of the C-terminal domain of RNA polymerase II.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Cheng SW, Kuzyk MA, Moradian A, Ichu TA, Chang VC, Tien JF, Vollett SE, Griffith M, Marra MA, Morin GB", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "22988298", "url": "https://glygen.org/publication/PubMed/22988298" } ] }, { "title": "STAT1 activation by venous malformations mutant Tie2-R849W antagonizes VEGF-A-mediated angiogenic response partly via reduced bFGF production.", "journal": "Angiogenesis", "date": "2013", "authors": "Huang YH, Wu MP, Pan SC, Su WC, Chen YW, Wu LW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23086340", "url": "https://glygen.org/publication/PubMed/23086340" } ] }, { "title": "IL-4 and IL-13 employ discrete signaling pathways for target gene expression in alternatively activated monocytes/macrophages.", "journal": "Free radical biology & medicine", "date": "2013", "authors": "Bhattacharjee A, Shukla M, Yakubenko VP, Mulya A, Kundu S, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23124025", "url": "https://glygen.org/publication/PubMed/23124025" } ] }, { "title": "Cohesin is required for activation of MYC by estradiol.", "journal": "PloS one", "date": "2012", "authors": "McEwan MV, Eccles MR, Horsfield JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23145106", "url": "https://glygen.org/publication/PubMed/23145106" } ] }, { "title": "STAT3 is involved in esophageal carcinogenesis through regulation of Oct-1.", "journal": "Carcinogenesis", "date": "2013", "authors": "Wang Z, Zhu S, Shen M, Liu J, Wang M, Li C, Wang Y, Deng A, Mei Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23172665", "url": "https://glygen.org/publication/PubMed/23172665" } ] }, { "title": "GATA3 acts upstream of FOXA1 in mediating ESR1 binding by shaping enhancer accessibility.", "journal": "Genome research", "date": "2013", "authors": "Theodorou V, Stark R, Menon S, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23172872", "url": "https://glygen.org/publication/PubMed/23172872" } ] }, { "title": "Cooperating transcription factors mediate the function of estrogen receptor.", "journal": "Chromosoma", "date": "2013", "authors": "Fiorito E, Katika MR, Hurtado A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23192763", "url": "https://glygen.org/publication/PubMed/23192763" } ] }, { "title": "Oxygen-dependent expression of cytochrome c oxidase subunit 4-2 gene expression is mediated by transcription factors RBPJ, CXXC5 and CHCHD2.", "journal": "Nucleic acids research", "date": "2013", "authors": "Aras S, Pak O, Sommer N, Finley R Jr, Huttemann M, Weissmann N, Grossman LI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23303788", "url": "https://glygen.org/publication/PubMed/23303788" } ] }, { "title": "The abrogation of the HOXB7/PBX2 complex induces apoptosis in melanoma through the miR-221&222-c-FOS pathway.", "journal": "International journal of cancer", "date": "2013", "authors": "Errico MC, Felicetti F, Bottero L, Mattia G, Boe A, Felli N, Petrini M, Bellenghi M, Pandha HS, Calvaruso M, Tripodo C, Colombo MP, Morgan R, Care A", "evidence": [ { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" } ], "reference": [ { "type": "PubMed", "id": "23400877", "url": "https://glygen.org/publication/PubMed/23400877" } ] }, { "title": "Endogenous purification reveals GREB1 as a key estrogen receptor regulatory factor.", "journal": "Cell reports", "date": "2013", "authors": "Mohammed H, D'Santos C, Serandour AA, Ali HR, Brown GD, Atkins A, Rueda OM, Holmes KA, Theodorou V, Robinson JL, Zwart W, Saadi A, Ross-Innes CS, Chin SF, Menon S, Stingl J, Palmieri C, Caldas C, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23403292", "url": "https://glygen.org/publication/PubMed/23403292" } ] }, { "title": "The lysine demethylase, KDM4B, is a key molecule in androgen receptor signalling and turnover.", "journal": "Nucleic acids research", "date": "2013", "authors": "Coffey K, Rogerson L, Ryan-Munden C, Alkharaif D, Stockley J, Heer R, Sahadevan K, O'Neill D, Jones D, Darby S, Staller P, Mantilla A, Gaughan L, Robson CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23435229", "url": "https://glygen.org/publication/PubMed/23435229" } ] }, { "title": "Mutant B-RAF-Mcl-1 survival signaling depends on the STAT3 transcription factor.", "journal": "Oncogene", "date": "2014", "authors": "Becker TM, Boyd SC, Mijatov B, Gowrishankar K, Snoyman S, Pupo GM, Scolyer RA, Mann GJ, Kefford RF, Zhang XD, Rizos H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23455323", "url": "https://glygen.org/publication/PubMed/23455323" } ] }, { "title": "Tissue inhibitor of metalloproteinase 1 is preferentially expressed in Th1 and Th17 T-helper cell subsets and is a direct STAT target gene.", "journal": "PloS one", "date": "2013", "authors": "Adamson A, Ghoreschi K, Rittler M, Chen Q, Sun HW, Vahedi G, Kanno Y, Stetler-Stevenson WG, O'Shea JJ, Laurence A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23555662", "url": "https://glygen.org/publication/PubMed/23555662" } ] }, { "title": "The nuclear import of oncoprotein hepatitis B X-interacting protein depends on interacting with c-Fos and phosphorylation of both proteins in breast cancer cells.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Zhang Y, Zhao Y, Li H, Li Y, Cai X, Shen Y, Shi H, Li L, Liu Q, Zhang X, Ye L", "evidence": [ { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" } ], "reference": [ { "type": "PubMed", "id": "23667255", "url": "https://glygen.org/publication/PubMed/23667255" } ] }, { "title": "KDM4B is a master regulator of the estrogen receptor signalling cascade.", "journal": "Nucleic acids research", "date": "2013", "authors": "Gaughan L, Stockley J, Coffey K, O'Neill D, Jones DL, Wade M, Wright J, Moore M, Tse S, Rogerson L, Robson CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23723241", "url": "https://glygen.org/publication/PubMed/23723241" } ] }, { "title": "N-myc downstream-regulated gene 1 promotes tumor inflammatory angiogenesis through JNK activation and autocrine loop of interleukin-1alpha by human gastric cancer cells.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Murakami Y, Watari K, Shibata T, Uba M, Ureshino H, Kawahara A, Abe H, Izumi H, Mukaida N, Kuwano M, Ono M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "23846687", "url": "https://glygen.org/publication/PubMed/23846687" } ] }, { "title": "CXXC5 Associates with Smads to Mediate TNF-alpha Induced Apoptosis.", "journal": "Current molecular medicine", "date": "2013", "authors": "Wang X, Liao P, Fan X, Wan Y, Wang Y, Li Y, Jiang Z, Ye X, Mo X, Ocorr K, Deng Y, Wu X, Yuan W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23906331", "url": "https://glygen.org/publication/PubMed/23906331" } ] }, { "title": "STAT3 regulates MMP3 in heme-induced endothelial cell apoptosis.", "journal": "PloS one", "date": "2013", "authors": "Liu M, Wilson NO, Hibbert JM, Stiles JK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23967200", "url": "https://glygen.org/publication/PubMed/23967200" } ] }, { "title": "Estradiol and tamoxifen induce cell migration through GPR30 and activation of focal adhesion kinase (FAK) in endometrial cancers with low or without nuclear estrogen receptor alpha (ERalpha).", "journal": "PloS one", "date": "2013", "authors": "Tsai CL, Wu HM, Lin CY, Lin YJ, Chao A, Wang TH, Hsueh S, Lai CH, Wang HS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "24039841", "url": "https://glygen.org/publication/PubMed/24039841" } ] }, { "title": "Involvement of a NF-kappa B-like transcription factor in the activation of the interleukin-6 gene by inflammatory lymphokines.", "journal": "Molecular and cellular biology", "date": "1990", "authors": "Shimizu H, Mitomo K, Watanabe T, Okamoto S, Yamamoto K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "2405250", "url": "https://glygen.org/publication/PubMed/2405250" } ] }, { "title": "Identification of a functional TPH1 polymorphism associated with irritable bowel syndrome bowel habit subtypes.", "journal": "The American journal of gastroenterology", "date": "2013", "authors": "Grasberger H, Chang L, Shih W, Presson AP, Sayuk GS, Newberry RD, Karagiannides I, Pothoulakis C, Mayer E, Merchant JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "24060757", "url": "https://glygen.org/publication/PubMed/24060757" } ] }, { "title": "The signal transducers Stat1 and Stat3 and their novel target Jmjd3 drive the expression of inflammatory genes in microglia.", "journal": "Journal of molecular medicine (Berlin, Germany)", "date": "2014", "authors": "Przanowski P, Dabrowski M, Ellert-Miklaszewska A, Kloss M, Mieczkowski J, Kaza B, Ronowicz A, Hu F, Piotrowski A, Kettenmann H, Komorowski J, Kaminska B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "24097101", "url": "https://glygen.org/publication/PubMed/24097101" } ] }, { "title": "Increased RCAS1 expression is associated with advanced histopathological stage and poor prognosis in patients with gastric adenocarcinoma.", "journal": "Disease markers", "date": "2013", "authors": "Giaginis C, Efkarpidis T, Alexandrou P, Patsouris E, Kouraklis G, Theocharis S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24167369", "url": "https://glygen.org/publication/PubMed/24167369" } ] }, { "title": "Regulation of the neuronal transcription factor NPAS4 by REST and microRNAs.", "journal": "Biochimica et biophysica acta", "date": "2014", "authors": "Bersten DC, Wright JA, McCarthy PJ, Whitelaw ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-9768919", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9768919" } ], "reference": [ { "type": "PubMed", "id": "24291638", "url": "https://glygen.org/publication/PubMed/24291638" } ] }, { "title": "An H2A histone isotype regulates estrogen receptor target genes by mediating enhancer-promoter-3'-UTR interactions in breast cancer cells.", "journal": "Nucleic acids research", "date": "2014", "authors": "Su CH, Tzeng TY, Cheng C, Hsu MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24371278", "url": "https://glygen.org/publication/PubMed/24371278" } ] }, { "title": "Human variants in the neuronal basic helix-loop-helix/Per-Arnt-Sim (bHLH/PAS) transcription factor complex NPAS4/ARNT2 disrupt function.", "journal": "PloS one", "date": "2014", "authors": "Bersten DC, Bruning JB, Peet DJ, Whitelaw ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-9768919", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9768919" } ], "reference": [ { "type": "PubMed", "id": "24465693", "url": "https://glygen.org/publication/PubMed/24465693" } ] }, { "title": "Ovarian cancer-associated mutations disable catalytic activity of CDK12, a kinase that promotes homologous recombination repair and resistance to cisplatin and poly(ADP-ribose) polymerase inhibitors.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Joshi PM, Sutor SL, Huntoon CJ, Karnitz LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "24554720", "url": "https://glygen.org/publication/PubMed/24554720" } ] }, { "title": "The structure and substrate specificity of human Cdk12/Cyclin K.", "journal": "Nature communications", "date": "2014", "authors": "Bosken CA, Farnung L, Hintermair C, Merzel Schachter M, Vogel-Bachmayr K, Blazek D, Anand K, Fisher RP, Eick D, Geyer M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "24662513", "url": "https://glygen.org/publication/PubMed/24662513" } ] }, { "title": "Homeobox transcription factor VentX regulates differentiation and maturation of human dendritic cells.