{ "uniprot_canonical_ac": "P01042-1", "uniprot_ac": "P01042", "uniprot_id": "KNG1_HUMAN", "mass": { "chemical_mass": 71957.0, "monoisotopic_mass": 71957.0 }, "refseq": { "ac": "NP_000884", "name": "kininogen-1 isoform 2 precursor", "summary": "This gene uses alternative splicing to generate two different proteins- high molecular weight kininogen (HMWK) and low molecular weight kininogen (LMWK). HMWK is essential for blood coagulation and assembly of the kallikrein-kinin system. Also, bradykinin, a peptide causing numerous physiological effects, is released from HMWK. Bradykinin also functions as an antimicrobial peptide with antibacterial and antifungal activity. In contrast to HMWK, LMWK is not involved in blood coagulation. Infection with severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) reduces or depletes angiotensin converting enzyme 2 (ACE2), which results in an increase in levels of des-Arg(9)-bradykinin, a bioactive metabolite of bradykinin that is associated with lung injury and inflammation. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2020].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000884" }, "gene_names": [ { "name": "KNG1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P01042", "id": "P01042" }, { "name": "BDK; BK; HAE6; HK; HMWK; KNG", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000884", "id": "NP_000884" }, { "name": "BDK", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P01042", "id": "P01042" }, { "name": "KNG1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000884", "id": "NP_000884" }, { "name": "KNG", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P01042", "id": "P01042" } ], "protein_names": [ { "name": "Kininogen-1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P01042" }, { "name": "Alpha-2-thiol proteinase inhibitor", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01042" }, { "name": "Fitzgerald factor", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01042" }, { "name": "HMWK", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01042" }, { "name": "High molecular weight kininogen", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01042" }, { "name": "Ile-Ser-Bradykinin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01042" }, { "name": "Kallidin II", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01042" }, { "name": "Kallidin I", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01042" }, { "name": "Williams-Fitzgerald-Flaujeac factor", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01042" }, { "name": "alpha-2-thiol proteinase inhibitor; bradykinin; fitzgerald factor; high molecular weight kininogen; williams-Fitzgerald-Flaujeac factor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000884", "id": "NP_000884" }, { "name": "kininogen-1 isoform 2 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000884", "id": "NP_000884" } ], "function": [ { "annotation": "An HBV susceptibility variant of KNG1 modulates the therapeutic effects of interferons alpha and lambda1 in HBV infection by promoting MAVS lysosomal degradation.", "evidence": [ { "database": "RefSeq", "id": "NP_000884", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000884" }, { "database": "PubMed", "id": "37442062", "url": "https://glygen.org/publication/PubMed/37442062" } ] }, { "annotation": "Bradykinin receptor expression and bradykinin-mediated sensitization of human sensory neurons.", "evidence": [ { "database": "RefSeq", "id": "NP_000884", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000884" }, { "database": "PubMed", "id": "37703419", "url": "https://glygen.org/publication/PubMed/37703419" } ] }, { "annotation": "GC1qR Antibody Can Modulate Endothelial Cell Permeability in Angioedema.", "evidence": [ { "database": "RefSeq", "id": "NP_000884", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000884" }, { "database": "PubMed", "id": "34494203", "url": "https://glygen.org/publication/PubMed/34494203" } ] }, { "annotation": "High preoperative bradykinin level is a risk factor for severe postoperative hypoxaemia in acute aortic dissection surgery.", "evidence": [ { "database": "RefSeq", "id": "NP_000884", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000884" }, { "database": "PubMed", "id": "36934370", "url": "https://glygen.org/publication/PubMed/36934370" } ] }, { "annotation": "Kininogens are inhibitors of thiol proteases. HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII; HMW-kininogen inhibits the thrombin- and plasmin-induced aggregation of thrombocytes. LMW-kininogen inhibits the aggregation of thrombocytes. LMW-kininogen is in contrast to HMW-kininogen not involved in blood clotting.", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042#function" } ] }, { "annotation": "Plasmin-mediated cleavage of high-molecular-weight kininogen contributes to acetaminophen-induced acute liver failure.", "evidence": [ { "database": "RefSeq", "id": "NP_000884", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000884" }, { "database": "PubMed", "id": "33827130", "url": "https://glygen.org/publication/PubMed/33827130" } ] }, { "annotation": "The active peptide bradykinin is a potent vasodilatator that is released from HMW-kininogen shows a variety of physiological effects: (A) influence in smooth muscle contraction, (B) induction of hypotension, (C) natriuresis and diuresis, (D) decrease in blood glucose level, (E) it is a mediator of inflammation and causes (E1) increase in vascular permeability, (E2) stimulation of nociceptors (4E3) release of other mediators of inflammation (e.g. prostaglandins), (F) it has a cardioprotective effect (directly via bradykinin action, indirectly via endothelium-derived relaxing factor action).", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042#function" }, { "database": "PubMed", "id": "4322742", "url": "https://glygen.org/publication/PubMed/4322742" }, { "database": "PubMed", "id": "6055465", "url": "https://glygen.org/publication/PubMed/6055465" } ] }, { "annotation": "The antimicrobial protein kininogen evolved adaptively in mammals and human populations.", "evidence": [ { "database": "RefSeq", "id": "NP_000884", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000884" }, { "database": "PubMed", "id": "23505046", "url": "https://glygen.org/publication/PubMed/23505046" } ] }, { "annotation": "This gene uses alternative splicing to generate two different proteins- high molecular weight kininogen (HMWK) and low molecular weight kininogen (LMWK). HMWK is essential for blood coagulation and assembly of the kallikrein-kinin system. Also, bradykinin, a peptide causing numerous physiological effects, is released from HMWK. Bradykinin also functions as an antimicrobial peptide with antibacterial and antifungal activity. In contrast to HMWK, LMWK is not involved in blood coagulation. Infection with severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) reduces or depletes angiotensin converting enzyme 2 (ACE2), which results in an increase in levels of des-Arg(9)-bradykinin, a bioactive metabolite of bradykinin that is associated with lung injury and inflammation. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2020].", "evidence": [ { "database": "RefSeq", "id": "NP_000884", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000884" } ] } ], "disease": [ { "disease_id": "DOID:0111676", "recommended_name": { "id": "DOID:0111676", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111676", "name": "high molecular weight kininogen deficiency", "description": "A blood coagulation disease characterized by deficiency of high molecular weight kininogen but not of low molecular weight kininogen resulting in abnormal surface-mediated activation of fibrinolysis that has_material_basis_in homozygous or compound heterozygous mutation in the KNG1 gene on chromosome 3q27.3. Both high and low molecular weight kininogen are encoded by the KNG1 gene." }, "synonyms": [ { "id": "DOID:0111676", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111676", "name": "Fitzgerald trait", "description": "" }, { "id": "DOID:0111676", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111676", "name": "HMWK deficiency", "description": "" }, { "id": "DOID:0111676", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111676", "name": "congenital high-molecular-weight kininogen deficiency", "description": "" }, { "id": "MONDO:0009234", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009234", "name": "congenital high-molecular-weight kininogen deficiency", "description": "A rare autosomal recessive inherited disorder characterized by prolonged partial thromboplastin time and absence of bleeding diathesis." }, { "id": "MONDO:0009234", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009234", "name": "high molecular weight kininogen deficiency", "description": "" }, { "id": "MONDO:0009234", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009234", "name": "kininogen deficiency", "description": "" }, { "id": "MONDO:0009234", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009234", "name": "Fitzgerald trait", "description": "" }, { "id": "MONDO:0009234", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009234", "name": "Fitzgerald trait kininogen deficiency, total, included", "description": "" }, { "id": "MONDO:0009234", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009234", "name": "Flaujeac factor deficiency", "description": "" }, { "id": "MONDO:0009234", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009234", "name": "Flaujeac trait", "description": "" }, { "id": "MONDO:0009234", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009234", "name": "Flaujeac trait, included", "description": "" }, { "id": "MONDO:0009234", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009234", "name": "HMWK", "description": "" }, { "id": "MONDO:0009234", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009234", "name": "HMWK deficiency", "description": "" }, { "id": "MONDO:0009234", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009234", "name": "Williams trait", "description": "" }, { "id": "MONDO:0009234", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009234", "name": "Williams trait, included", "description": "" }, { "id": "MONDO:0009234", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009234", "name": "high-molecular-weight kininogen deficiency, congenital", "description": "" }, { "id": "MONDO:0009234", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009234", "name": "kininogen deficiency, high molecular weight", "description": "" }, { "id": "MONDO:0009234", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009234", "name": "kininogen deficiency, high molecular weight and LOW molecular weight, included", "description": "" }, { "id": "MONDO:0009234", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009234", "name": "kininogen deficiency, high molecular weight and Low molecular weight", "description": "" }, { "id": "MONDO:0009234", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009234", "name": "kininogen deficiency, total", "description": "" }, { "id": "MIM:228960", "resource": "MIM", "url": "https://www.omim.org/entry/228960", "name": "High molecular weight kininogen deficiency", "description": "High molecular weight kininogen deficiency" } ], "evidence": [ { "id": "228960", "database": "MIM", "url": "https://www.omim.org/entry/228960" } ] }, { "disease_id": "MONDO:0023660", "recommended_name": { "id": "MONDO:0023660", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023660", "name": "angioedema, hereditary, 6", "description": "" }, "synonyms": [ { "id": "MONDO:0023660", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023660", "name": "HAE6", "description": "" }, { "id": "MIM:619363", "resource": "MIM", "url": "https://www.omim.org/entry/619363", "name": "Angioedema, hereditary, 6", "description": "Angioedema, hereditary, 6" } ], "evidence": [ { "id": "619363", "database": "MIM", "url": "https://www.omim.org/entry/619363" } ] } ], "snv": [ { "evidence": [ { "id": "rs760595120", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760595120" }, { "id": "rs760595120", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760595120" }, { "id": "rs760595120", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760595120" }, { "id": "rs760595120", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs760595120" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 115, "end_pos": 115, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SST->NST).", "chr_id": "3", "chr_pos": "186722474", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S115", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs753145793", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753145793" }, { "id": "rs753145793", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753145793" }, { "id": "rs753145793", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs753145793" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 123, "end_pos": 123, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TQT->NQT).", "chr_id": "3", "chr_pos": "186722498", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T123", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1397645777", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1397645777" }, { "id": "rs1397645777", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1397645777" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 150, "end_pos": 150, "sequence_org": "S", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->L).", "chr_id": "3", "chr_pos": "186725145", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S150", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs377332435", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs377332435" }, { "id": "rs377332435", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs377332435" }, { "id": "rs377332435", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs377332435#frequency_tab" }, { "id": "rs377332435", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs377332435" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 151, "end_pos": 151, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->M).", "chr_id": "3", "chr_pos": "186725148", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T151", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs768936464", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768936464" }, { "id": "rs768936464", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768936464" }, { "id": "rs768936464", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768936464" }, { "id": "rs768936464", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768936464" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 205, "end_pos": 205, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->ICS).", "chr_id": "3", "chr_pos": "186727286", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N205", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs866243127", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs866243127" }, { "id": "rs866243127", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs866243127" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 207, "end_pos": 207, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->NCF).", "chr_id": "3", "chr_pos": "186727292", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S207", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs774171070", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774171070" }, { "id": "rs774171070", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774171070" }, { "id": "rs774171070", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs774171070#frequency_tab" }, { "id": "rs774171070", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs774171070" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 285, "end_pos": 285, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TIT->NIT).", "chr_id": "3", "chr_pos": "186732598", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T285", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs373838314", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373838314" }, { "id": "rs373838314", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373838314" }, { "id": "rs373838314", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs373838314#frequency_tab" }, { "id": "rs373838314", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs373838314" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 295, "end_pos": 295, "sequence_org": "A", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->NPT).", "chr_id": "3", "chr_pos": "186732627", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A295", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs373838314", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373838314" }, { "id": "rs373838314", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373838314" }, { "id": "rs373838314", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs373838314#frequency_tab" }, { "id": "rs373838314", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs373838314" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 295, "end_pos": 295, "sequence_org": "A", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NNA->NNS).", "chr_id": "3", "chr_pos": "186732627", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A295", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs373838314", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373838314" }, { "id": "rs373838314", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373838314" }, { "id": "rs373838314", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs373838314#frequency_tab" }, { "id": "rs373838314", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs373838314" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 295, "end_pos": 295, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NNA->NNT).", "chr_id": "3", "chr_pos": "186732627", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A295", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs3190568", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3190568" }, { "id": "rs3190568", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3190568" }, { "id": "rs3190568", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs3190568#frequency_tab" }, { "id": "rs3190568", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs3190568" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 400, "end_pos": 400, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "3", "chr_pos": "186741595", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T400", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs3190568", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3190568" }, { "id": "rs3190568", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3190568" }, { "id": "rs3190568", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs3190568#frequency_tab" }, { "id": "rs3190568", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs3190568" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 400, "end_pos": 400, "sequence_org": "T", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->K).", "chr_id": "3", "chr_pos": "186741595", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T400", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1401295926", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1401295926" }, { "id": "rs1401295926", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1401295926#frequency_tab" }, { "id": "rs1401295926", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1401295926" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 401, "end_pos": 401, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "3", "chr_pos": "186741598", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T401", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs752213099", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752213099" }, { "id": "rs752213099", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752213099" }, { "id": "rs752213099", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs752213099" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 48, "end_pos": 48, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "3", "chr_pos": "186717685", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N48", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs752213099", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752213099" }, { "id": "rs752213099", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752213099" }, { "id": "rs752213099", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs752213099" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 48, "end_pos": 48, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->TQS).", "chr_id": "3", "chr_pos": "186717685", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N48", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1157292917", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1157292917" }, { "id": "rs1157292917", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1157292917" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 48, "end_pos": 48, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->YQS).", "chr_id": "3", "chr_pos": "186717684", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N48", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1304912212", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1304912212" }, { "id": "rs1304912212", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1304912212" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 531, "end_pos": 531, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "3", "chr_pos": "186741987", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S531", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1477849508", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1477849508" }, { "id": "rs1477849508", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1477849508" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 532, "end_pos": 532, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->N).", "chr_id": "3", "chr_pos": "186741991", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T532", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1388846154", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1388846154" }, { "id": "rs1388846154", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1388846154#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 533, "end_pos": 533, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "3", "chr_pos": "186741994", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T533", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1297802569", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1297802569" }, { "id": "rs1297802569", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1297802569" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 546, "end_pos": 546, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "3", "chr_pos": "186742033", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T546", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1245497128", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1245497128" }, { "id": "rs1245497128", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1245497128" }, { "id": "rs1245497128", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1245497128" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 557, "end_pos": 557, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "3", "chr_pos": "186742066", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T557", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs773502813", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773502813" }, { "id": "rs773502813", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773502813" }, { "id": "rs773502813", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773502813" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 571, "end_pos": 571, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "3", "chr_pos": "186742108", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T571", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs773502813", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773502813" }, { "id": "rs773502813", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773502813" }, { "id": "rs773502813", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773502813" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 571, "end_pos": 571, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->N).", "chr_id": "3", "chr_pos": "186742108", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T571", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs748908879", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748908879" }, { "id": "rs748908879", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs748908879" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 628, "end_pos": 628, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "3", "chr_pos": "186742279", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T628", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs376740037", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs376740037" }, { "id": "rs376740037", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs376740037" }, { "id": "rs376740037", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs376740037" }, { "id": "rs376740037", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs376740037#frequency_tab" }, { "id": "rs376740037", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs376740037" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 638, "end_pos": 638, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DLT->NLT).", "chr_id": "3", "chr_pos": "186742308", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D638", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "93.12", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000113889", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113889" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "41.27", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000113889", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113889" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "45.11", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000113889", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113889" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000113889", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113889" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "57.9", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000113889", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113889" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "67.58", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000113889", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113889" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000113889", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113889" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "39.98", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000113889", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113889" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "33.9", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000113889", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113889" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000113889", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113889" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "99.68", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000113889", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113889" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "39.04", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000113889", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113889" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "33.19", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000113889", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113889" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P01042", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01042" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P01042", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01042" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P01042", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01042" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P01042", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01042" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P01042", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01042" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P01042", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01042" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P01042", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01042" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P01042", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01042" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P01042", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01042" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P01042", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01042" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P01042", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01042" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P01042", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01042" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "common_name": "Human" } ], "gene": [ { "name": "KNG1", "url": "https://www.uniprot.org/uniprot/P01042", "locus": { "chromosome": "3", "start_pos": 32102, "end_pos": 5051, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "LRG_598", "url": "https://www.ensembl.org/id/LRG_598" } ] } } ], "crossref": [ { "id": "ENSG00000113889", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113889", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00042", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00042", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "KNG1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=KNG1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "3827", "url": "https://www.ncbi.nlm.nih.gov/gene/3827", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "810", "url": "https://glyconnect.expasy.org/browser/proteins/810", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "6383", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=6383", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P01042", "url": "https://www.ebi.ac.uk/intact/interactors/id:P01042*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000010", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000010", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002395", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002395", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018073", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018073", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027358", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027358", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046350", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046350", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:3827", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3827", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "228960", "url": "http://www.omim.org/entry/228960", "database": "MIM", "categories": [ "Other" ] }, { "id": "612358", "url": "http://www.omim.org/entry/612358", "database": "MIM", "categories": [ "Other" ] }, { "id": "619363", "url": "http://www.omim.org/entry/619363", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P01042", "url": "https://www.nextprot.org/entry/NX_P01042", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "DQGHGHQ", "url": "https://omabrowser.org/oma/group/DQGHGHQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5223498at2759", "url": "http://www.orthodb.org/?query=5223498at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13814", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13814", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13814:SF12", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13814:SF12", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1NY2", "url": "https://www.rcsb.org/structure/1NY2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2WOK", "url": "https://www.rcsb.org/structure/2WOK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4ASQ", "url": "https://www.rcsb.org/structure/4ASQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4ASR", "url": "https://www.rcsb.org/structure/4ASR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4ECB", "url": "https://www.rcsb.org/structure/4ECB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4ECC", "url": "https://www.rcsb.org/structure/4ECC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5I25", "url": "https://www.rcsb.org/structure/5I25", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6F27", "url": "https://www.rcsb.org/structure/6F27", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6F3V", "url": "https://www.rcsb.org/structure/6F3V", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6F3W", "url": "https://www.rcsb.org/structure/6F3W", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6F3X", "url": "https://www.rcsb.org/structure/6F3X", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6F3Y", "url": "https://www.rcsb.org/structure/6F3Y", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7EIB", "url": "https://www.rcsb.org/structure/7EIB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7F2O", "url": "https://www.rcsb.org/structure/7F2O", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7F6H", "url": "https://www.rcsb.org/structure/7F6H", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7F6I", "url": "https://www.rcsb.org/structure/7F6I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7QOT", "url": "https://www.rcsb.org/structure/7QOT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7QOX", "url": "https://www.rcsb.org/structure/7QOX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00031", "url": "http://pfam.xfam.org/family/PF00031", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P01042", "url": "https://pharos.nih.gov/targets/P01042", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000051541", "url": "https://proconsortium.org/app/entry/PR:000051541", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051542", "url": "https://proconsortium.org/app/entry/PR:000051542", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051543", "url": "https://proconsortium.org/app/entry/PR:000051543", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051544", "url": "https://proconsortium.org/app/entry/PR:000051544", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051545", "url": "https://proconsortium.org/app/entry/PR:000051545", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051546", "url": "https://proconsortium.org/app/entry/PR:000051546", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051547", "url": "https://proconsortium.org/app/entry/PR:000051547", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051548", "url": "https://proconsortium.org/app/entry/PR:000051548", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051549", "url": "https://proconsortium.org/app/entry/PR:000051549", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051550", "url": "https://proconsortium.org/app/entry/PR:000051550", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051551", "url": "https://proconsortium.org/app/entry/PR:000051551", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051552", "url": "https://proconsortium.org/app/entry/PR:000051552", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051553", "url": "https://proconsortium.org/app/entry/PR:000051553", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051554", "url": "https://proconsortium.org/app/entry/PR:000051554", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051555", "url": "https://proconsortium.org/app/entry/PR:000051555", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051556", "url": "https://proconsortium.org/app/entry/PR:000051556", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051557", "url": "https://proconsortium.org/app/entry/PR:000051557", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051558", "url": "https://proconsortium.org/app/entry/PR:000051558", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051559", "url": "https://proconsortium.org/app/entry/PR:000051559", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051560", "url": "https://proconsortium.org/app/entry/PR:000051560", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051561", "url": "https://proconsortium.org/app/entry/PR:000051561", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051562", "url": "https://proconsortium.org/app/entry/PR:000051562", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051563", "url": "https://proconsortium.org/app/entry/PR:000051563", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051564", "url": "https://proconsortium.org/app/entry/PR:000051564", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051565", "url": "https://proconsortium.org/app/entry/PR:000051565", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051566", "url": "https://proconsortium.org/app/entry/PR:000051566", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051567", "url": "https://proconsortium.org/app/entry/PR:000051567", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051568", "url": "https://proconsortium.org/app/entry/PR:000051568", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051569", "url": "https://proconsortium.org/app/entry/PR:000051569", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051570", "url": "https://proconsortium.org/app/entry/PR:000051570", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051571", "url": "https://proconsortium.org/app/entry/PR:000051571", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051572", "url": "https://proconsortium.org/app/entry/PR:000051572", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051573", "url": "https://proconsortium.org/app/entry/PR:000051573", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051574", "url": "https://proconsortium.org/app/entry/PR:000051574", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051575", "url": "https://proconsortium.org/app/entry/PR:000051575", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051576", "url": "https://proconsortium.org/app/entry/PR:000051576", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051577", "url": "https://proconsortium.org/app/entry/PR:000051577", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051578", "url": "https://proconsortium.org/app/entry/PR:000051578", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051579", "url": "https://proconsortium.org/app/entry/PR:000051579", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051580", "url": "https://proconsortium.org/app/entry/PR:000051580", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051581", "url": "https://proconsortium.org/app/entry/PR:000051581", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051582", "url": "https://proconsortium.org/app/entry/PR:000051582", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051583", "url": "https://proconsortium.org/app/entry/PR:000051583", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051584", "url": "https://proconsortium.org/app/entry/PR:000051584", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051585", "url": "https://proconsortium.org/app/entry/PR:000051585", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051586", "url": "https://proconsortium.org/app/entry/PR:000051586", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051587", "url": "https://proconsortium.org/app/entry/PR:000051587", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051588", "url": "https://proconsortium.org/app/entry/PR:000051588", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051589", "url": "https://proconsortium.org/app/entry/PR:000051589", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051590", "url": "https://proconsortium.org/app/entry/PR:000051590", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051591", "url": "https://proconsortium.org/app/entry/PR:000051591", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051592", "url": "https://proconsortium.org/app/entry/PR:000051592", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051593", "url": "https://proconsortium.org/app/entry/PR:000051593", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051594", "url": "https://proconsortium.org/app/entry/PR:000051594", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051595", "url": "https://proconsortium.org/app/entry/PR:000051595", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051596", "url": "https://proconsortium.org/app/entry/PR:000051596", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051597", "url": "https://proconsortium.org/app/entry/PR:000051597", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051598", "url": "https://proconsortium.org/app/entry/PR:000051598", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051599", "url": "https://proconsortium.org/app/entry/PR:000051599", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051600", "url": "https://proconsortium.org/app/entry/PR:000051600", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051601", "url": "https://proconsortium.org/app/entry/PR:000051601", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051602", "url": "https://proconsortium.org/app/entry/PR:000051602", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051603", "url": "https://proconsortium.org/app/entry/PR:000051603", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051604", "url": "https://proconsortium.org/app/entry/PR:000051604", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051605", "url": "https://proconsortium.org/app/entry/PR:000051605", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051606", "url": "https://proconsortium.org/app/entry/PR:000051606", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051607", "url": "https://proconsortium.org/app/entry/PR:000051607", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051608", "url": "https://proconsortium.org/app/entry/PR:000051608", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051609", "url": "https://proconsortium.org/app/entry/PR:000051609", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051610", "url": "https://proconsortium.org/app/entry/PR:000051610", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051611", "url": "https://proconsortium.org/app/entry/PR:000051611", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051612", "url": "https://proconsortium.org/app/entry/PR:000051612", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051613", "url": "https://proconsortium.org/app/entry/PR:000051613", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051614", "url": "https://proconsortium.org/app/entry/PR:000051614", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051615", "url": "https://proconsortium.org/app/entry/PR:000051615", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051616", "url": "https://proconsortium.org/app/entry/PR:000051616", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051617", "url": "https://proconsortium.org/app/entry/PR:000051617", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051618", "url": "https://proconsortium.org/app/entry/PR:000051618", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051619", "url": "https://proconsortium.org/app/entry/PR:000051619", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051620", "url": "https://proconsortium.org/app/entry/PR:000051620", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051621", "url": "https://proconsortium.org/app/entry/PR:000051621", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051622", "url": "https://proconsortium.org/app/entry/PR:000051622", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051623", "url": "https://proconsortium.org/app/entry/PR:000051623", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051624", "url": "https://proconsortium.org/app/entry/PR:000051624", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051625", "url": "https://proconsortium.org/app/entry/PR:000051625", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051626", "url": "https://proconsortium.org/app/entry/PR:000051626", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051627", "url": "https://proconsortium.org/app/entry/PR:000051627", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P01042", "url": "http://purl.obolibrary.org/obo/PR_P01042", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8957275", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8957275", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_000884", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000884", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P01042", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01042-1", "url": "https://www.uniprot.org/uniprot/P01042-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01042-2", "url": "https://www.uniprot.org/uniprot/P01042-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01042-3", "url": "https://www.uniprot.org/uniprot/P01042-3", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKLITILFLCSRLLLSLTQESQSEEIDCNDKDLFKAVDAALKKYNSQNQSNNQFVLYRITEATKTVGSDTFYSFKYEIKEGDCPVQSGKTWQDCEYKDAAKAATGECTATVGKRSSTKFSVATQTCQITPAEGPVVTAQYDCLGCVHPISTQSPDLEPILRHGIQYFNNNTQHSSLFMLNEVKRAQRQVVAGLNFRITYSIVQTNCSKENFLFLTPDCKSLWNGDTGECTDNAYIDIQLRIASFSQNCDIYPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFKIDNVKKARVQVVAGKKYFIDFVARETTCSKESNEELTESCETKKLGQSLDCNAEVYVVPWEKKIYPTVNCQPLGMISLMKRPPGFSPFRSSRIGEIKEETTVSPPHTSMAPAQDEERDSGKEQGHTRRHDWGHEKQRKHNLGHGHKHERDQGHGHQRGHGLGHGHEQQHGLGHGHKFKLDDDLEHQGGHVLDHGHKHKHGHGHGKHKNKGKKNGKHNGWKTEHLASSSEDSTTPSAQTQEKTEGPTPIPSLAKPGVTVTFSDFQDSDLIATMMPPISPAPIQSDDDWIPDIQIDPNGLSFNPISDFPDTTSPKCPGRPWKSVSEINPTTQMKESYYFDLTDGLS", "length": 