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Wu X, Gao H, Bleday R, Zhu Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "24706756", "url": "https://glygen.org/publication/PubMed/24706756" } ] }, { "title": "Identification of miR-26 as a key mediator of estrogen stimulated cell proliferation by targeting CHD1, GREB1 and KPNA2.", "journal": "Breast cancer research : BCR", "date": "2014", "authors": "Tan S, Ding K, Li R, Zhang W, Li G, Kong X, Qian P, Lobie PE, Zhu T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24735615", "url": "https://glygen.org/publication/PubMed/24735615" } ] }, { "title": "STAT3 Target Genes Relevant to Human Cancers.", "journal": "Cancers", "date": "2014", "authors": "Carpenter RL, Lo HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "24743777", "url": "https://glygen.org/publication/PubMed/24743777" } ] }, { "title": "Cohesin in cancer: chromosome segregation and beyond.", "journal": "Nature reviews. Cancer", "date": "2014", "authors": "Losada A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24854081", "url": "https://glygen.org/publication/PubMed/24854081" } ] }, { "title": "Apoptotic function of tumor-associated antigen RCAS1 in oral squamous cell carcinoma.", "journal": "Journal of translational medicine", "date": "2014", "authors": "Tanaka H, Toyoshima T, Sonoda K, Kitamura R, Sasaguri M, Kawano S, Matsubara R, Goto Y, Nakamura S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24885040", "url": "https://glygen.org/publication/PubMed/24885040" } ] }, { "title": "A functional interplay between ZNF217 and estrogen receptor alpha exists in luminal breast cancers.", "journal": "Molecular oncology", "date": "2014", "authors": "Nguyen NT, Vendrell JA, Poulard C, Gyorffy B, Goddard-Leon S, Bieche I, Corbo L, Le Romancer M, Bachelot T, Treilleux I, Cohen PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24973012", "url": "https://glygen.org/publication/PubMed/24973012" } ] }, { "title": "Consideration of GREB1 as a potential therapeutic target for hormone-responsive or endocrine-resistant cancers.", "journal": "Expert opinion on therapeutic targets", "date": "2014", "authors": "Hodgkinson KM, Vanderhyden BC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24998469", "url": "https://glygen.org/publication/PubMed/24998469" } ] }, { "title": "The basic region of Fos mediates specific DNA binding.", "journal": "EMBO J.", "date": "1989", "authors": "Nakabeppu Y, Nathans D", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "reference": [ { "type": "PubMed", "id": "2511004", "url": "https://glygen.org/publication/PubMed/2511004" } ] }, { "title": "Transcription factor ATF cDNA clones: an extensive family of leucine zipper proteins able to selectively form DNA-binding heterodimers.", "journal": "Genes Dev.", "date": "1989", "authors": "Hai TW, Liu F, Coukos WJ, Green MR", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "reference": [ { "type": "PubMed", "id": "2516827", "url": "https://glygen.org/publication/PubMed/2516827" } ] }, { "title": "Uncovering global SUMOylation signaling networks in a site-specific manner.", "journal": "Nat. Struct. Mol. Biol.", "date": "2014", "authors": "Hendriks IA, D'Souza RC, Yang B, Verlaan-de Vries M, Mann M, Vertegaal AC", "evidence": [ { "database": "UniProtKB", "id": "G3V2V7", "url": "https://www.uniprot.org/uniprot/G3V2V7" } ], "reference": [ { "type": "PubMed", "id": "25218447", "url": "https://glygen.org/publication/PubMed/25218447" } ] }, { "title": "Liver is the major source of elevated serum lipocalin-2 levels after bacterial infection or partial hepatectomy: a critical role for IL-6/STAT3.", "journal": "Hepatology (Baltimore, Md.)", "date": "2015", "authors": "Xu MJ, Feng D, Wu H, Wang H, Chan Y, Kolls J, Borregaard N, Porse B, Berger T, Mak TW, Cowland JB, Kong X, Gao B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "25234944", "url": "https://glygen.org/publication/PubMed/25234944" } ] }, { "title": "Id proteins: small molecules, mighty regulators.", "journal": "Current topics in developmental biology", "date": "2014", "authors": "Ling F, Kang B, Sun XH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "25248477", "url": "https://glygen.org/publication/PubMed/25248477" } ] }, { "title": "Serum receptor-binding cancer antigen expressed on SiSo cells (RCAS1) as a diagnostic and prognostic marker for non-small cell lung cancer.", "journal": "Tumori", "date": "2014", "authors": "Xu C, Yu LK, Zhang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25296600", "url": "https://glygen.org/publication/PubMed/25296600" } ] }, { "title": "EBAG9 modulates host immune defense against tumor formation and metastasis by regulating cytotoxic activity of T lymphocytes.", "journal": "Oncogenesis", "date": "2014", "authors": "Miyazaki T, Ikeda K, Horie-Inoue K, Kondo T, Takahashi S, Inoue S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25365482", "url": "https://glygen.org/publication/PubMed/25365482" } ] }, { "title": "Expression, purification, and identification of associated proteins of the full-length hCDK12/CyclinK complex.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Bartkowiak B, Greenleaf AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "25429106", "url": "https://glygen.org/publication/PubMed/25429106" } ] }, { "title": "CXXC5 regulates differentiation of C2C12 myoblasts into myocytes.", "journal": "Journal of muscle research and cell motility", "date": "2014", "authors": "Li G, Ye X, Peng X, Deng Y, Yuan W, Li Y, Mo X, Wang X, Wan Y, Liu X, Chen T, Jiang Z, Fan X, Wu X, Wang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25433557", "url": "https://glygen.org/publication/PubMed/25433557" } ] }, { "title": "Cohesin modulates transcription of estrogen-responsive genes.", "journal": "Biochimica et biophysica acta", "date": "2015", "authors": "Antony J, Dasgupta T, Rhodes JM, McEwan MV, Print CG, O'Sullivan JM, Horsfield JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25542856", "url": "https://glygen.org/publication/PubMed/25542856" } ] }, { "title": "Characterization of human cyclin-dependent kinase 12 (CDK12) and CDK13 complexes in C-terminal domain phosphorylation, gene transcription, and RNA processing.", "journal": "Molecular and cellular biology", "date": "2015", "authors": "Liang K, Gao X, Gilmore JM, Florens L, Washburn MP, Smith E, Shilatifard A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "25561469", "url": "https://glygen.org/publication/PubMed/25561469" } ] }, { "title": "Transcriptional regulation of the neuropeptide VGF by the neuron-restrictive silencer factor/neuron-restrictive silencer element.", "journal": "Neuroreport", "date": "2015", "authors": "Moon SM, Kim JS, Park BR, Kim DK, Kim SG, Kim HJ, Chun HS, Lee BK, Kim CS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "25569790", "url": "https://glygen.org/publication/PubMed/25569790" } ] }, { "title": "CXXC5 is a negative-feedback regulator of the Wnt/beta-catenin pathway involved in osteoblast differentiation.", "journal": "Cell death and differentiation", "date": "2015", "authors": "Kim HY, Yoon JY, Yun JH, Cho KW, Lee SH, Rhee YM, Jung HS, Lim HJ, Lee H, Choi J, Heo JN, Lee W, No KT, Min D, Choi KY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25633194", "url": "https://glygen.org/publication/PubMed/25633194" } ] }, { "title": "Two Faces of Cathepsin D: Physiological Guardian Angel and Pathological Demon.", "journal": "Biology and medicine (Aligarh)", "date": "2014", "authors": "Khalkhali-Ellis Z, Hendrix MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25663755", "url": "https://glygen.org/publication/PubMed/25663755" } ] }, { "title": "Expression of RCAS1 correlates with urothelial bladder cancer malignancy.", "journal": "International journal of molecular sciences", "date": "2015", "authors": "Jozwicki W, Brozyna AA, Siekiera J, Slominski AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25674852", "url": "https://glygen.org/publication/PubMed/25674852" } ] }, { "title": "Ovarian carcinoma CDK12 mutations misregulate expression of DNA repair genes via deficient formation and function of the Cdk12/CycK complex.", "journal": "Nucleic acids research", "date": "2015", "authors": "Ekumi KM, Paculova H, Lenasi T, Pospichalova V, Bosken CA, Rybarikova J, Bryja V, Geyer M, Blazek D, Barboric M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "25712099", "url": "https://glygen.org/publication/PubMed/25712099" } ] }, { "title": "Structure of a biologically active estrogen receptor-coactivator complex on DNA.", "journal": "Molecular cell", "date": "2015", "authors": "Yi P, Wang Z, Feng Q, Pintilie GD, Foulds CE, Lanz RB, Ludtke SJ, Schmid MF, Chiu W, O'Malley BW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25728767", "url": "https://glygen.org/publication/PubMed/25728767" } ] }, { "title": "Arc is a flexible modular protein capable of reversible self-oligomerization.", "journal": "The Biochemical journal", "date": "2015", "authors": "Myrum C, Baumann A, Bustad HJ, Flydal MI, Mariaule V, Alvira S, Cuellar J, Haavik J, Soule J, Valpuesta JM, Marquez JA, Martinez A, Bramham CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "25748042", "url": "https://glygen.org/publication/PubMed/25748042" } ] }, { "title": "SUMO-2 orchestrates chromatin modifiers in response to DNA damage.", "journal": "Cell Rep.", "date": "2015", "authors": "Hendriks Ivo A, Treffers Louise W, Verlaan-de Vries Matty, Olsen Jesper V, Vertegaal Alfred C O", "evidence": [ { "database": "UniProtKB", "id": "G3V2V7", "url": "https://www.uniprot.org/uniprot/G3V2V7" } ], "reference": [ { "type": "PubMed", "id": "25772364", "url": "https://glygen.org/publication/PubMed/25772364" } ] }, { "title": "How it all starts: Initiation of the clotting cascade.", "journal": "Critical reviews in biochemistry and molecular biology", "date": "2015", "authors": "Smith SA, Travers RJ, Morrissey JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "26018600", "url": "https://glygen.org/publication/PubMed/26018600" } ] }, { "title": "The Dishevelled-binding protein CXXC5 negatively regulates cutaneous wound healing.", "journal": "The Journal of experimental medicine", "date": "2015", "authors": "Lee SH, Kim MY, Kim HY, Lee YM, Kim H, Nam KA, Roh MR, Min do S, Chung KY, Choi KY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26056233", "url": "https://glygen.org/publication/PubMed/26056233" } ] }, { "title": "Progesterone receptor modulates ERalpha action in breast cancer.", "journal": "Nature", "date": "2015", "authors": "Mohammed H, Russell IA, Stark R, Rueda OM, Hickey TE, Tarulli GA, Serandour AA, Birrell SN, Bruna A, Saadi A, Menon S, Hadfield J, Pugh M, Raj GV, Brown GD, D'Santos C, Robinson JL, Silva G, Launchbury R, Perou CM, Stingl J, Caldas C, Tilley WD, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26153859", "url": "https://glygen.org/publication/PubMed/26153859" } ] }, { "title": "MiR-26b/KPNA2 axis inhibits epithelial ovarian carcinoma proliferation and metastasis through downregulating OCT4.", "journal": "Oncotarget", "date": "2015", "authors": "Lin J, Zhang L, Huang H, Huang Y, Huang L, Wang J, Huang S, He L, Zhou Y, Jia W, Yun J, Luo R, Zheng M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26204489", "url": "https://glygen.org/publication/PubMed/26204489" } ] }, { "title": "p27(Kip1) signaling: Transcriptional and post-translational regulation.", "journal": "The international journal of biochemistry & cell biology", "date": "2015", "authors": "Hnit SS, Xie C, Yao M, Holst J, Bensoussan A, De Souza P, Li Z, Dong Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "26279144", "url": "https://glygen.org/publication/PubMed/26279144" } ] }, { "title": "CXXC5 plays a role as a transcription activator for myelin genes on oligodendrocyte differentiation.", "journal": "Glia", "date": "2016", "authors": "Kim MY, Kim HY, Hong J, Kim D, Lee H, Cheong E, Lee Y, Roth J, Kim DG, Min do S, Choi KY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26462610", "url": "https://glygen.org/publication/PubMed/26462610" } ] }, { "title": "Trefoil factor family peptides--friends or foes?", "journal": "Biomolecular concepts", "date": "2015", "authors": "Busch M, Dunker N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26479350", "url": "https://glygen.org/publication/PubMed/26479350" } ] }, { "title": "KDM2B/FBXL10 targets c-Fos for ubiquitylation and degradation in response to mitogenic stimulation.", "journal": "Oncogene", "date": "2016", "authors": "Han XR, Zha Z, Yuan HX, Feng X, Xia YK, Lei QY, Guan KL, Xiong Y", "evidence": [ { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" } ], "reference": [ { "type": "PubMed", "id": "26725323", "url": "https://glygen.org/publication/PubMed/26725323" } ] }, { "title": "A protein induced by NGF in PC12 cells is stored in secretory vesicles and released through the regulated pathway.", "journal": "The EMBO journal", "date": "1989", "authors": "Possenti R, Eldridge JD, Paterson BM, Grasso A, Levi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "2676516", "url": "https://glygen.org/publication/PubMed/2676516" } ] }, { "title": "Structural Basis for Substrate Selectivity of the E3 Ligase COP1.", "journal": "Structure (London, England : 1993)", "date": "2016", "authors": "Uljon S, Xu X, Durzynska I, Stein S, Adelmant G, Marto JA, Pear WS, Blacklow SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "27041596", "url": "https://glygen.org/publication/PubMed/27041596" } ] }, { "title": "Steroid Receptors Reprogram FoxA1 Occupancy through Dynamic Chromatin Transitions.", "journal": "Cell", "date": "2016", "authors": "Swinstead EE, Miranda TB, Paakinaho V, Baek S, Goldstein I, Hawkins M, Karpova TS, Ball D, Mazza D, Lavis LD, Grimm JB, Morisaki T, Grontved L, Presman DM, Hager GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "27062924", "url": "https://glygen.org/publication/PubMed/27062924" } ] }, { "title": "Combined Id1 and Id3 Deletion Leads to Severe Erythropoietic Disturbances.", "journal": "PloS one", "date": "2016", "authors": "Zhao Q, Chang C, Gonzalez JP, Alzahrani K, Button JL, Fraidenraich D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "27128622", "url": "https://glygen.org/publication/PubMed/27128622" } ] }, { "title": "Gene regulation in the immediate-early response process.", "journal": "Advances in biological regulation", "date": "2016", "authors": "Bahrami S, Drablos F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "27220739", "url": "https://glygen.org/publication/PubMed/27220739" } ] }, { "title": "MAGED1 is a novel regulator of a select subset of bHLH PAS transcription factors.", "journal": "The FEBS journal", "date": "2016", "authors": "Sullivan AE, Peet DJ, Whitelaw ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-9768919", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9768919" } ], "reference": [ { "type": "PubMed", "id": "27472814", "url": "https://glygen.org/publication/PubMed/27472814" } ] }, { "title": "Induction of Connective Tissue Growth Factor Expression by Hypoxia in Human Lung Fibroblasts via the MEKK1/MEK1/ERK1/GLI-1/GLI-2 and AP-1 Pathways.", "journal": "PloS one", "date": "2016", "authors": "Cheng Y, Lin CH, Chen JY, Li CH, Liu YT, Chen BC", "evidence": [ { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" } ], "reference": [ { "type": "PubMed", "id": "27486656", "url": "https://glygen.org/publication/PubMed/27486656" } ] }, { "title": "The emerging role of estrogen in B cell malignancies.", "journal": "Leukemia & lymphoma", "date": "2017", "authors": "Ladikou EE, Kassi E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "27557932", "url": "https://glygen.org/publication/PubMed/27557932" } ] }, { "title": "Estradiol-Estrogen Receptor alpha Mediates the Expression of the CXXC5 Gene through the Estrogen Response Element-Dependent Signaling Pathway.", "journal": "Scientific reports", "date": "2016", "authors": "Yasar P, Ayaz G, Muyan M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "27886276", "url": "https://glygen.org/publication/PubMed/27886276" } ] }, { "title": "Resveratrol regulates gene transcription via activation of stimulus-responsive transcription factors.", "journal": "Pharmacological research", "date": "2017", "authors": "Thiel G, Rossler OG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "28012964", "url": "https://glygen.org/publication/PubMed/28012964" } ] }, { "title": "Role for Egr1 in the Transcriptional Program Associated with Neuronal Differentiation of PC12 Cells.", "journal": "PloS one", "date": "2017", "authors": "Adams KW, Kletsov S, Lamm RJ, Elman JS, Mullenbrock S, Cooper GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "28076410", "url": "https://glygen.org/publication/PubMed/28076410" } ] }, { "title": "Binding and inhibition of the ternary complex factor Elk-4/Sap1 by the adapter protein Dok-4.", "journal": "The Biochemical journal", "date": "2017", "authors": "Hooker E, Baldwin C, Roodman V, Batra A, Isa NN, Takano T, Lemay S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "28275114", "url": "https://glygen.org/publication/PubMed/28275114" } ] }, { "title": "ERK-Induced Activation of TCF Family of SRF Cofactors Initiates a Chromatin Modification Cascade Associated with Transcription.", "journal": "Molecular cell", "date": "2017", "authors": "Esnault C, Gualdrini F, Horswell S, Kelly G, Stewart A, East P, Matthews N, Treisman R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "28286024", "url": "https://glygen.org/publication/PubMed/28286024" } ] }, { "title": "Membrane and Nuclear Estrogen Receptor Alpha Actions: From Tissue Specificity to Medical Implications.", "journal": "Physiological reviews", "date": "2017", "authors": "Arnal JF, Lenfant F, Metivier R, Flouriot G, Henrion D, Adlanmerini M, Fontaine C, Gourdy P, Chambon P, Katzenellenbogen B, Katzenellenbogen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "28539435", "url": "https://glygen.org/publication/PubMed/28539435" } ] }, { "title": "A role for G-protein coupled estrogen receptor (GPER) in estrogen-induced carcinogenesis: Dysregulated glandular homeostasis, survival and metastasis.", "journal": "The Journal of steroid biochemistry and molecular biology", "date": "2018", "authors": "Filardo EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "28595943", "url": "https://glygen.org/publication/PubMed/28595943" } ] }, { "title": "Estrogen-responsive element of the human pS2 gene is an imperfectly palindromic sequence.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Berry M, Nunez AM, Chambon P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "2919170", "url": "https://glygen.org/publication/PubMed/2919170" } ] }, { "title": "Mapping and Quantification of Over 2000 O-linked Glycopeptides in Activated Human T Cells with Isotope-Targeted Glycoproteomics (Isotag).", "journal": "Molecular & cellular proteomics : MCP", "date": "2018", "authors": "Woo CM, Lund PJ, Huang AC, Davis MM, Bertozzi CR, Pitteri SJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "P01100", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01100" }, { "database": "O-GlcNAc Atlas", "id": "P01100", "url": "https://oglcnac.org/atlas/detail/P01100" }, { "database": "GlyGen", "id": "GLY_000142", "url": "https://data.glygen.org/GLY_000142" } ], "reference": [ { "type": "PubMed", "id": "29351928", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "title": "Regulation of mutant TERT by BRAF V600E/MAP kinase pathway through FOS/GABP in human cancer.", "journal": "Nature communications", "date": "2018", "authors": "Liu R, Zhang T, Zhu G, Xing M", "evidence": [ { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" } ], "reference": [ { "type": "PubMed", "id": "29422527", "url": "https://glygen.org/publication/PubMed/29422527" } ] }, { "title": "The MEK1/2-ERK Pathway Inhibits Type I IFN Production in Plasmacytoid Dendritic Cells.", "journal": "Frontiers in immunology", "date": "2018", "authors": "Janovec V, Aouar B, Font-Haro A, Hofman T, Trejbalova K, Weber J, Chaperot L, Plumas J, Olive D, Dubreuil P, Nunes JA, Stranska R, Hirsch I", "evidence": [ { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" } ], "reference": [ { "type": "PubMed", "id": "29535732", "url": "https://glygen.org/publication/PubMed/29535732" } ] }, { "title": "The Arc of cognition: Signaling cascades regulating Arc and implications for cognitive function and disease.", "journal": "Seminars in cell & developmental biology", "date": "2018", "authors": "Epstein I, Finkbeiner S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "29559111", "url": "https://glygen.org/publication/PubMed/29559111" } ] }, { "title": "Natural compound Tetrocarcin-A downregulates Junctional Adhesion Molecule-A in conjunction with HER2 and inhibitor of apoptosis proteins and inhibits tumor cell growth.", "journal": "Cancer letters", "date": "2019-01", "authors": "Vellanki Sri HariKrishna, Cruz Rodrigo G B, Jahns Hanne, Hudson Lance, Sette Giovanni, Eramo Adriana, Hopkins Ann M", "evidence": [ { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" } ], "reference": [ { "type": "PubMed", "id": "30312728", "url": "https://glygen.org/publication/PubMed/30312728" } ] }, { "title": "Transcriptional regulation of c-myc oncogene expression by estrogen in hormone-responsive human breast cancer cells.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Dubik D, Shiu RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3045126", "url": "https://glygen.org/publication/PubMed/3045126" } ] }, { "title": "Amyloid beta-induced elevation of O-GlcNAcylated c-Fos promotes neuronal cell death.", "journal": "Aging cell", "date": "2019", "authors": "Choi H, Kim C, Song H, Cha MY, Cho HJ, Son SM, Kim HJ, Mook-Jung I", "evidence": [ { "database": "O-GlcNAc Database", "id": "P01100", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01100" }, { "database": "O-GlcNAc Atlas", "id": "P01100", "url": "https://oglcnac.org/atlas/detail/P01100" } ], "reference": [ { "type": "PubMed", "id": "30515991", "url": "https://glygen.org/publication/PubMed/30515991" } ] }, { "title": "A zinc finger-encoding gene coregulated with c-fos during growth and differentiation, and after cellular depolarization.", "journal": "Cell", "date": "1988", "authors": "Sukhatme VP, Cao XM, Chang LC, Tsai-Morris CH, Stamenkovich D, Ferreira PC, Cohen DR, Edwards SA, Shows TB, Curran T, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "3127059", "url": "https://glygen.org/publication/PubMed/3127059" } ] }, { "title": "Genomic Decoding of Neuronal Depolarization by Stimulus-Specific NPAS4 Heterodimers.", "journal": "Cell", "date": "2019", "authors": "Brigidi GS, Hayes MGB, Delos Santos NP, Hartzell AL, Texari L, Lin PA, Bartlett A, Ecker JR, Benner C, Heinz S, Bloodgood BL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9768919", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9768919" } ], "reference": [ { "type": "PubMed", "id": "31585079", "url": "https://glygen.org/publication/PubMed/31585079" } ] }, { "title": "A transcriptional arrest mechanism involved in controlling constitutive levels of mouse c-myb mRNA.", "journal": "Oncogene", "date": "1988", "authors": "Watson RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3281094", "url": "https://glygen.org/publication/PubMed/3281094" } ] }, { "title": "Truncation of the TPR domain of OGT alters substrate and glycosite selection.", "journal": "Analytical and bioanalytical chemistry", "date": "2021", "authors": "Ramirez DH, Yang B, D'Souza AK, Shen D, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P01100", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01100" } ], "reference": [ { "type": "PubMed", "id": "34725712", "url": "https://glygen.org/publication/PubMed/34725712" } ] }, { "title": "Differential expression of c-myb mRNA in murine B lymphomas by a block to transcription elongation.", "journal": "Science (New York, N.Y.)", "date": "1987", "authors": "Bender TP, Thompson CB, Kuehl WM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3498214", "url": "https://glygen.org/publication/PubMed/3498214" } ] }, { "title": "A nerve growth factor-induced gene encodes a possible transcriptional regulatory factor.", "journal": "Science (New York, N.Y.)", "date": "1987", "authors": "Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "3672127", "url": "https://glygen.org/publication/PubMed/3672127" } ] }, { "title": "Stimulation of c-myc oncogene expression associated with estrogen-induced proliferation of human breast cancer cells.", "journal": "Cancer research", "date": "1987", "authors": "Dubik D, Dembinski TC, Shiu RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3677090", "url": "https://glygen.org/publication/PubMed/3677090" } ] }, { "title": "Protection of c-Fos from autophagic degradation by PRMT1-mediated methylation fosters gastric tumorigenesis.", "journal": "International journal of biological sciences", "date": "2023", "authors": "Kim Eunji, Rahmawati Laily, Aziz Nur, Kim Han Gyung, Kim Ji Hye, Kim Kyung-Hee, Yoo Byong Chul, Parameswaran Narayana, Kang Jong-Sun, Hur Hoon, Manavalan Balachandran, Lee Jongsung, Cho Jae Youl", "evidence": [ { "database": "RefSeq", "id": "NP_005243", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005243" } ], "reference": [ { "type": "PubMed", "id": "37564212", "url": "https://glygen.org/publication/PubMed/37564212" } ] }, { "title": "c-FOS is an integral component of the