644, "header": "sp|P01042-1|KNG1_HUMAN Isoform 1 of Kininogen-1 OS=Homo sapiens OX=9606 GN=KNG1 PE=1 SV=2 CANONICAL=P01042-1" }, "isoforms": [ { "isoform_ac": "P01042-1", "url": "", "sequence": { "sequence": "MKLITILFLCSRLLLSLTQESQSEEIDCNDKDLFKAVDAALKKYNSQNQSNNQFVLYRITEATKTVGSDTFYSFKYEIKEGDCPVQSGKTWQDCEYKDAAKAATGECTATVGKRSSTKFSVATQTCQITPAEGPVVTAQYDCLGCVHPISTQSPDLEPILRHGIQYFNNNTQHSSLFMLNEVKRAQRQVVAGLNFRITYSIVQTNCSKENFLFLTPDCKSLWNGDTGECTDNAYIDIQLRIASFSQNCDIYPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFKIDNVKKARVQVVAGKKYFIDFVARETTCSKESNEELTESCETKKLGQSLDCNAEVYVVPWEKKIYPTVNCQPLGMISLMKRPPGFSPFRSSRIGEIKEETTVSPPHTSMAPAQDEERDSGKEQGHTRRHDWGHEKQRKHNLGHGHKHERDQGHGHQRGHGLGHGHEQQHGLGHGHKFKLDDDLEHQGGHVLDHGHKHKHGHGHGKHKNKGKKNGKHNGWKTEHLASSSEDSTTPSAQTQEKTEGPTPIPSLAKPGVTVTFSDFQDSDLIATMMPPISPAPIQSDDDWIPDIQIDPNGLSFNPISDFPDTTSPKCPGRPWKSVSEINPTTQMKESYYFDLTDGLS", "length": 644, "header": "sp|P01042-1|KNG1_HUMAN Isoform 1 of Kininogen-1 OS=Homo sapiens OX=9606 GN=KNG1 PE=1 SV=2 CANONICAL=P01042-1" }, "locus": { "chromosome": "3", "start_pos": 186742328, "end_pos": 186717543, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000644859.2", "url": "https://www.ensembl.org/id/ENST00000644859.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000493985.1", "url": "https://www.ensembl.org/id/ENSP00000493985.1" } ] } }, { "isoform_ac": "P01042-2", "url": "", "sequence": { "sequence": "MKLITILFLCSRLLLSLTQESQSEEIDCNDKDLFKAVDAALKKYNSQNQSNNQFVLYRITEATKTVGSDTFYSFKYEIKEGDCPVQSGKTWQDCEYKDAAKAATGECTATVGKRSSTKFSVATQTCQITPAEGPVVTAQYDCLGCVHPISTQSPDLEPILRHGIQYFNNNTQHSSLFMLNEVKRAQRQVVAGLNFRITYSIVQTNCSKENFLFLTPDCKSLWNGDTGECTDNAYIDIQLRIASFSQNCDIYPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFKIDNVKKARVQVVAGKKYFIDFVARETTCSKESNEELTESCETKKLGQSLDCNAEVYVVPWEKKIYPTVNCQPLGMISLMKRPPGFSPFRSSRIGEIKEETTSHLRSCEYKGRPPKAGAEPASEREVS", "length": 427, "header": "sp|P01042-2|KNG1_HUMAN Isoform 2 of Kininogen-1 OS=Homo sapiens OX=9606 GN=KNG1 PE=1 SV=2 CANONICAL=P01042-1" }, "locus": { "chromosome": "3", "start_pos": 186743782, "end_pos": 186717543, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000287611.8", "url": "https://www.ensembl.org/id/ENST00000287611.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000287611.2", "url": "https://www.ensembl.org/id/ENSP00000287611.2" } ] } }, { "isoform_ac": "P01042-3", "url": "", "sequence": { "sequence": "MKLITILFLCSRLLLSLTQESQSEEIDCNDKDLFKAVDAALKKYNSQNQSNNQFVLYRITEATKTVGSDTFYSFKYEIKEGDCPVQSGKTWQDCEYKDAAKAATGECTATVGKRSSTKFSVATQTCQITPAEGPVVTAQYDCLGCVHPISTQSPDLEPILRHGIQYFNNNTQHSSLFMLNEVKRAQRQDTGECTDNAYIDIQLRIASFSQNCDIYPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFKIDNVKKARVQVVAGKKYFIDFVARETTCSKESNEELTESCETKKLGQSLDCNAEVYVVPWEKKIYPTVNCQPLGMISLMKRPPGFSPFRSSRIGEIKEETTSHLRSCEYKGRPPKAGAEPASEREVS", "length": 391, "header": "sp|P01042-3|KNG1_HUMAN Isoform 3 of Kininogen-1 OS=Homo sapiens OX=9606 GN=KNG1 PE=1 SV=2 CANONICAL=P01042-1" }, "locus": { "chromosome": "3", "start_pos": 186743782, "end_pos": 186717543, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000447445.1", "url": "https://www.ensembl.org/id/ENST00000447445.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000396025.1", "url": "https://www.ensembl.org/id/ENSP00000396025.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 120, "start_aa": "Ser", "end_pos": 120, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser120", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G17015OC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 137, "start_aa": "Thr", "end_pos": 137, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr137", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "26598643", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26598643" } ] }, { "glytoucan_ac": "G23729WG", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 137, "start_aa": "Thr", "end_pos": 137, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr137", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "26598643", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26598643" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 137, "start_aa": "Thr", "end_pos": 137, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr137", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "26598643", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26598643" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 137, "start_aa": "Thr", "end_pos": 137, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr137", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "26598643", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26598643" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 137, "start_aa": "Thr", "end_pos": 137, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr137", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "26598643", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26598643" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57317CE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 137, "start_aa": "Thr", "end_pos": 137, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr137", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "26598643", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26598643" } ] }, { "glytoucan_ac": "G58001LT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 137, "start_aa": "Thr", "end_pos": 137, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr137", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "26598643", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26598643" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G94917XT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 137, "start_aa": "Thr", "end_pos": 137, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr137", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "26598643", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26598643" } ] }, { "glytoucan_ac": "G95678HJ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 137, "start_aa": "Thr", "end_pos": 137, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr137", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "26598643", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26598643" } ] }, { "glytoucan_ac": "G17015OC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 150, "start_aa": "Ser", "end_pos": 150, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser150", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "26598643", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26598643" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G27947YN", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 150, "start_aa": "Ser", "end_pos": 150, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser150", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "26598643", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26598643" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 150, "start_aa": "Ser", "end_pos": 150, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser150", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "26598643", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26598643" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 150, "start_aa": "Ser", "end_pos": 150, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser150", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "26598643", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26598643" } ] }, { "glytoucan_ac": "G58001LT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 150, "start_aa": "Ser", "end_pos": 150, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser150", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "26598643", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26598643" } ] }, { "glytoucan_ac": "G17015OC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 151, "start_aa": "Thr", "end_pos": 151, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr151", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "26598643", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26598643" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 151, "start_aa": "Thr", "end_pos": 151, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr151", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "26598643", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26598643" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 151, "start_aa": "Thr", "end_pos": 151, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr151", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "26598643", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26598643" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P01042@N169", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01042@N169" } ] }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P01042@N169", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01042@N169" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "P01042@N169", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01042@N169" } ] }, { "glytoucan_ac": "G11115RO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G11911BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G12793SR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G22276PO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G23505EP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "P01042@N169", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01042@N169" } ] }, { "glytoucan_ac": "G26267FS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P01042@N169", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01042@N169" } ] }, { "glytoucan_ac": "G29068FM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G30769VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G36131WL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G40926MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "P01042@N169", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01042@N169" } ] }, { "glytoucan_ac": "G44576HQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G44753VC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "P01042@N169", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01042@N169" } ] }, { "glytoucan_ac": "G47012YE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G52890YB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P01042@N169", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01042@N169" } ] }, { "glytoucan_ac": "G62165AG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G66088HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G66163OV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G69834CE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G78644BR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G79286RS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G85144OK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P01042@N169", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01042@N169" } ] }, { "glytoucan_ac": "G86752LQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "P01042@N169", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01042@N169" } ] }, { "glytoucan_ac": "G90093AU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P01042@N169", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01042@N169" } ] }, { "glytoucan_ac": "G95678HJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G99679NM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P01042@N169", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01042@N169" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "P01042", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01042#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/14760718" }, { "id": "3484703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3484703" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "automatic_literature_mining", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "14977046", "database": "Automatic Literature Mining", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/14977046" }, { "id": "14977046", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/14977046" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P01042@N205", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01042@N205" } ] }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P01042@N205", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01042@N205" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G11870QZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G11911BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G17015OC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G33791AF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G36131WL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G40926MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "24417605", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24417605" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G56784JY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G61806WR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G76417NN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G78644BR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G85144OK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G86752LQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G86795LJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P01042@N205", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01042@N205" } ] }, { "glytoucan_ac": "G92081HT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P01042@N205", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01042@N205" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "Complex", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (complex) asparagine