IKZF1 transactivator complex and mediates lenalidomide resistance in multiple myeloma.", "journal": "Clinical and translational medicine", "date": "2023-08", "authors": "Osada Naoki, Kikuchi Jiro, Iha Hidekatsu, Yasui Hiroshi, Ikeda Sho, Takahashi Naoto, Furukawa Yusuke", "evidence": [ { "database": "RefSeq", "id": "NP_005243", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005243" } ], "reference": [ { "type": "PubMed", "id": "37581569", "url": "https://glygen.org/publication/PubMed/37581569" } ] }, { "title": "Over-expression of cFos by the Transcription Factors NFATc2 and Sp1 in Pancreatic Cancer Cells.", "journal": "Anticancer research", "date": "2023-11", "authors": "Malsy Manuela, Graf Bernhard, Bruendl Elisabeth, Maier-Stocker Constantin, Bundscherer Anika", "evidence": [ { "database": "RefSeq", "id": "NP_005243", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005243" } ], "reference": [ { "type": "PubMed", "id": "37909980", "url": "https://glygen.org/publication/PubMed/37909980" } ] }, { "title": "Molecular profiling of clinical remission in psoriatic arthritis reveals dysregulation of FOS and CCDC50 genes: a gene expression study.", "journal": "Frontiers in immunology", "date": "2023", "authors": "Angioni Maria Maddalena, Floris Alberto, Cangemi Ignazio, Congia Mattia, Chessa Elisabetta, Naitza Micaela Rita, Piga Matteo, Cauli Alberto", "evidence": [ { "database": "RefSeq", "id": "NP_005243", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005243" } ], "reference": [ { "type": "PubMed", "id": "37965313", "url": "https://glygen.org/publication/PubMed/37965313" } ] }, { "title": "Expression of PVRL4, a molecular target for cancer treatment, is transcriptionally regulated by FOS.", "journal": "Oncology reports", "date": "2024-01", "authors": "Nanamiya Tomoyuki, Takane Kiyoko, Yamaguchi Kiyoshi, Okawara Yuya, Arakawa Mariko, Saku Akari, Ikenoue Tsuneo, Fujiyuki Tomoko, Yoneda Misako, Kai Chieko, Furukawa Yoichi", "evidence": [ { "database": "RefSeq", "id": "NP_005243", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005243" } ], "reference": [ { "type": "PubMed", "id": "38063270", "url": "https://glygen.org/publication/PubMed/38063270" } ] }, { "title": "Complete nucleotide sequence of a human c-onc gene: deduced amino acid sequence of the human c-fos protein.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1983", "authors": "van Straaten F, M\u00fcller R, Curran T, Van Beveren C, Verma I M", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "reference": [ { "type": "PubMed", "id": "6574479", "url": "https://glygen.org/publication/PubMed/6574479" } ] }, { "title": "Interferon activation of the transcription factor Stat91 involves dimerization through SH2-phosphotyrosyl peptide interactions.", "journal": "Cell", "date": "1994", "authors": "Shuai K, Horvath CM, Huang LH, Qureshi SA, Cowburn D, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7510216", "url": "https://glygen.org/publication/PubMed/7510216" } ] }, { "title": "Molecular cloning of APRF, a novel IFN-stimulated gene factor 3 p91-related transcription factor involved in the gp130-mediated signaling pathway.", "journal": "Cell", "date": "1994", "authors": "Akira S, Nishio Y, Inoue M, Wang XJ, Wei S, Matsusaka T, Yoshida K, Sudo T, Naruto M, Kishimoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7512451", "url": "https://glygen.org/publication/PubMed/7512451" } ] }, { "title": "IL-13 selectively induces vascular cell adhesion molecule-1 expression in human endothelial cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1995", "authors": "Bochner BS, Klunk DA, Sterbinsky SA, Coffman RL, Schleimer RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7529288", "url": "https://glygen.org/publication/PubMed/7529288" } ] }, { "title": "Pro-inflammatory cytokines and environmental stress cause p38 mitogen-activated protein kinase activation by dual phosphorylation on tyrosine and threonine.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Raingeaud J, Gupta S, Rogers JS, Dickens M, Han J, Ulevitch RJ, Davis RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "7535770", "url": "https://glygen.org/publication/PubMed/7535770" } ] }, { "title": "Serine 133-phosphorylated CREB induces transcription via a cooperative mechanism that may confer specificity to neurotrophin signals.", "journal": "Molecular and cellular neurosciences", "date": "1995", "authors": "Bonni A, Ginty DD, Dudek H, Greenberg ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "7551568", "url": "https://glygen.org/publication/PubMed/7551568" } ] }, { "title": "Transforming p21ras mutants and c-Ets-2 activate the cyclin D1 promoter through distinguishable regions.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Albanese C, Johnson J, Watanabe G, Eklund N, Vu D, Arnold A, Pestell RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "7559524", "url": "https://glygen.org/publication/PubMed/7559524" } ] }, { "title": "Journey to the surface of the cell: Fos regulation and the SRE.", "journal": "The EMBO journal", "date": "1995", "authors": "Treisman R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "7588619", "url": "https://glygen.org/publication/PubMed/7588619" } ] }, { "title": "The Mos/MAP kinase pathway stabilizes c-Fos by phosphorylation and augments its transforming activity in NIH 3T3 cells.", "journal": "The EMBO journal", "date": "1995", "authors": "Okazaki K, Sagata N", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" }, { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" }, { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" } ], "reference": [ { "type": "PubMed", "id": "7588633", "url": "https://glygen.org/publication/PubMed/7588633" } ] }, { "title": "An isoform of the neuronal cyclin-dependent kinase 5 (Cdk5) activator.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Tang D, Yeung J, Lee KY, Matsushita M, Matsui H, Tomizawa K, Hatase O, Wang JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "7592934", "url": "https://glygen.org/publication/PubMed/7592934" } ] }, { "title": "Tissue-specific processing of the neuroendocrine protein VGF.", "journal": "Journal of neurochemistry", "date": "1995", "authors": "Trani E, Ciotti T, Rinaldi AM, Canu N, Ferri GL, Levi A, Possenti R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "7595538", "url": "https://glygen.org/publication/PubMed/7595538" } ] }, { "title": "Transcriptional activation of egr-1 by granulocyte-macrophage colony-stimulating factor but not interleukin 3 requires phosphorylation of cAMP response element-binding protein (CREB) on serine 133.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Lee HJ, Mignacca RC, Sakamoto KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "7608156", "url": "https://glygen.org/publication/PubMed/7608156" } ] }, { "title": "Identification of NAB1, a repressor of NGFI-A- and Krox20-mediated transcription.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Russo MW, Sevetson BR, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "7624335", "url": "https://glygen.org/publication/PubMed/7624335" } ] }, { "title": "Somatodendritic expression of an immediate early gene is regulated by synaptic activity.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Link W, Konietzko U, Kauselmann G, Krug M, Schwanke B, Frey U, Kuhl D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "7777577", "url": "https://glygen.org/publication/PubMed/7777577" } ] }, { "title": "Direct evidence of a heterotrimeric complex of human interleukin-4 with its receptors.", "journal": "Protein science : a publication of the Protein Society", "date": "1995", "authors": "Hoffman RC, Castner BJ, Gerhart M, Gibson MG, Rasmussen BD, March CJ, Weatherbee J, Tsang M, Gustchina A, Schalk-Hihi C, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7795521", "url": "https://glygen.org/publication/PubMed/7795521" } ] }, { "title": "Components of a Stat recognition code: evidence for two layers of molecular selectivity.", "journal": "Immunity", "date": "1995", "authors": "Schindler U, Wu P, Rothe M, Brasseur M, McKnight SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7796300", "url": "https://glygen.org/publication/PubMed/7796300" } ] }, { "title": "Crystal structure of the heterodimeric bZIP transcription factor c-Fos-c-Jun bound to DNA.", "journal": "Nature", "date": "1995", "authors": "Glover JN, Harrison SC", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" }, { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "7816143", "url": "https://glygen.org/publication/PubMed/7816143" } ] }, { "title": "Phosphorylation of the c-Fos and c-Jun HOB1 motif stimulates its activation capacity.", "journal": "Nucleic acids research", "date": "1994", "authors": "Bannister AJ, Brown HJ, Sutherland JA, Kouzarides T", "evidence": [ { "database": "iPTMnet", "id": "P01100-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100-1" } ], "reference": [ { "type": "PubMed", "id": "7816602", "url": "https://glygen.org/publication/PubMed/7816602" } ] }, { "title": "A ternary complex factor-dependent mechanism mediates induction of egr-1 through selective serum response elements following antigen receptor cross-linking in B lymphocytes.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "McMahon SB, Monroe JG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "7823924", "url": "https://glygen.org/publication/PubMed/7823924" } ] }, { "title": "MAPKs: new JNK expands the group.", "journal": "Trends in biochemical sciences", "date": "1994", "authors": "Davis RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "7855889", "url": "https://glygen.org/publication/PubMed/7855889" } ] }, { "title": "Arc, a growth factor and activity-regulated gene, encodes a novel cytoskeleton-associated protein that is enriched in neuronal dendrites.", "journal": "Neuron", "date": "1995", "authors": "Lyford GL, Yamagata K, Kaufmann WE, Barnes CA, Sanders LK, Copeland NG, Gilbert DJ, Jenkins NA, Lanahan AA, Worley PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "7857651", "url": "https://glygen.org/publication/PubMed/7857651" } ] }, { "title": "Lack of cyclin D-Cdk complexes in Rb-negative cells correlates with high levels of p16INK4/MTS1 tumour suppressor gene product.", "journal": "The EMBO journal", "date": "1995", "authors": "Parry D, Bates S, Mann DJ, Peters G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "7859739", "url": "https://glygen.org/publication/PubMed/7859739" } ] }, { "title": "The neuron-restrictive silencer factor (NRSF): a coordinate repressor of multiple neuron-specific genes.", "journal": "Science (New York, N.Y.)", "date": "1995", "authors": "Schoenherr CJ, Anderson DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "7871435", "url": "https://glygen.org/publication/PubMed/7871435" } ] }, { "title": "Characterization of Rad, a new member of Ras/GTPase superfamily, and its regulation by a unique GTPase-activating protein (GAP)-like activity.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Zhu J, Reynet C, Caldwell JS, Kahn CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "7876254", "url": "https://glygen.org/publication/PubMed/7876254" } ] }, { "title": "ERK phosphorylation potentiates Elk-1-mediated ternary complex formation and transactivation.", "journal": "The EMBO journal", "date": "1995", "authors": "Gille H, Kortenjann M, Thomae O, Moomaw C, Slaughter C, Cobb MH, Shaw PE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "7889942", "url": "https://glygen.org/publication/PubMed/7889942" } ] }, { "title": "Transcriptional regulation of the junB promoter: analysis of STAT-mediated signal transduction.", "journal": "Oncogene", "date": "1995", "authors": "Coffer P, Lutticken C, van Puijenbroek A, Klop-de Jonge M, Horn F, Kruijer W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7898939", "url": "https://glygen.org/publication/PubMed/7898939" } ] }, { "title": "Interleukin 13, an interleukin 4-like cytokine that acts on monocytes and B cells, but not on T cells.", "journal": "Immunology today", "date": "1994", "authors": "Zurawski G, de Vries JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7907877", "url": "https://glygen.org/publication/PubMed/7907877" } ] }, { "title": "Deficient long-term memory in mice with a targeted mutation of the cAMP-responsive element-binding protein.", "journal": "Cell", "date": "1994", "authors": "Bourtchuladze R, Frenguelli B, Blendy J, Cioffi D, Schutz G, Silva AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "7923378", "url": "https://glygen.org/publication/PubMed/7923378" } ] }, { "title": "Characterization of the proximal estrogen-responsive element of human cathepsin D gene.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1994", "authors": "Augereau P, Miralles F, Cavailles V, Gaudelet C, Parker M, Rochefort H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "7935485", "url": "https://glygen.org/publication/PubMed/7935485" } ] }, { "title": "Interaction of proteins with transcriptionally active estrogen receptors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Cavailles V, Dauvois S, Danielian PS, Parker MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "7937828", "url": "https://glygen.org/publication/PubMed/7937828" } ] }, { "title": "Activation of stress-activated protein kinase by MEKK1 phosphorylation of its activator SEK1.", "journal": "Nature", "date": "1994", "authors": "Yan M, Dai T, Deak JC, Kyriakis JM, Zon LI, Woodgett JR, Templeton DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "7997270", "url": "https://glygen.org/publication/PubMed/7997270" } ] }, { "title": "Growth suppression by p18, a p16INK4/MTS1- and p14INK4B/MTS2-related CDK6 inhibitor, correlates with wild-type pRb function.", "journal": "Genes & development", "date": "1994", "authors": "Guan KL, Jenkins CW, Li Y, Nichols MA, Wu X, O'Keefe CL, Matera AG, Xiong Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8001816", "url": "https://glygen.org/publication/PubMed/8001816" } ] }, { "title": "c-Fos transcriptional activity stimulated by H-Ras-activated protein kinase distinct from JNK and ERK.", "journal": "Nature", "date": "1994", "authors": "Deng T, Karin M", "evidence": [ { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" } ], "reference": [ { "type": "PubMed", "id": "8072547", "url": "https://glygen.org/publication/PubMed/8072547" } ] }, { "title": "p15INK4B is a potential effector of TGF-beta-induced cell cycle arrest.", "journal": "Nature", "date": "1994", "authors": "Hannon GJ, Beach D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8078588", "url": "https://glygen.org/publication/PubMed/8078588" } ] }, { "title": "An interleukin-4-induced transcription factor: IL-4 Stat.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Hou J, Schindler U, Henzel WJ, Ho TC, Brasseur M, McKnight SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8085155", "url": "https://glygen.org/publication/PubMed/8085155" } ] }, { "title": "p35 is a neural-specific regulatory subunit of cyclin-dependent kinase 5.", "journal": "Nature", "date": "1994", "authors": "Tsai LH, Delalle I, Caviness VS Jr, Chae T, Harlow E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "8090221", "url": "https://glygen.org/publication/PubMed/8090221" } ] }, { "title": "A brain-specific activator of cyclin-dependent kinase 5.", "journal": "Nature", "date": "1994", "authors": "Lew J, Huang QQ, Qi Z, Winkfein RJ, Aebersold R, Hunt T, Wang JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "8090222", "url": "https://glygen.org/publication/PubMed/8090222" } ] }, { "title": "Estrogen receptor-Sp1 complexes mediate estrogen-induced cathepsin D gene expression in MCF-7 human breast cancer cells.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Krishnan V, Wang X, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8195246", "url": "https://glygen.org/publication/PubMed/8195246" } ] }, { "title": "Estrogen receptor-associated proteins: possible mediators of hormone-induced transcription.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Halachmi S, Marden E, Martin G, MacKay H, Abbondanza C, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8197458", "url": "https://glygen.org/publication/PubMed/8197458" } ] }, { "title": "Transcription factors NF-IL6 and NF-kappa B synergistically activate transcription of the inflammatory cytokines, interleukin 6 and interleukin 8.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Matsusaka T, Fujikawa K, Nishio Y, Mukaida N, Matsushima K, Kishimoto T, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8234276", "url": "https://glygen.org/publication/PubMed/8234276" } ] }, { "title": "Phosphorylation of the c-Fos transrepression domain by mitogen-activated protein kinase and 90-kDa ribosomal S6 kinase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Chen RH, Abate C, Blenis J", "evidence": [ { "database": "iPTMnet", "id": "P01100-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100-1" } ], "reference": [ { "type": "PubMed", "id": "8248197", "url": "https://glygen.org/publication/PubMed/8248197" } ] }, { "title": "Rad: a member of the Ras family overexpressed in muscle of type II diabetic humans.", "journal": "Science (New York, N.Y.)", "date": "1993", "authors": "Reynet C, Kahn CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "8248782", "url": "https://glygen.org/publication/PubMed/8248782" } ] }, { "title": "A new regulatory motif in cell-cycle control causing specific inhibition of cyclin D/CDK4.", "journal": "Nature", "date": "1993", "authors": "Serrano M, Hannon GJ, Beach D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8259215", "url": "https://glygen.org/publication/PubMed/8259215" } ] }, { "title": "The p53-mdm-2 autoregulatory feedback loop.", "journal": "Genes & development", "date": "1993", "authors": "Wu X, Bayle JH, Olson D, Levine AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8319905", "url": "https://glygen.org/publication/PubMed/8319905" } ] }, { "title": "Phosphorylation at threonine-235 by a ras-dependent mitogen-activated protein kinase cascade is essential for transcription factor NF-IL6.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Nakajima T, Kinoshita S, Sasagawa T, Sasaki K, Naruto M, Kishimoto T, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8384717", "url": "https://glygen.org/publication/PubMed/8384717" } ] }, { "title": "The SRF accessory protein Elk-1 contains a growth factor-regulated transcriptional activation domain.", "journal": "Cell", "date": "1993", "authors": "Marais R, Wynne J, Treisman R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "8386592", "url": "https://glygen.org/publication/PubMed/8386592" } ] }, { "title": "NF-kappa B subunit-specific regulation of the interleukin-8 promoter.", "journal": "Molecular and cellular biology", "date": "1993", "authors": "Kunsch C, Rosen CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8413215", "url": "https://glygen.org/publication/PubMed/8413215" } ] }, { "title": "Transcriptional activity of the zinc finger protein NGFI-A is influenced by its interaction with a cellular factor.", "journal": "Molecular and cellular biology", "date": "1993", "authors": "Russo MW, Matheny C, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "8413279", "url": "https://glygen.org/publication/PubMed/8413279" } ] }, { "title": "Distinct mechanisms for regulation of the interleukin-8 gene involve synergism and cooperativity between C/EBP and NF-kappa B.", "journal": "Molecular and cellular biology", "date": "1993", "authors": "Stein B, Baldwin AS Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8413306", "url": "https://glygen.org/publication/PubMed/8413306" } ] }, { "title": "Cathepsin D gene is controlled by a mixed promoter, and estrogens stimulate only TATA-dependent transcription in breast cancer cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Cavailles V, Augereau P, Rochefort H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8419924", "url": "https://glygen.org/publication/PubMed/8419924" } ] }, { "title": "Nerve growth factor induces transcription of NGFIA through complex regulatory elements that are also sensitive to serum and phorbol 12-myristate 13-acetate.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1993", "authors": "DeFranco C, Damon DH, Endoh M, Wagner JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "8483478", "url": "https://glygen.org/publication/PubMed/8483478" } ] }, { "title": "Human Sos1: a guanine nucleotide exchange factor for Ras that binds to GRB2.", "journal": "Science (New York, N.Y.)", "date": "1993", "authors": "Chardin P, Camonis JH, Gale NW, van Aelst L, Schlessinger J, Wigler MH, Bar-Sagi D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "8493579", "url": "https://glygen.org/publication/PubMed/8493579" } ] }, { "title": "Transcriptional regulation of the tissue factor gene in human epithelial cells is mediated by Sp1 and EGR-1.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Cui MZ, Parry GC, Oeth P, Larson H, Smith M, Huang RP, Adamson ED, Mackman N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "8576248", "url": "https://glygen.org/publication/PubMed/8576248" } ] }, { "title": "Increased expression of early growth response-1 messenger ribonucleic acid in prostatic adenocarcinoma.", "journal": "The Journal of urology", "date": "1996", "authors": "Thigpen AE, Cala KM, Guileyardo JM, Molberg KH, McConnell JD, Russell DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "8583621", "url": "https://glygen.org/publication/PubMed/8583621" } ] }, { "title": "Essential role of Stat6 in IL-4 signalling.", "journal": "Nature", "date": "1996", "authors": "Takeda K, Tanaka T, Shi W, Matsumoto M, Minami M, Kashiwamura S, Nakanishi K, Yoshida N, Kishimoto T, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8602263", "url": "https://glygen.org/publication/PubMed/8602263" } ] }, { "title": "Interleukin-1 alpha activates an NF-kappaB-like factor in osteoclast-like cells.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Jimi E, Ikebe T, Takahashi N, Hirata M, Suda T, Koga T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8617720", "url": "https://glygen.org/publication/PubMed/8617720" } ] }, { "title": "STAT3 participates in transcriptional activation of the C-reactive protein gene by interleukin-6.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Zhang D, Sun M, Samols D, Kushner I", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8621622", "url": "https://glygen.org/publication/PubMed/8621622" } ] }, { "title": "MKK3- and MKK6-regulated gene expression is mediated by the p38 mitogen-activated protein kinase signal transduction pathway.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Raingeaud J, Whitmarsh AJ, Barrett T, Derijard B, Davis RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8622669", "url": "https://glygen.org/publication/PubMed/8622669" } ] }, { "title": "3pK, a new mitogen-activated protein kinase-activated protein kinase located in the small cell lung cancer tumor suppressor gene region.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Sithanandam G, Latif F, Duh FM, Bernal R, Smola U, Li H, Kuzmin I, Wixler V, Geil L, Shrestha S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8622688", "url": "https://glygen.org/publication/PubMed/8622688" } ] }, { "title": "Identification of mitogen-activated protein (MAP) kinase-activated protein kinase-3, a novel substrate of CSBP p38 MAP kinase.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "McLaughlin MM, Kumar S, McDonnell PC, Van Horn S, Lee JC, Livi GP, Young PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8626550", "url": "https://glygen.org/publication/PubMed/8626550" } ] }, { "title": "Tyrosine kinase/p21ras/MAP-kinase pathway activation by estradiol-receptor complex in MCF-7 cells.", "journal": "The EMBO journal", "date": "1996", "authors": "Migliaccio A, Di Domenico M, Castoria G, de Falco A, Bontempo P, Nola E, Auricchio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "8635462", "url": "https://glygen.org/publication/PubMed/8635462" } ] }, { "title": "Cloning and characterization of a specific interleukin (IL)-13 binding protein structurally related to the IL-5 receptor alpha chain.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Caput D, Laurent P, Kaghad M, Lelias JM, Lefort S, Vita N, Ferrara P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8663118", "url": "https://glygen.org/publication/PubMed/8663118" } ] }, { "title": "Syk-dependent phosphorylation of Shc. A potential link between FcepsilonRI and the Ras/mitogen-activated protein kinase signaling pathway through SOS and Grb2.