Complex", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01042", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01042#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "3484703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3484703" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "19139490", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19139490" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 273, "start_aa": "Thr", "end_pos": 273, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr273", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 273, "start_aa": "Thr", "end_pos": 273, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr273", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P01042@N294", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01042@N294" } ] }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P01042@N294", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01042@N294" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G08110WX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G11911BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G15488CF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G18590ZR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G23811SR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G26403SG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G31118FR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G33791AF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G36131WL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G39170TE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G39595FH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G40926MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G41346UA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G43417UB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G44778BV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G46665ZP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G47737VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "P01042@N294", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01042@N294" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G58001LT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G61806WR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G64394MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G66163OV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G69834CE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G72667IM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G76329HL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G76417NN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G76915KR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G78644BR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G81198YO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G85144OK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G86795LJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G92081HT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G93683YO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P01042@N294", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01042@N294" } ] }, { "glytoucan_ac": "G97968CT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "P01042", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01042#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "12754519", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12754519" }, { "id": "19139490", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19139490" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "IGEIKEETTVSPPHTSMAPAQDEER", "relation": "attached", "comment": "", "start_pos": 393, "start_aa": "Ile", "end_pos": 417, "end_aa": "Arg", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "28035807", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.6b02887" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "IGEIKEETTVSPPHTSMAPAQDEERDSGK", "relation": "attached", "comment": "", "start_pos": 393, "start_aa": "Ile", "end_pos": 421, "end_aa": "Lys", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "28035807", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.6b02887" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "EETTVSPPHTSMAPAQDEER", "relation": "attached", "comment": "", "start_pos": 398, "start_aa": "Glu", "end_pos": 417, "end_aa": "Arg", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "28035807", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.6b02887" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "EETTVSPPHTSMAPAQDEERDSGKEQGHTR", "relation": "attached", "comment": "", "start_pos": 398, "start_aa": "Glu", "end_pos": 427, "end_aa": "Arg", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "28035807", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.6b02887" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 400, "start_aa": "Thr", "end_pos": 400, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr400", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57317CE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 400, "start_aa": "Thr", "end_pos": 400, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr400", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G06247RL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 401, "start_aa": "Thr", "end_pos": 401, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr401", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 401, "start_aa": "Thr", "end_pos": 401, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr401", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 401, "start_aa": "Thr", "end_pos": 401, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr401", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G58001LT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 401, "start_aa": "Thr", "end_pos": 401, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr401", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 401, "start_aa": "Thr", "end_pos": 401, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr401", "evidence": [ { "id": "P01042", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01042#ptm_processing" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 407, "start_aa": "Thr", "end_pos": 407, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr407", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 407, "start_aa": "Thr", "end_pos": 407, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr407", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 408, "start_aa": "Ser", "end_pos": 408, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser408", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "DSGKEQGHTR", "relation": "attached", "comment": "", "start_pos": 418, "start_aa": "Asp", "end_pos": 427, "end_aa": "Arg", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "28035807", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.6b02887" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 48, "start_aa": "Asn", "end_pos": 48, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn48", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 48, "start_aa": "Asn", "end_pos": 48, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn48", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 48, "start_aa": "Asn", "end_pos": 48, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn48", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 48, "start_aa": "Asn", "end_pos": 48, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn48", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 48, "start_aa": "Asn", "end_pos": 48, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn48", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G33791AF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 48, "start_aa": "Asn", "end_pos": 48, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn48", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 48, "start_aa": "Asn", "end_pos": 48, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn48", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 48, "start_aa": "Asn", "end_pos": 48, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn48", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 48, "start_aa": "Asn", "end_pos": 48, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn48", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 48, "start_aa": "Asn", "end_pos": 48, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn48", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 48, "start_aa": "Asn", "end_pos": 48, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn48", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "Complex", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (complex) asparagine Complex", "start_pos": 48, "start_aa": "Asn", "end_pos": 48, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn48", "evidence": [ { "id": "P01042", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01042#ptm_processing" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "19139490", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19139490" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "TEHLASSSEDSTTPSAQTQEK", "relation": "attached", "comment": "", "start_pos": 521, "start_aa": "Thr", "end_pos": 541, "end_aa": "Lys", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "28035807", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.6b02887" } ] }, { "glytoucan_ac": "G73004SD", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 531, "start_aa": "Ser", "end_pos": 531, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser531", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 532, "start_aa": "Thr", "end_pos": 532, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr532", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 532, "start_aa": "Thr", "end_pos": 532, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr532", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G58001LT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 532, "start_aa": "Thr", "end_pos": 532, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr532", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 533, "start_aa": "Thr", "end_pos": 533, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr533", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 533, "start_aa": "Thr", "end_pos": 533, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr533", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 533, "start_aa": "Thr", "end_pos": 533, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr533", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 533, "start_aa": "Thr", "end_pos": 533, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr533", "evidence": [ { "id": "P01042", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01042#ptm_processing" }, { "id": "4054110", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4054110" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 542, "start_aa": "Thr", "end_pos": 542, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr542", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 542, "start_aa": "Thr", "end_pos": 542, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr542", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G74722FL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 542, "start_aa": "Thr", "end_pos": 542, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr542", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "24417605", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24417605" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 542, "start_aa": "Thr", "end_pos": 542, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr542", "evidence": [ { "id": "P01042", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01042#ptm_processing" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 546, "start_aa": "Thr", "end_pos": 546, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr546", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 546, "start_aa": "Thr", "end_pos": 546, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr546", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 546, "start_aa": "Thr", "end_pos": 546, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr546", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 546, "start_aa": "Thr", "end_pos": 546, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr546", "evidence": [ { "id": "P01042", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01042#ptm_processing" }, { "id": "4054110", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4054110" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 550, "start_aa": "Ser", "end_pos": 550, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser550", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "predicted", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 557, "start_aa": "Thr", "end_pos": 557, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr557", "evidence": [ { "id": "P01042", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01042#ptm_processing" } ] }, { "glytoucan_ac": "G23729WG", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 571, "start_aa": "Thr", "end_pos": 571, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr571", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "26598643", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26598643" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 571, "start_aa": "Thr", "end_pos": 571, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr571", "evidence": [ { "id": "P01042", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01042#ptm_processing" } ] }, { "glytoucan_ac": "G17015OC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 577, "start_aa": "Ser", "end_pos": 577, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser577", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "26598643", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26598643" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc...) serine O-GalNAcylation", "start_pos": 577, "start_aa": "Ser", "end_pos": 577, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser577", "evidence": [ { "id": "P01042", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01042#ptm_processing" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 599, "start_aa": "Ser", "end_pos": 599, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser599", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 599, "start_aa": "Ser", "end_pos": 599, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser599", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G23729WG", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 604, "start_aa": "Ser", "end_pos": 604, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser604", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "26598643", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26598643" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 