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Jabril-Cuenod B, Zhang C, Scharenberg AM, Paolini R, Numerof R, Beaven MA, Kinet JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "8663278", "url": "https://glygen.org/publication/PubMed/8663278" } ] }, { "title": "The lipopolysaccharide-binding protein is a secretory class 1 acute-phase protein whose gene is transcriptionally activated by APRF/STAT/3 and other cytokine-inducible nuclear proteins.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Schumann RR, Kirschning CJ, Unbehaun A, Aberle HP, Knope HP, Lamping N, Ulevitch RJ, Herrmann F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8668165", "url": "https://glygen.org/publication/PubMed/8668165" } ] }, { "title": "NAB2, a corepressor of NGFI-A (Egr-1) and Krox20, is induced by proliferative and differentiative stimuli.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Svaren J, Sevetson BR, Apel ED, Zimonjic DB, Popescu NC, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "8668170", "url": "https://glygen.org/publication/PubMed/8668170" } ] }, { "title": "Vav and SLP-76 interact and functionally cooperate in IL-2 gene activation.", "journal": "Immunity", "date": "1996", "authors": "Wu J, Motto DG, Koretzky GA, Weiss A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "8673706", "url": "https://glygen.org/publication/PubMed/8673706" } ] }, { "title": "The transcription factor AP-1 binds to the human interleukin 1 alpha promoter.", "journal": "European cytokine network", "date": "1996", "authors": "Bailly S, Fay M, Israel N, Gougerot-Pocidalo MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8688489", "url": "https://glygen.org/publication/PubMed/8688489" } ] }, { "title": "Phosphorylation of SLP-76 by the ZAP-70 protein-tyrosine kinase is required for T-cell receptor function.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Bubeck Wardenburg J, Fu C, Jackman JK, Flotow H, Wilkinson SE, Williams DH, Johnson R, Kong G, Chan AC, Findell PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "8702662", "url": "https://glygen.org/publication/PubMed/8702662" } ] }, { "title": "Isolation and characterization of p19INK4d, a p16-related inhibitor specific to CDK6 and CDK4.", "journal": "Molecular biology of the cell", "date": "1996", "authors": "Guan KL, Jenkins CW, Li Y, O'Keefe CL, Noh S, Wu X, Zariwala M, Matera AG, Xiong Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8741839", "url": "https://glygen.org/publication/PubMed/8741839" } ] }, { "title": "Activation of codependent transcription factors is required for transcriptional induction of the vgf gene by nerve growth factor and Ras.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "D'Arcangelo G, Habas R, Wang S, Halegoua S, Salton SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "8756618", "url": "https://glygen.org/publication/PubMed/8756618" } ] }, { "title": "A comparison of the substrate specificity of MAPKAP kinase-2 and MAPKAP kinase-3 and their activation by cytokines and cellular stress.", "journal": "FEBS letters", "date": "1996", "authors": "Clifton AD, Young PR, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8774846", "url": "https://glygen.org/publication/PubMed/8774846" } ] }, { "title": "Global and local determinants for the kinetics of interleukin-4/interleukin-4 receptor alpha chain interaction. A biosensor study employing recombinant interleukin-4-binding protein.", "journal": "European journal of biochemistry", "date": "1996", "authors": "Shen BJ, Hage T, Sebald W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8797861", "url": "https://glygen.org/publication/PubMed/8797861" } ] }, { "title": "Requirements for interleukin-4-induced gene expression and functional characterization of Stat6.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Mikita T, Campbell D, Wu P, Williamson K, Schindler U", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8816495", "url": "https://glygen.org/publication/PubMed/8816495" } ] }, { "title": "Identification of novel phosphorylation sites required for activation of MAPKAP kinase-2.", "journal": "The EMBO journal", "date": "1995", "authors": "Ben-Levy R, Leighton IA, Doza YN, Attwood P, Morrice N, Marshall CJ, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8846784", "url": "https://glygen.org/publication/PubMed/8846784" } ] }, { "title": "The cdk5/p35 kinase is essential for neurite outgrowth during neuronal differentiation.", "journal": "Genes & development", "date": "1996", "authors": "Nikolic M, Dudek H, Kwon YT, Ramos YF, Tsai LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "8846918", "url": "https://glygen.org/publication/PubMed/8846918" } ] }, { "title": "p300 is a component of an estrogen receptor coactivator complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Hanstein B, Eckner R, DiRenzo J, Halachmi S, Liu H, Searcy B, Kurokawa R, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8876171", "url": "https://glygen.org/publication/PubMed/8876171" } ] }, { "title": "Dermatotoxic chemical stimulate of c-jun and c-fos transcription and AP-1 DNA binding in human keratinocytes.", "journal": "Research communications in molecular pathology and pharmacology", "date": "1996", "authors": "Burleson FG, Simeonova PP, Germolec DR, Luster MI", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8884985", "url": "https://glygen.org/publication/PubMed/8884985" } ] }, { "title": "The transcription factors SCIP and Krox-20 mark distinct stages and cell fates in Schwann cell differentiation.", "journal": "Molecular and cellular neurosciences", "date": "1996", "authors": "Zorick TS, Syroid DE, Arroyo E, Scherer SS, Lemke G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "8918830", "url": "https://glygen.org/publication/PubMed/8918830" } ] }, { "title": "An AP-1 site is involved in the NGF induction of IL-1 alpha in PC12 cells.", "journal": "Neurochemistry international", "date": "1996", "authors": "Alheim K, McDowell TL, Symons JA, Duff GW, Bartfai T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8939459", "url": "https://glygen.org/publication/PubMed/8939459" } ] }, { "title": "Induction of apoptosis by ASK1, a mammalian MAPKKK that activates SAPK/JNK and p38 signaling pathways.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Ichijo H, Nishida E, Irie K, ten Dijke P, Saitoh M, Moriguchi T, Takagi M, Matsumoto K, Miyazono K, Gotoh Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8974401", "url": "https://glygen.org/publication/PubMed/8974401" } ] }, { "title": "Functional and physical interactions of Syk family kinases with the Vav proto-oncogene product.", "journal": "Immunity", "date": "1996", "authors": "Deckert M, Tartare-Deckert S, Couture C, Mustelin T, Altman A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "8986718", "url": "https://glygen.org/publication/PubMed/8986718" } ] }, { "title": "SLP-76 is a substrate of the high affinity IgE receptor-stimulated protein tyrosine kinases in rat basophilic leukemia cells.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Hendricks-Taylor LR, Motto DG, Zhang J, Siraganian RP, Koretzky GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "8995445", "url": "https://glygen.org/publication/PubMed/8995445" } ] }, { "title": "Cloning of the human IL-13R alpha1 chain and reconstitution with the IL4R alpha of a functional IL-4/IL-13 receptor complex.", "journal": "FEBS letters", "date": "1997", "authors": "Miloux B, Laurent P, Bonnin O, Lupker J, Caput D, Vita N, Ferrara P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9013879", "url": "https://glygen.org/publication/PubMed/9013879" } ] }, { "title": "Regulatory mechanisms involved in activator-protein-1 (AP-1)-mediated activation of glutathione-S-transferase gene expression by chemical agents.", "journal": "European journal of biochemistry", "date": "1997", "authors": "Ainbinder E, Bergelson S, Pinkus R, Daniel V", "evidence": [ { "database": "Reactome", "id": "R-HSA-450341", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450341" } ], "reference": [ { "type": "PubMed", "id": "9030721", "url": "https://glygen.org/publication/PubMed/9030721" } ] }, { "title": "Interplay of the E box, the cyclic AMP response element, and HTF4/HEB in transcriptional regulation of the neurospecific, neurotrophin-inducible vgf gene.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Di Rocco G, Pennuto M, Illi B, Canu N, Filocamo G, Trani E, Rinaldi AM, Possenti R, Mandolesi G, Sirinian MI, Jucker R, Levi A, Nasi S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9032251", "url": "https://glygen.org/publication/PubMed/9032251" } ] }, { "title": "The subcellular locations of p15(Ink4b) and p27(Kip1) coordinate their inhibitory interactions with cdk4 and cdk2.", "journal": "Genes & development", "date": "1997", "authors": "Reynisdottir I, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "9042862", "url": "https://glygen.org/publication/PubMed/9042862" } ] }, { "title": "p53 activates Fanconi anemia group C gene expression.", "journal": "Human molecular genetics", "date": "1997", "authors": "Liebetrau W, Budde A, Savoia A, Grummt F, Hoehn H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "9063748", "url": "https://glygen.org/publication/PubMed/9063748" } ] }, { "title": "Molecular cloning and characterization of the human VGF promoter region.", "journal": "Journal of neurochemistry", "date": "1997", "authors": "Canu N, Possenti R, Rinaldi AM, Trani E, Levi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9084409", "url": "https://glygen.org/publication/PubMed/9084409" } ] }, { "title": "Tyrosine phosphorylation of the vav proto-oncogene product links FcepsilonRI to the Rac1-JNK pathway.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Teramoto H, Salem P, Robbins KC, Bustelo XR, Gutkind JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "9099726", "url": "https://glygen.org/publication/PubMed/9099726" } ] }, { "title": "Characterization of the mitogen-activated protein kinase kinase 4 (MKK4)/c-Jun NH2-terminal kinase 1 and MKK3/p38 pathways regulated by MEK kinases 2 and 3. MEK kinase 3 activates MKK3 but does not cause activation of p38 kinase in vivo.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Deacon K, Blank JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9162092", "url": "https://glygen.org/publication/PubMed/9162092" } ] }, { "title": "A novel mechanism of JNK1 activation. Nuclear translocation and activation of JNK1 during ischemia and reperfusion.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Mizukami Y, Yoshioka K, Morimoto S, Yoshida Ki", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9195981", "url": "https://glygen.org/publication/PubMed/9195981" } ] }, { "title": "Ras links growth factor signaling to the cell cycle machinery via regulation of cyclin D1 and the Cdk inhibitor p27KIP1.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Aktas H, Cai H, Cooper GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "9199319", "url": "https://glygen.org/publication/PubMed/9199319" } ] }, { "title": "Shc contains two Grb2 binding sites needed for efficient formation of complexes with SOS in B lymphocytes.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Harmer SL, DeFranco AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "9199344", "url": "https://glygen.org/publication/PubMed/9199344" } ] }, { "title": "Identification of a functional imperfect estrogen-responsive element in the 5'-promoter region of the human cathepsin D gene.", "journal": "Biochemistry", "date": "1997", "authors": "Wang F, Porter W, Xing W, Archer TK, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9201922", "url": "https://glygen.org/publication/PubMed/9201922" } ] }, { "title": "Induction of p27Kip1 degradation and anchorage independence by Ras through the MAP kinase signaling pathway.", "journal": "Oncogene", "date": "1997", "authors": "Kawada M, Yamagoe S, Murakami Y, Suzuki K, Mizuno S, Uehara Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "9264403", "url": "https://glygen.org/publication/PubMed/9264403" } ] }, { "title": "Molecular basis of agonism and antagonism in the oestrogen receptor.", "journal": "Nature", "date": "1997", "authors": "Brzozowski AM, Pike AC, Dauter Z, Hubbard RE, Bonn T, Engstrom O, Ohman L, Greene GL, Gustafsson JA, Carlquist M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9338790", "url": "https://glygen.org/publication/PubMed/9338790" } ] }, { "title": "Role of cyclins in neuronal differentiation of immortalized hippocampal cells.