604, "start_aa": "Ser", "end_pos": 604, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser604", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "26598643", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26598643" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 604, "start_aa": "Ser", "end_pos": 604, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser604", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "26598643", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26598643" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "SVSEINPTTQMK", "relation": "attached", "comment": "", "start_pos": 621, "start_aa": "Ser", "end_pos": 632, "end_aa": "Lys", "evidence": [ { "id": "P01042", "database": "UniCarbKB", "url": "" }, { "id": "28035807", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.6b02887" } ] }, { "glytoucan_ac": "G10019LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 626, "start_aa": "Asn", "end_pos": 626, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn626", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 626, "start_aa": "Asn", "end_pos": 626, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn626", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G23010ZW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 626, "start_aa": "Asn", "end_pos": 626, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn626", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G38663NM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 626, "start_aa": "Asn", "end_pos": 626, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn626", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G43089EG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 626, "start_aa": "Asn", "end_pos": 626, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn626", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G57888GL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 626, "start_aa": "Asn", "end_pos": 626, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn626", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G62461SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 626, "start_aa": "Asn", "end_pos": 626, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn626", "evidence": [ { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "predicted", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 628, "start_aa": "Thr", "end_pos": 628, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr628", "evidence": [ { "id": "P01042", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01042#ptm_processing" } ] } ], "phosphorylation": [ { "start_pos": 326, "end_pos": 326, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01042", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01042" }, { "database": "PubMed", "id": "19824718", "url": "https://glygen.org/publication/PubMed/19824718" } ], "site_lbl": "Thr326" }, { "start_pos": 327, "end_pos": 327, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01042", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01042" }, { "database": "PubMed", "id": "19824718", "url": "https://glygen.org/publication/PubMed/19824718" } ], "site_lbl": "Thr327" }, { "start_pos": 329, "end_pos": 329, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01042", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01042" }, { "database": "PubMed", "id": "19824718", "url": "https://glygen.org/publication/PubMed/19824718" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" } ], "site_lbl": "Ser329" }, { "start_pos": 332, "end_pos": 332, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by FAM20C", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" }, { "database": "iPTMnet", "id": "P01042", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01042" }, { "database": "PubMed", "id": "19824718", "url": "https://glygen.org/publication/PubMed/19824718" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" }, { "database": "PubMed", "id": "20187088", "url": "https://glygen.org/publication/PubMed/20187088" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "26091039", "url": "https://glygen.org/publication/PubMed/26091039" } ], "site_lbl": "Ser332" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported", "glycoprotein_predicted" ], "publication": [ { "title": "Proteomics Analysis of O-GalNAc Glycosylation in Human Serum by an Integrated Strategy", "journal": "Anal. Chem.", "date": "2017", "authors": "Qin H., Cheng K., Zhu J., Mao J., Wang F., Dong M., Chen R., Guo Z., Liang X., Ye M., Zou H.", "evidence": [ { "database": "UniCarbKB", "id": "P01042", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1021/acs.analchem.6b02887", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.6b02887" } ] }, { "title": "N-Linked glycosylation and sialylation of the acid-labile subunit. Role in complex formation with insulin-like growth factor (IGF)-binding protein-3 and the IGFs.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Janosi JB, Firth SM, Bond JJ, Baxter RC, Delhanty PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10026136", "url": "https://glygen.org/publication/PubMed/10026136" } ] }, { "title": "The insulin-like growth factor (IGF)-dependent IGF binding protein-4 protease secreted by human fibroblasts is pregnancy-associated plasma protein-A.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Lawrence JB, Oxvig C, Overgaard MT, Sottrup-Jensen L, Gleich GJ, Hays LG, Yates JR 3rd, Conover CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10077652", "url": "https://glygen.org/publication/PubMed/10077652" } ] }, { "title": "Protease-activated receptors 1 and 4 mediate activation of human platelets by thrombin.", "journal": "The Journal of clinical investigation", "date": "1999", "authors": "Kahn ML, Nakanishi-Matsui M, Shapiro MJ, Ishihara H, Coughlin SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10079109", "url": "https://glygen.org/publication/PubMed/10079109" } ] }, { "title": "Discovery of a receptor related to the galanin receptors.", "journal": "FEBS letters", "date": "1999", "authors": "Lee DK, Nguyen T, O'Neill GP, Cheng R, Liu Y, Howard AD, Coulombe N, Tan CP, Tang-Nguyen AT, George SR, O'Dowd BF", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10100623", "url": "https://glygen.org/publication/PubMed/10100623" } ] }, { "title": "Genomic organization of the human galpha14 and Galphaq genes and mutation analysis in chorea-acanthocytosis (CHAC).", "journal": "Genomics", "date": "1999", "authors": "Rubio JP, Levy ER, Dobson-Stone C, Monaco AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "10191087", "url": "https://glygen.org/publication/PubMed/10191087" } ] }, { "title": "The cleavage site specificity of human prostate specific antigen for insulin-like growth factor binding protein-3.", "journal": "FEBS letters", "date": "1999", "authors": "Okabe E, Kajihara J, Usami Y, Hirano K", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10218588", "url": "https://glygen.org/publication/PubMed/10218588" } ] }, { "title": "Receptor for motilin identified in the human gastrointestinal system.", "journal": "Science (New York, N.Y.)", "date": "1999", "authors": "Feighner SD, Tan CP, McKee KK, Palyha OC, Hreniuk DL, Pong SS, Austin CP, Figueroa D, MacNeil D, Cascieri MA, Nargund R, Bakshi R, Abramovitz M, Stocco R, Kargman S, O'Neill G, Van Der Ploeg LH, Evans J, Patchett AA, Smith RG, Howard AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10381885", "url": "https://glygen.org/publication/PubMed/10381885" } ] }, { "title": "Melanin-concentrating hormone is the cognate ligand for the orphan G-protein-coupled receptor SLC-1.", "journal": "Nature", "date": "1999", "authors": "Chambers J, Ames RS, Bergsma D, Muir A, Fitzgerald LR, Hervieu G, Dytko GM, Foley JJ, Martin J, Liu WS, Park J, Ellis C, Ganguly S, Konchar S, Cluderay J, Leslie R, Wilson S, Sarau HM", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10421367", "url": "https://glygen.org/publication/PubMed/10421367" } ] }, { "title": "Molecular characterization of the melanin-concentrating-hormone receptor.", "journal": "Nature", "date": "1999", "authors": "Saito Y, Nothacker HP, Wang Z, Lin SH, Leslie F, Civelli O", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10421368", "url": "https://glygen.org/publication/PubMed/10421368" } ] }, { "title": "Proteolytic processing of big endothelin-3 by the kell blood group protein.", "journal": "Blood", "date": "1999", "authors": "Lee S, Lin M, Mele A, Cao Y, Farmar J, Russo D, Redman C", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10438732", "url": "https://glygen.org/publication/PubMed/10438732" } ] }, { "title": "Extensive alternative splicing in the 5'-untranslated region of the rat and human neuropeptide Y Y5 receptor genes regulates receptor expression.", "journal": "Journal of neurochemistry", "date": "1999", "authors": "Parker EM, Xia L", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10461880", "url": "https://glygen.org/publication/PubMed/10461880" } ] }, { "title": "Tissue distribution of prolactin-releasing peptide (PrRP) and its receptor.", "journal": "Regulatory peptides", "date": "1999", "authors": "Fujii R, Fukusumi S, Hosoya M, Kawamata Y, Habata Y, Hinuma S, Sekiguchi M, Kitada C, Kurokawa T, Nishimura O, Onda H, Sumino Y, Fujino M", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10498338", "url": "https://glygen.org/publication/PubMed/10498338" } ] }, { "title": "Human urotensin-II is a potent vasoconstrictor and agonist for the orphan receptor GPR14.", "journal": "Nature", "date": "1999", "authors": "Ames RS, Sarau HM, Chambers JK, Willette RN, Aiyar NV, Romanic AM, Louden CS, Foley JJ, Sauermelch CF, Coatney RW, Ao Z, Disa J, Holmes SD, Stadel JM, Martin JD, Liu WS, Glover GI, Wilson S, McNulty DE, Ellis CE, Elshourbagy NA, Shabon U, Trill JJ, Hay DW, Ohlstein EH, Bergsma DJ, Douglas SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10499587", "url": "https://glygen.org/publication/PubMed/10499587" } ] }, { "title": "Inflammation-related neutrophil proteases, cathepsin G and elastase, function as insulin-like growth factor binding protein proteases.", "journal": "Growth hormone & IGF research : official journal of the Growth Hormone Research Society and the International IGF Research Society", "date": "1999", "authors": "Gibson TL, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10512690", "url": "https://glygen.org/publication/PubMed/10512690" } ] }, { "title": "Selective regulation of Galpha(q/11) by an RGS domain in the G protein-coupled receptor kinase, GRK2.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Carman CV, Parent JL, Day PW, Pronin AN, Sternweis PM, Wedegaertner PB, Gilman AG, Benovic JL, Kozasa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "10567430", "url": "https://glygen.org/publication/PubMed/10567430" } ] }, { "title": "Ghrelin is a growth-hormone-releasing acylated peptide from stomach.", "journal": "Nature", "date": "1999", "authors": "Kojima M, Hosoda H, Date Y, Nakazato M, Matsuo H, Kangawa K", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10604470", "url": "https://glygen.org/publication/PubMed/10604470" } ] }, { "title": "A central domain binding site in insulin-like growth factor binding protein-5 for the acid-labile subunit.", "journal": "Endocrinology", "date": "2000", "authors": "Twigg SM, Kiefer MC, Zapf J, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10614670", "url": "https://glygen.org/publication/PubMed/10614670" } ] }, { "title": "Mechanisms for the involvement of high molecular weight kininogen in surface-dependent reactions of Hageman factor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1976", "authors": "Griffin JH, Cochrane CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "1066663", "url": "https://glygen.org/publication/PubMed/1066663" } ] }, { "title": "Insulin-like growth factor binding protein (IGFBP)-3-bound IGF-I and IGFBP-3-bound IGF-II in growth hormone deficiency.", "journal": "Hormone research", "date": "1999", "authors": "Belgorosky A, Rivarola MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10681634", "url": "https://glygen.org/publication/PubMed/10681634" } ] }, { "title": "Selective regulation of Gq signaling by G protein-coupled receptor kinase 2: direct interaction of kinase N terminus with activated galphaq.", "journal": "Molecular pharmacology", "date": "2000", "authors": "Sallese M, Mariggio S, D'Urbano E, Iacovelli L, De Blasi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "10727532", "url": "https://glygen.org/publication/PubMed/10727532" } ] }, { "title": "Thrombin-mediated feedback activation of factor XI on the activated platelet surface is preferred over contact activation by factor XIIa or factor XIa.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Baglia FA, Walsh PN", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "10781579", "url": "https://glygen.org/publication/PubMed/10781579" } ] }, { "title": "Binding characteristics of pro-insulin-like growth factor-II from cancer patients: binary and ternary complex formation with IGF binding proteins-1 to -6.", "journal": "The Journal of endocrinology", "date": "2000", "authors": "Bond JJ, Meka S, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10810289", "url": "https://glygen.org/publication/PubMed/10810289" } ] }, { "title": "Clinical pharmacokinetics of angiotensin II (AT1) receptor blockers in hypertension.", "journal": "Journal of human hypertension", "date": "2000", "authors": "Israili ZH", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10854085", "url": "https://glygen.org/publication/PubMed/10854085" } ] }, { "title": "G protein-coupled receptor kinase-5 regulates thrombin-activated signaling in endothelial cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Tiruppathi C, Yan W, Sandoval R, Naqvi T, Pronin AN, Benovic JL, Malik AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "10861009", "url": "https://glygen.org/publication/PubMed/10861009" } ] }, { "title": "Evidence that the interaction between insulin-like growth factor (IGF)-II and IGF binding protein (IGFBP)-4 is essential for the action of the IGF-II-dependent IGFBP-4 protease.", "journal": "Archives of biochemistry and biophysics", "date": "2000", "authors": "Qin X, Byun D, Lau KH, Baylink DJ, Mohan S", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10898936", "url": "https://glygen.org/publication/PubMed/10898936" } ] }, { "title": "Identification and characterization of two neuromedin U receptors differentially expressed in peripheral tissues and the central nervous system.