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Xiong W, Pestell R, Rosner MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9343422", "url": "https://glygen.org/publication/PubMed/9343422" } ] }, { "title": "Nucleosome positioning and transcription-associated chromatin alterations on the human estrogen-responsive pS2 promoter.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Sewack GF, Hansen U", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9388265", "url": "https://glygen.org/publication/PubMed/9388265" } ] }, { "title": "CREB: a major mediator of neuronal neurotrophin responses.", "journal": "Neuron", "date": "1997", "authors": "Finkbeiner S, Tavazoie SF, Maloratsky A, Jacobs KM, Harris KM, Greenberg ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9390517", "url": "https://glygen.org/publication/PubMed/9390517" } ] }, { "title": "Nab1, a corepressor of NGFI-A (Egr-1), contains an active transcriptional repression domain.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Swirnoff AH, Apel ED, Svaren J, Sevetson BR, Zimonjic DB, Popescu NC, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9418898", "url": "https://glygen.org/publication/PubMed/9418898" } ] }, { "title": "Assembly of cyclin D-dependent kinase and titration of p27Kip1 regulated by mitogen-activated protein kinase kinase (MEK1).", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Cheng M, Sexl V, Sherr CJ, Roussel MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "9448290", "url": "https://glygen.org/publication/PubMed/9448290" } ] }, { "title": "ARF promotes MDM2 degradation and stabilizes p53: ARF-INK4a locus deletion impairs both the Rb and p53 tumor suppression pathways.", "journal": "Cell", "date": "1998", "authors": "Zhang Y, Xiong Y, Yarbrough WG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9529249", "url": "https://glygen.org/publication/PubMed/9529249" } ] }, { "title": "Mammalian thioredoxin is a direct inhibitor of apoptosis signal-regulating kinase (ASK) 1.", "journal": "The EMBO journal", "date": "1998", "authors": "Saitoh M, Nishitoh H, Fujii M, Takeda K, Tobiume K, Sawada Y, Kawabata M, Miyazono K, Ichijo H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9564042", "url": "https://glygen.org/publication/PubMed/9564042" } ] }, { "title": "Functional and physical interactions between the estrogen receptor Sp1 and nuclear aryl hydrocarbon receptor complexes.", "journal": "Nucleic acids research", "date": "1998", "authors": "Wang F, Hoivik D, Pollenz R, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9611253", "url": "https://glygen.org/publication/PubMed/9611253" } ] }, { "title": "Expression of early growth response genes in human prostate cancer.", "journal": "Cancer research", "date": "1998", "authors": "Eid MA, Kumar MV, Iczkowski KA, Bostwick DG, Tindall DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9622090", "url": "https://glygen.org/publication/PubMed/9622090" } ] }, { "title": "PRAK, a novel protein kinase regulated by the p38 MAP kinase.", "journal": "The EMBO journal", "date": "1998", "authors": "New L, Jiang Y, Zhao M, Liu K, Zhu W, Flood LJ, Kato Y, Parry GC, Han J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9628874", "url": "https://glygen.org/publication/PubMed/9628874" } ] }, { "title": "Differential activation of stress-activated protein kinase kinases SKK4/MKK7 and SKK1/MKK4 by the mixed-lineage kinase-2 and mitogen-activated protein kinase kinase (MKK) kinase-1.", "journal": "The Biochemical journal", "date": "1998", "authors": "Cuenda A, Dorow DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "9639556", "url": "https://glygen.org/publication/PubMed/9639556" } ] }, { "title": "Mutational analysis of the STAT6 SH2 domain.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Mikita T, Daniel C, Wu P, Schindler U", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9651359", "url": "https://glygen.org/publication/PubMed/9651359" } ] }, { "title": "c-Myc or cyclin D1 mimics estrogen effects on cyclin E-Cdk2 activation and cell cycle reentry.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Prall OW, Rogan EM, Musgrove EA, Watts CK, Sutherland RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9671459", "url": "https://glygen.org/publication/PubMed/9671459" } ] }, { "title": "The transcriptional corepressor NAB2 inhibits NGF-induced differentiation of PC12 cells.", "journal": "The Journal of cell biology", "date": "1998", "authors": "Qu Z, Wolfraim LA, Svaren J, Ehrengruber MU, Davidson N, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9722618", "url": "https://glygen.org/publication/PubMed/9722618" } ] }, { "title": "The role of IL-13 and its receptor in allergy and inflammatory responses.", "journal": "The Journal of allergy and clinical immunology", "date": "1998", "authors": "de Vries JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9723655", "url": "https://glygen.org/publication/PubMed/9723655" } ] }, { "title": "Upstream stimulatory factors mediate estrogen receptor activation of the cathepsin D promoter.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1998", "authors": "Xing W, Archer TK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9731700", "url": "https://glygen.org/publication/PubMed/9731700" } ] }, { "title": "Smad3 and Smad4 cooperate with c-Jun/c-Fos to mediate TGF-beta-induced transcription.", "journal": "Nature", "date": "1998-08-27", "authors": "Zhang Y, Feng X H, Derynck R", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "reference": [ { "type": "PubMed", "id": "9732876", "url": "https://glygen.org/publication/PubMed/9732876" } ] }, { "title": "Interferon-gamma-induced factor binding to the interleukin-4-responsive element of CD23b promoter in human tonsillar mononuclear cells: role in transient up-regulation of the interleukin-4-induced CD23b mRNA.", "journal": "Molecular immunology", "date": "1998", "authors": "Park HJ, So EY, Lee CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9736340", "url": "https://glygen.org/publication/PubMed/9736340" } ] }, { "title": "Nuclear export of the stress-activated protein kinase p38 mediated by its substrate MAPKAP kinase-2.", "journal": "Current biology : CB", "date": "1998", "authors": "Ben-Levy R, Hooper S, Wilson R, Paterson HF, Marshall CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9768359", "url": "https://glygen.org/publication/PubMed/9768359" } ] }, { "title": "Rsk-2 activity is necessary for epidermal growth factor-induced phosphorylation of CREB protein and transcription of c-fos gene.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "De Cesare D, Jacquot S, Hanauer A, Sassone-Corsi P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9770464", "url": "https://glygen.org/publication/PubMed/9770464" } ] }, { "title": "Novel mutants of NAB corepressors enhance activation by Egr transactivators.", "journal": "The EMBO journal", "date": "1998", "authors": "Svaren J, Sevetson BR, Golda T, Stanton JJ, Swirnoff AH, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9774344", "url": "https://glygen.org/publication/PubMed/9774344" } ] }, { "title": "Synaptic activation causes the mRNA for the IEG Arc to localize selectively near activated postsynaptic sites on dendrites.", "journal": "Neuron", "date": "1998", "authors": "Steward O, Wallace CS, Lyford GL, Worley PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9808461", "url": "https://glygen.org/publication/PubMed/9808461" } ] }, { "title": "Induction of 15-lipoxygenase expression by IL-13 requires tyrosine phosphorylation of Jak2 and Tyk2 in human monocytes.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Roy B, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9822675", "url": "https://glygen.org/publication/PubMed/9822675" } ] }, { "title": "Evidence for the participation of the neuron-specific CDK5 activator P35 during laminin-enhanced axonal growth.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "1998", "authors": "Paglini G, Pigino G, Kunda P, Morfini G, Maccioni R, Quiroga S, Ferreira A, Caceres A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9822744", "url": "https://glygen.org/publication/PubMed/9822744" } ] }, { "title": "Mdm2 association with p53 targets its ubiquitination.", "journal": "Oncogene", "date": "1998", "authors": "Fuchs SY, Adler V, Buschmann T, Wu X, Ronai Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9824166", "url": "https://glygen.org/publication/PubMed/9824166" } ] }, { "title": "Inducible and constitutive transcription factors in the mammalian nervous system: control of gene expression by Jun, Fos and Krox, and CREB/ATF proteins.", "journal": "Brain research. Brain research reviews", "date": "1998", "authors": "Herdegen T, Leah JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9858769", "url": "https://glygen.org/publication/PubMed/9858769" } ] }, { "title": "STAT3 is required for the gp130-mediated full activation of the c-myc gene.", "journal": "The Journal of experimental medicine", "date": "1999", "authors": "Kiuchi N, Nakajima K, Ichiba M, Fukada T, Narimatsu M, Mizuno K, Hibi M, Hirano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9874564", "url": "https://glygen.org/publication/PubMed/9874564" } ] }, { "title": "Transcription factor phosphorylation by pp90(rsk2). Identification of Fos kinase and NGFI-B kinase I as pp90(rsk2).", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Swanson KD, Taylor LK, Haung L, Burlingame AL, Landreth GE", "evidence": [ { "database": "iPTMnet", "id": "P01100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01100" } ], "reference": [ { "type": "PubMed", "id": "9920881", "url": "https://glygen.org/publication/PubMed/9920881" } ] }, { "title": "Mechanism of activation of Pak1 kinase by membrane localization.", "journal": "Oncogene", "date": "1999", "authors": "Lu W, Mayer BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "9989831", "url": "https://glygen.org/publication/PubMed/9989831" } ] } ], "pathway": [ { "id": "hsa:2353", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2353", "resource": "KEGG Pathway" }, { "id": "R-HSA-2559580", "name": "Oxidative Stress Induced Senescence", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580", "resource": "Reactome", "description": "Oxidative Stress Induced Senescence" }, { "id": "R-HSA-2559582", "name": "Senescence-Associated Secretory Phenotype (SASP)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582", "resource": "Reactome", "description": "Senescence-Associated Secretory Phenotype (SASP)" }, { "id": "R-HSA-2871796", "name": "FCERI mediated MAPK activation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796", "resource": "Reactome", "description": "FCERI mediated MAPK activation" }, { "id": "R-HSA-450341", "name": "Activation of the AP-1 family of transcription factors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450341", "resource": "Reactome", "description": "Activation of the AP-1 family of transcription factors" }, { "id": "R-HSA-6785807", "name": "Interleukin-4 and Interleukin-13 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807", "resource": "Reactome", "description": "Interleukin-4 and Interleukin-13 signaling" }, { "id": "R-HSA-6796648", "name": "TP53 Regulates Transcription of DNA Repair Genes", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648", "resource": "Reactome", "description": "TP53 Regulates Transcription of DNA Repair Genes" }, { "id": "R-HSA-9018519", "name": "Estrogen-dependent gene expression", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519", "resource": "Reactome", "description": "Estrogen-dependent gene expression" }, { "id": "R-HSA-9031628", "name": "NGF-stimulated transcription", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628", "resource": "Reactome", "description": "NGF-stimulated transcription" }, { "id": "R-HSA-9634638", "name": "Estrogen-dependent nuclear events downstream of ESR-membrane signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638", "resource": "Reactome", "description": "Estrogen-dependent nuclear events downstream of ESR-membrane signaling" }, { "id": "R-HSA-9768919", "name": "NPAS4 