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Raddatz R, Wilson AE, Artymyshyn R, Bonini JA, Borowsky B, Boteju LW, Zhou S, Kouranova EV, Nagorny R, Guevarra MS, Dai M, Lerman GS, Vaysse PJ, Branchek TA, Gerald C, Forray C, Adham N", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10899166", "url": "https://glygen.org/publication/PubMed/10899166" } ] }, { "title": "Effects of IGFBP-2 overexpression in vitro and in vivo.", "journal": "Pediatric nephrology (Berlin, Germany)", "date": "2000", "authors": "Wolf E, Lahm H, Wu M, Wanke R, Hoeflich A", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10912521", "url": "https://glygen.org/publication/PubMed/10912521" } ] }, { "title": "O-glycosylation of insulin-like growth factor (IGF) binding protein-6 maintains high IGF-II binding affinity by decreasing binding to glycosaminoglycans and susceptibility to proteolysis.", "journal": "European journal of biochemistry", "date": "2000", "authors": "Marinaro JA, Neumann GM, Russo VC, Leeding KS, Bach LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10951195", "url": "https://glygen.org/publication/PubMed/10951195" } ] }, { "title": "Prostate carcinoma (PC-3) cell proliferation is stimulated by the 22-25-kDa proteolytic fragment (1-160) and inhibited by the 16-kDa fragment (1-95) of recombinant human insulin-like growth factor binding protein-3.", "journal": "Growth hormone & IGF research : official journal of the Growth Hormone Research Society and the International IGF Research Society", "date": "1998", "authors": "Angelloz-Nicoud P, Lalou C, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10990447", "url": "https://glygen.org/publication/PubMed/10990447" } ] }, { "title": "Src tyrosine kinase is a novel direct effector of G proteins.", "journal": "Cell", "date": "2000", "authors": "Ma YC, Huang J, Ali S, Lowry W, Huang XY", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "11007482", "url": "https://glygen.org/publication/PubMed/11007482" } ] }, { "title": "Structure, function, and control of phosphoinositide-specific phospholipase C.", "journal": "Physiological reviews", "date": "2000", "authors": "Rebecchi MJ, Pentyala SN", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "11015615", "url": "https://glygen.org/publication/PubMed/11015615" } ] }, { "title": "Pregnancy-associated plasma protein-A accounts for the insulin-like growth factor (IGF)-binding protein-4 (IGFBP-4) proteolytic activity in human pregnancy serum and enhances the mitogenic activity of IGF by degrading IGFBP-4 in vitro.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2001", "authors": "Byun D, Mohan S, Yoo M, Sexton C, Baylink DJ, Qin X", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11158056", "url": "https://glygen.org/publication/PubMed/11158056" } ] }, { "title": "Factor XII-dependent contact activation on endothelial cells and binding proteins gC1qR and cytokeratin 1.", "journal": "Thrombosis and haemostasis", "date": "2001", "authors": "Joseph K, Shibayama Y, Ghebrehiwet B, Kaplan AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "11204562", "url": "https://glygen.org/publication/PubMed/11204562" } ] }, { "title": "Ligand-binding characteristics of recombinant amino- and carboxyl-terminal fragments of human insulin-like growth factor-binding protein-3.", "journal": "The Journal of endocrinology", "date": "2001", "authors": "Galanis M, Firth SM, Bond J, Nathanielsz A, Kortt AA, Hudson PJ, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11250653", "url": "https://glygen.org/publication/PubMed/11250653" } ] }, { "title": "Pregnancy-associated plasma protein-A2 (PAPP-A2), a novel insulin-like growth factor-binding protein-5 proteinase.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Overgaard MT, Boldt HB, Laursen LS, Sottrup-Jensen L, Conover CA, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11264294", "url": "https://glygen.org/publication/PubMed/11264294" } ] }, { "title": "Mutagenesis of basic amino acids in the carboxyl-terminal region of insulin-like growth factor binding protein-5 affects acid-labile subunit binding.", "journal": "Endocrinology", "date": "2001", "authors": "Firth SM, Clemmons DR, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11316783", "url": "https://glygen.org/publication/PubMed/11316783" } ] }, { "title": "Growth hormone secretagogue receptor family members and ligands.", "journal": "Endocrine", "date": "2001", "authors": "Smith RG, Leonard R, Bailey AR, Palyha O, Feighner S, Tan C, Mckee KK, Pong SS, Griffin P, Howard A", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "11322507", "url": "https://glygen.org/publication/PubMed/11322507" } ] }, { "title": "Model for a factor IX activation complex on blood platelets: dimeric conformation of factor XIa is essential.", "journal": "Blood", "date": "2001", "authors": "Gailani D, Ho D, Sun MF, Cheng Q, Walsh PN", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "11342438", "url": "https://glygen.org/publication/PubMed/11342438" } ] }, { "title": "Metastasis suppressor gene KiSS-1 encodes peptide ligand of a G-protein-coupled receptor.", "journal": "Nature", "date": "2001", "authors": "Ohtaki T, Shintani Y, Honda S, Matsumoto H, Hori A, Kanehashi K, Terao Y, Kumano S, Takatsu Y, Masuda Y, Ishibashi Y, Watanabe T, Asada M, Yamada T, Suenaga M, Kitada C, Usuki S, Kurokawa T, Onda H, Nishimura O, Fujino M", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "11385580", "url": "https://glygen.org/publication/PubMed/11385580" } ] }, { "title": "The metastasis suppressor gene KiSS-1 encodes kisspeptins, the natural ligands of the orphan G protein-coupled receptor GPR54.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Kotani M, Detheux M, Vandenbogaerde A, Communi D, Vanderwinden JM, Le Poul E, Brezillon S, Tyldesley R, Suarez-Huerta N, Vandeput F, Blanpain C, Schiffmann SN, Vassart G, Parmentier M", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "11457843", "url": "https://glygen.org/publication/PubMed/11457843" } ] }, { "title": "Pregnancy-associated plasma protein-A (PAPP-A) cleaves insulin-like growth factor binding protein (IGFBP)-5 independent of IGF: implications for the mechanism of IGFBP-4 proteolysis by PAPP-A.", "journal": "FEBS letters", "date": "2001", "authors": "Laursen LS, Overgaard MT, Soe R, Boldt HB, Sottrup-Jensen L, Giudice LC, Conover CA, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11522292", "url": "https://glygen.org/publication/PubMed/11522292" } ] }, { "title": "Cloning and molecular characterization of the novel human melanin-concentrating hormone receptor MCH2.", "journal": "Molecular pharmacology", "date": "2001", "authors": "Rodriguez M, Beauverger P, Naime I, Rique H, Ouvry C, Souchaud S, Dromaint S, Nagel N, Suply T, Audinot V, Boutin JA, Galizzi JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "11562423", "url": "https://glygen.org/publication/PubMed/11562423" } ] }, { "title": "Insulin-like growth factor-binding protein-5 inhibits growth and induces differentiation of mouse osteosarcoma cells.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Schneider MR, Zhou R, Hoeflich A, Krebs O, Schmidt J, Mohan S, Wolf E, Lahm H", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11606061", "url": "https://glygen.org/publication/PubMed/11606061" } ] }, { "title": "Pharmacology of AT1-receptor blockers.", "journal": "Blood pressure. Supplement", "date": "2001", "authors": "Unger T", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "11683476", "url": "https://glygen.org/publication/PubMed/11683476" } ] }, { "title": "Factor XI binding to the platelet glycoprotein Ib-IX-V complex promotes factor XI activation by thrombin.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Baglia FA, Badellino KO, Li CQ, Lopez JA, Walsh PN", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "11696542", "url": "https://glygen.org/publication/PubMed/11696542" } ] }, { "title": "IGFBP-3 binding to endothelial cells inhibits plasmin and thrombin proteolysis.", "journal": "American journal of physiology. Endocrinology and metabolism", "date": "2002", "authors": "Booth BA, Boes M, Dake BL, Knudtson KL, Bar RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11739083", "url": "https://glygen.org/publication/PubMed/11739083" } ] }, { "title": "Competing modes of self-association in the regulatory domains of Bruton's tyrosine kinase: intramolecular contact versus asymmetric homodimerization.", "journal": "Protein science : a publication of the Protein Society", "date": "2002", "authors": "Laederach A, Cradic KW, Brazin KN, Zamoon J, Fulton DB, Huang XY, Andreotti AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "11742120", "url": "https://glygen.org/publication/PubMed/11742120" } ] }, { "title": "Insulin-like growth factor-binding protein 2 in tumorigenesis: protector or promoter?", "journal": "Cancer research", "date": "2001", "authors": "Hoeflich A, Reisinger R, Lahm H, Kiess W, Blum WF, Kolb HJ, Weber MM, Wolf E", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11751371", "url": "https://glygen.org/publication/PubMed/11751371" } ] }, { "title": "A unique fold of phospholipase C-beta mediates dimerization and interaction with G alpha q.", "journal": "Nature structural biology", "date": "2002", "authors": "Singer AU, Waldo GL, Harden TK, Sondek J", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "11753430", "url": "https://glygen.org/publication/PubMed/11753430" } ] }, { "title": "The orphan receptor C5L2 has high affinity binding sites for complement fragments C5a and C5a des-Arg(74).", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Cain SA, Monk PN", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "11773063", "url": "https://glygen.org/publication/PubMed/11773063" } ] }, { "title": "Molecular distribution of IGF binding protein-5 in human serum.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2002", "authors": "Baxter RC, Meka S, Firth SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11788658", "url": "https://glygen.org/publication/PubMed/11788658" } ] }, { "title": "Identification and characterization of prolylcarboxypeptidase as an endothelial cell prekallikrein activator.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Shariat-Madar Z, Mahdi F, Schmaier AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "11830581", "url": "https://glygen.org/publication/PubMed/11830581" } ] }, { "title": "Bivalirudin: a direct thrombin inhibitor.", "journal": "Clinical therapeutics", "date": "2002", "authors": "Gladwell TD", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "11833835", "url": "https://glygen.org/publication/PubMed/11833835" } ] }, { "title": "Factor XII interacts with the multiprotein assembly of urokinase plasminogen activator receptor, gC1qR, and cytokeratin 1 on endothelial cell membranes.", "journal": "Blood", "date": "2002", "authors": "Mahdi F, Madar ZS, Figueroa CD, Schmaier AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "11986212", "url": "https://glygen.org/publication/PubMed/11986212" } ] }, { "title": "Regulators of G-protein signalling as new central nervous system drug targets.", "journal": "Nature reviews. Drug discovery", "date": "2002", "authors": "Neubig RR, Siderovski DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "12120503", "url": "https://glygen.org/publication/PubMed/12120503" } ] }, { "title": "Identification of prolylcarboxypeptidase as the cell matrix-associated prekallikrein activator.", "journal": "FEBS letters", "date": "2002", "authors": "Moreira CR, Schmaier AH, Mahdi F, da Motta G, Nader HB, Shariat-Madar Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "12123826", "url": "https://glygen.org/publication/PubMed/12123826" } ] }, { "title": "Substrate specificity of the metalloproteinase pregnancy-associated plasma protein-A (PAPP-A) assessed by mutagenesis and analysis of synthetic peptides: substrate residues distant from the scissile bond are critical for proteolysis.", "journal": "The Biochemical journal", "date": "2002", "authors": "Laursen LS, Overgaard MT, Nielsen CG, Boldt HB, Hopmann KH, Conover CA, Sottrup-Jensen L, Giudice LC, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12241545", "url": "https://glygen.org/publication/PubMed/12241545" } ] }, { "title": "IGF-binding proteins are multifunctional and act via IGF-dependent and -independent mechanisms.", "journal": "The Journal of endocrinology", "date": "2002", "authors": "Mohan S, Baylink DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12379487", "url": "https://glygen.org/publication/PubMed/12379487" } ] }, { "title": "Localization of the adhesion receptor glycoprotein Ib-IX-V complex to lipid rafts is required for platelet adhesion and activation.", "journal": "The Journal of experimental medicine", "date": "2002", "authors": "Shrimpton CN, Borthakur G, Larrucea S, Cruz MA, Dong JF, Lopez JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "12391017", "url": "https://glygen.org/publication/PubMed/12391017" } ] }, { "title": "Molecular cloning and characterization of prokineticin receptors.", "journal": "Biochimica et biophysica acta", "date": "2002", "authors": "Soga T, Matsumoto Si, Oda T, Saito T, Hiyama H, Takasaki J, Kamohara M, Ohishi T, Matsushime H, Furuichi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "12427552", "url": "https://glygen.org/publication/PubMed/12427552" } ] }, { "title": "Cellular actions of the insulin-like growth factor binding proteins.", "journal": "Endocrine reviews", "date": "2002", "authors": "Firth SM, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12466191", "url": "https://glygen.org/publication/PubMed/12466191" } ] }, { "title": "The chemoattractant receptor-like protein C5L2 binds the C3a des-Arg77/acylation-stimulating protein.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Kalant D, Cain SA, Maslowska M, Sniderman AD, Cianflone K, Monk PN", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "12540846", "url": "https://glygen.org/publication/PubMed/12540846" } ] }, { "title": "Characterization of a family of endogenous neuropeptide ligands for the G protein-coupled receptors GPR7 and GPR8.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Tanaka H, Yoshida T, Miyamoto N, Motoike T, Kurosu H, Shibata K, Yamanaka A, Williams SC, Richardson JA, Tsujino N, Garry MG, Lerner MR, King DS, O'Dowd BF, Sakurai T, Yanagisawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "12719537", "url": "https://glygen.org/publication/PubMed/12719537" } ] }, { "title": "Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.", "journal": "Nature biotechnology", "date": "2003", "authors": "Zhang H, Li XJ, Martin DB, Aebersold R", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042#ptm_processing" }, { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "reference": [ { "type": "PubMed", "id": "12754519", "url": "https://glygen.org/publication/PubMed/12754519" } ] }, { "title": "Molecular cloning of the human brain and gastric cholecystokinin receptor: structure, functional expression and chromosomal localization.", "journal": "Biochemical and biophysical research communications", "date": "1992", "authors": "Pisegna JR, de Weerth A, Huppi K, Wank SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1280419", "url": "https://glygen.org/publication/PubMed/1280419" } ] }, { "title": "Amino- and carboxyl-terminal fragments of insulin-like growth factor (IGF) binding protein-3 cooperate to bind IGFs with high affinity and inhibit IGF receptor interactions.", "journal": "Endocrinology", "date": "2003", "authors": "Payet LD, Wang XH, Baxter RC, Firth SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12810533", "url": "https://glygen.org/publication/PubMed/12810533" } ] }, { "title": "IGF-binding protein-4: biochemical characteristics and functional consequences.", "journal": "The Journal of endocrinology", "date": "2003", "authors": "Zhou R, Diehl D, Hoeflich A, Lahm H, Wolf E", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12904166", "url": "https://glygen.org/publication/PubMed/12904166" } ] }, { "title": "The relative priority of prekallikrein and factors XI/XIa assembly on cultured endothelial cells.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Mahdi F, Shariat-Madar Z, Schmaier AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "12944405", "url": "https://glygen.org/publication/PubMed/12944405" } ] }, { "title": "Structure-function analysis of the extracellular domains of the Duffy antigen/receptor for chemokines: characterization of antibody and chemokine binding sites.", "journal": "British journal of haematology", "date": "2003", "authors": "Tournamille C, Filipe A, Wasniowska K, Gane P, Lisowska E, Cartron JP, Colin Y, Le Van Kim C", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "12956774", "url": "https://glygen.org/publication/PubMed/12956774" } ] }, { "title": "Cloning and pharmacological characterization of a human bradykinin (BK-2) receptor.", "journal": "Biochemical and biophysical research communications", "date": "1992", "authors": "Hess JF, Borkowski JA, Young GS, Strader CD, Ransom RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1314587", "url": "https://glygen.org/publication/PubMed/1314587" } ] }, { "title": "Cloning and functional expression of a human neuropeptide Y/peptide YY receptor of the Y1 type.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Larhammar D, Blomqvist AG, Yee F, Jazin E, Yoo H, Wahlested C", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1317848", "url": "https://glygen.org/publication/PubMed/1317848" } ] }, { "title": "The cloning of a family of genes that encode the melanocortin receptors.", "journal": "Science (New York, N.Y.)", "date": "1992", "authors": "Mountjoy KG, Robbins LS, Mortrud MT, Cone RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1325670", "url": "https://glygen.org/publication/PubMed/1325670" } ] }, { "title": "Somatostatin receptors, an expanding gene family: cloning and functional characterization of human SSTR3, a protein coupled to adenylyl cyclase.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1992", "authors": "Yamada Y, Reisine T, Law SF, Ihara Y, Kubota A, Kagimoto S, Seino M, Seino Y, Bell GI, Seino S", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1337145", "url": "https://glygen.org/publication/PubMed/1337145" } ] }, { "title": "Cloning and functional characterization of a family of human and mouse somatostatin receptors expressed in brain, gastrointestinal tract, and kidney.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1992", "authors": "Yamada Y, Post SR, Wang K, Tager HS, Bell GI, Seino S", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1346068", "url": "https://glygen.org/publication/PubMed/1346068" } ] }, { "title": "Structural determinants for binary and ternary complex formation between insulin-like growth factor-I (IGF-I) and IGF binding protein-3.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Baxter RC, Bayne ML, Cascieri MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "1370451", "url": "https://glygen.org/publication/PubMed/1370451" } ] }, { "title": "Prostate-specific antigen (PSA) is an insulin-like growth factor binding protein-3 protease found in seminal plasma.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1992", "authors": "Cohen P, Graves HC, Peehl DM, Kamarei M, Giudice LC, Rosenfeld RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "1383255", "url": "https://glygen.org/publication/PubMed/1383255" } ] }, { "title": "Isolation of dense granules from human platelets.", "journal": "Methods in enzymology", "date": "1992", "authors": "Fukami MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "1435334", "url": "https://glygen.org/publication/PubMed/1435334" } ] }, { "title": "On the structure of human corticotropin (adrenocorticotropic hormone).", "journal": "The Journal of biological chemistry", "date": "1961", "authors": "LEE TH, LERNER AB, BUETTNER-JANUSCH V", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "14463577", "url": "https://glygen.org/publication/PubMed/14463577" } ] }, { "title": "Identification of urotensin II-related peptide as the urotensin II-immunoreactive molecule in the rat brain.", "journal": "Biochemical and biophysical research communications", "date": "2003", "authors": "Sugo T, Murakami Y, Shimomura Y, Harada M, Abe M, Ishibashi Y, Kitada C, Miyajima N, Suzuki N, Mori M, Fujino M", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "14550283", "url": "https://glygen.org/publication/PubMed/14550283" } ] }, { "title": "The GPR54 gene as a regulator of puberty.", "journal": "The New England journal of medicine", "date": "2003", "authors": "Seminara SB, Messager S, Chatzidaki EE, Thresher RR, Acierno JS Jr, Shagoury JK, Bo-Abbas Y, Kuohung W, Schwinof KM, Hendrick AG, Zahn D, Dixon J, Kaiser UB, Slaugenhaupt SA, Gusella JF, O'Rahilly S, Carlton MB, Crowley WF Jr, Aparicio SA, Colledge WH", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "14573733", "url": "https://glygen.org/publication/PubMed/14573733" } ] }, { "title": "Characterization of the proteins released from activated platelets leads to localization of novel platelet proteins in human atherosclerotic lesions.", "journal": "Blood", "date": "2004", "authors": "Coppinger JA, Cagney G, Toomey S, Kislinger T, Belton O, McRedmond JP, Cahill DJ, Emili A, Fitzgerald DJ, Maguire PB", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "14630798", "url": "https://glygen.org/publication/PubMed/14630798" } ] }, { "title": "The physiologic basis of assembly and activation of the plasma kallikrein/kinin system.", "journal": "Thrombosis and haemostasis", "date": "2004", "authors": "Schmaier AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "14691562", "url": "https://glygen.org/publication/PubMed/14691562" } ] }, { "title": "Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.", "journal": "Proteomics", "date": "2004", "authors": "Bunkenborg J, Pilch BJ, Podtelejnikov AV, Wisniewski JR", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042#ptm_processing" }, { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "reference": [ { "type": "PubMed", "id": "14760718", "url": "https://glygen.org/publication/PubMed/14760718" } ] }, { "title": "N-linked glycosylation of the human bradykinin B2 receptor is required for optimal cell-surface expression and coupling.", "journal": "Biological chemistry", "date": "2004", "authors": "Michineau S, Muller L, Pizard A, Alhenc-Gelas F, Rajerison RM", "evidence": [ { "database": "Automatic Literature Mining", "id": "14977046", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/14977046" } ], "reference": [ { "type": "PubMed", "id": "14977046", "url": "https://glygen.org/publication/PubMed/14977046" } ] }, { "title": "Recombinant prolylcarboxypeptidase activates plasma prekallikrein.", "journal": "Blood", "date": "2004", "authors": "Shariat-Madar Z, Mahdi F, Schmaier AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "14996700", "url": "https://glygen.org/publication/PubMed/14996700" } ] }, { "title": "The role of the acid-labile subunit in regulating insulin-like growth factor transport across human umbilical vein endothelial cell monolayers.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2004", "authors": "Payet LD, Firth SM, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15126567", "url": "https://glygen.org/publication/PubMed/15126567" } ] }, { "title": "Novel benzo[1,4]diazepin-2-one derivatives as endothelin receptor antagonists.", "journal": "Journal of medicinal chemistry", "date": "2004", "authors": "Bolli MH, Marfurt J, Grisostomi C, Boss C, Binkert C, Hess P, Treiber A, Thorin E, Morrison K, Buchmann S, Bur D, Ramuz H, Clozel M, Fischli W, Weller T", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "15139756", "url": "https://glygen.org/publication/PubMed/15139756" } ] }, { "title": "The nucleotide transporter MRP4 (ABCC4) is highly expressed in human platelets and present in dense granules, indicating a role in mediator storage.", "journal": "Blood", "date": "2004", "authors": "Jedlitschky G, Tirschmann K, Lubenow LE, Nieuwenhuis HK, Akkerman JW, Greinacher A, Kroemer HK", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "15297306", "url": "https://glygen.org/publication/PubMed/15297306" } ] }, { "title": "C-terminal domain of insulin-like growth factor (IGF) binding protein-6: structure and interaction with IGF-II.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2004", "authors": "Headey SJ, Keizer DW, Yao S, Brasier G, Kantharidis P, Bach LA, Norton RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15308688", "url": "https://glygen.org/publication/PubMed/15308688" } ] }, { "title": "Characterization of insulin-like growth factor-free interaction between insulin-like growth factor binding protein 3 and acid labile subunit expressed from Xenopus oocytes.", "journal": "Journal of biochemistry and molecular biology", "date": "2004", "authors": "Choi KY, Kyung YJ, Lee CY, Lee DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15469690", "url": "https://glygen.org/publication/PubMed/15469690" } ] }, { "title": "Role of N- and C-terminal residues of insulin-like growth factor (IGF)-binding protein-3 in regulating IGF complex formation and receptor activation.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Yan X, Forbes BE, McNeil KA, Baxter RC, Firth SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15485880", "url": "https://glygen.org/publication/PubMed/15485880" } ] }, { "title": "Contributions of the N- and C-terminal domains of IGF binding protein-6 to IGF binding.", "journal": "Journal of molecular endocrinology", "date": "2004", "authors": "Headey SJ, Leeding KS, Norton RS, Bach LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15525596", "url": "https://glygen.org/publication/PubMed/15525596" } ] }, { "title": "Identity of an estrogen membrane receptor coupled to a G protein in human breast cancer cells.", "journal": "Endocrinology", "date": "2005", "authors": "Thomas P, Pang Y, Filardo EJ, Dong J", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "15539556", "url": "https://glygen.org/publication/PubMed/15539556" } ] }, { "title": "Structural basis for the regulation of insulin-like growth factors by IGF binding proteins.", "journal": "Structure (London, England : 1993)", "date": "2005", "authors": "Siwanowicz I, Popowicz GM, Wisniewska M, Huber R, Kuenkele KP, Lang K, Engh RA, Holak TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15642270", "url": "https://glygen.org/publication/PubMed/15642270" } ] }, { "title": "Cloning and characterization of a human angiotensin II type 1 receptor.", "journal": "Biochemical and biophysical research communications", "date": "1992", "authors": "Bergsma DJ, Ellis C, Kumar C, Nuthulaganti P, Kersten H, Elshourbagy N, Griffin E, Stadel JM, Aiyar N", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1567413", "url": "https://glygen.org/publication/PubMed/1567413" } ] }, { "title": "Characterization of GPRA, a novel G protein-coupled receptor related to asthma.", "journal": "American journal of respiratory cell and molecular biology", "date": "2005", "authors": "Vendelin J, Pulkkinen V, Rehn M, Pirskanen A, Raisanen-Sokolowski A, Laitinen A, Laitinen LA, Kere J, Laitinen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "15947423", "url": "https://glygen.org/publication/PubMed/15947423" } ] }, { "title": "The GAPs, GEFs, and GDIs of heterotrimeric G-protein alpha subunits.", "journal": "International journal of biological sciences", "date": "2005", "authors": "Siderovski DP, Willard FS", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "15951850", "url": "https://glygen.org/publication/PubMed/15951850" } ] }, { "title": "Cell signalling diversity of the Gqalpha family of heterotrimeric G proteins.", "journal": "Cellular signalling", "date": "2006", "authors": "Hubbard KB, Hepler JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "16182515", "url": "https://glygen.org/publication/PubMed/16182515" } ] }, { "title": "Characterization of the interaction between the A2 subunit and A1/A3-C1-C2 dimer in human factor VIIIa.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Fay PJ, Smudzin TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "1618828", "url": "https://glygen.org/publication/PubMed/1618828" } ] }, { "title": "Galphaq binds to p110alpha/p85alpha phosphoinositide 3-kinase and displaces Ras.", "journal": "The Biochemical journal", "date": "2006", "authors": "Ballou LM, Chattopadhyay M, Li Y, Scarlata S, Lin RZ", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "16268778", "url": "https://glygen.org/publication/PubMed/16268778" } ] }, { "title": "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.", "journal": "Journal of proteome research", "date": "2005", "authors": "Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042#ptm_processing" }, { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "reference": [ { "type": "PubMed", "id": "16335952", "url": "https://glygen.org/publication/PubMed/16335952" } ] }, { "title": "Snapshot of activated G proteins at the membrane: the Galphaq-GRK2-Gbetagamma complex.", "journal": "Science (New York, N.Y.)", "date": "2005", "authors": "Tesmer VM, Kawano T, Shankaranarayanan A, Kozasa T, Tesmer JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "16339447", "url": "https://glygen.org/publication/PubMed/16339447" } ] }, { "title": "Two distinct bombesin receptor subtypes are expressed and functional in human lung carcinoma cells.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Corjay MH, Dobrzanski DJ, Way JM, Viallet J, Shapira H, Worland P, Sausville EA, Battey JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1655761", "url": "https://glygen.org/publication/PubMed/1655761" } ] }, { "title": "The vertebrate phototransduction cascade: amplification and termination mechanisms.", "journal": "Reviews of physiology, biochemistry and pharmacology", "date": "2005", "authors": "Chen CK", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "16634148", "url": "https://glygen.org/publication/PubMed/16