regulates expression of target genes", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9768919", "resource": "Reactome", "description": "NPAS4 regulates expression of target genes" } ], "orthologs": [ { "uniprot_canonical_ac": "P01101-1", "protein_name": "Protein c-Fos", "gene_name": "Fos", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNTQDFCADLSVSSANFIPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGLPTQSAGAYARAGMVKTVSGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEASTPESEEAFTLPLLNDPEPKPSLEPVKSISNVELKAEPFDDFLFPASSRPSGSETSRSVPDVDLSGSFYAADWEPLHSNSLGMGPMVTELEPLCTPVVTCTPGCTTYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL", "length": 380 }, "evidence": [ { "id": "45920427", "url": "http://www.informatics.jax.org/homology/45920427", "database": "MGI" }, { "id": "P01100", "url": "https://omabrowser.org/oma/group/P01100/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P12841-1", "protein_name": "Protein c-Fos", "gene_name": "Fos", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNTQDFCADLSVSSANFIPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGLPTPSTGAYARAGVVKTMSGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPNDLGFPEEMSVTSLDLTGGLPEATTPESEEAFTLPLLNDPEPKPSLEPVKNISNMELKAEPFDDFLFPASSRPSGSETARSVPDVDLSGSFYAADWEPLHSSSLGMGPMVTELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL", "length": 380 }, "evidence": [ { "id": "45920427", "url": "http://www.informatics.jax.org/homology/45920427", "database": "MGI" }, { "id": "P01100", "url": "https://omabrowser.org/oma/group/P01100/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 42, "go_terms": [ { "name": "osteoclast differentiation", "id": "GO:0030316", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030316", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "inflammatory response", "id": "GO:0006954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "nervous system development", "id": "GO:0007399", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007399", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "response to lipopolysaccharide", "id": "GO:0032496", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032496", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "response to ethanol", "id": "GO:0045471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045471", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "transforming growth factor beta receptor signaling pathway", "id": "GO:0007179", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007179", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "cellular response to calcium ion", "id": "GO:0071277", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071277", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "cellular response to hypoxia", "id": "GO:0071456", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071456", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "female pregnancy", "id": "GO:0007565", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007565", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "response to progesterone", "id": "GO:0032570", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032570", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "response to toxic substance", "id": "GO:0009636", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009636", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "response to insulin", "id": "GO:0032868", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032868", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "SMAD protein signal transduction", "id": "GO:0060395", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060395", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "response to activity", "id": "GO:0014823", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014823", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "conditioned taste aversion", "id": "GO:0001661", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001661", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "transcription by RNA polymerase II", "id": "GO:0006366", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006366", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "response to muscle stretch", "id": "GO:0035994", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035994", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "response to corticosterone", "id": "GO:0051412", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051412", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "response to cAMP", "id": "GO:0051591", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051591", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "skeletal muscle cell differentiation", "id": "GO:0035914", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035914", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "response to xenobiotic stimulus", "id": "GO:0009410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009410", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "cellular response to reactive oxygen species", "id": "GO:0034614", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034614", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "cellular response to cadmium ion", "id": "GO:0071276", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071276", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "cellular response to tumor necrosis factor", "id": "GO:0071356", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071356", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "cellular response to epidermal growth factor stimulus", "id": "GO:0071364", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071364", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "response to light stimulus", "id": "GO:0009416", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009416", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "response to immobilization stress", "id": "GO:0035902", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035902", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "DNA methylation", "id": "GO:0006306", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006306", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "cellular response to parathyroid hormone stimulus", "id": "GO:0071374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071374", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "cellular response to zinc ion starvation", "id": "GO:0034224", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034224", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "myoblast proliferation", "id": "GO:0051450", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051450", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "cellular response to phorbol 13-acetate 12-myristate", "id": "GO:1904628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904628", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "positive regulation of osteoclast differentiation", "id": "GO:0045672", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045672", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "positive regulation of miRNA transcription", "id": "GO:1902895", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902895", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "cellular response to prolactin", "id": "GO:1990646", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990646", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "response to gravity", "id": "GO:0009629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009629", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "skeletal muscle cell proliferation", "id": "GO:0014856", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014856", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "integrated stress response signaling", "id": "GO:0140467", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140467", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "mononuclear cell differentiation", "id": "GO:1903131", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903131", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 13, "go_terms": [ { "name": "chromatin binding", "id": "GO:0003682", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003682", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity", "id": "GO:0003700", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003700", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "transcription cis-regulatory region binding", "id": "GO:0000976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000976", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "RNA polymerase II core promoter sequence-specific DNA binding", "id": "GO:0000979", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000979", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "DNA-binding transcription activator activity, RNA polymerase II-specific", "id": "GO:0001228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001228", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "RNA polymerase II-specific DNA-binding transcription factor binding", "id": "GO:0061629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061629", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "R-SMAD binding", "id": "GO:0070412", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070412", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "transcription coregulator binding", "id": "GO:0001221", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001221", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "sequence-specific double-stranded DNA binding", "id": "GO:1990837", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990837", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 8, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "chromatin", "id": "GO:0000785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000785", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "protein-DNA complex", "id": "GO:0032993", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032993", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "RNA polymerase II transcription regulator complex", "id": "GO:0090575", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090575", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" }, { "name": "transcription factor AP-1 complex", "id": "GO:0035976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035976", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "Constitutively sumoylated with SUMO1, SUMO2 and SUMO3. Desumoylated by SENP2. Sumoylation requires heterodimerization with JUN and is enhanced by mitogen stimulation. Sumoylation inhibits the AP-1 transcriptional activity and is, itself, inhibited by Ras-activated phosphorylation on Thr-232.", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" }, { "database": "PubMed", "id": "17709345", "url": "https://glygen.org/publication/PubMed/17709345" }, { "database": "PubMed", "id": "16055710", "url": "https://glygen.org/publication/PubMed/16055710" } ] }, { "annotation": "In quiescent cells, the small amount of FOS present is phosphorylated at Tyr-10 and Tyr-30 by SRC. This Tyr-phosphorylated form is cytosolic. In growing cells, dephosphorylated by PTPN2. Dephosphorylation leads to the association with endoplasmic reticulum membranes and activation of phospholipid synthesis.", "evidence": [ { "database": "UniProtKB", "id": "P01100", "url": "https://www.uniprot.org/uniprot/P01100" }, { "database": "PubMed", "id": "22105363", "url": "https://glygen.org/publication/PubMed/22105363" }, { "database": "PubMed", "id": "17160021", "url": "https://glygen.org/publication/PubMed/17160021" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 56, 57, 83, 84, 88, 90, 278, 283 ], "snv_sites": [ 88, 90, 114, 143, 222, 258, 281, 362 ], "glycation_sites": [], "phosphorylation_sites": [ 10, 30, 32, 70, 114, 232, 325, 331, 362, 374 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 8 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 8 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 8 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 8 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 23 }, { "field": "total_sites", "count": 10 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 8 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 568 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }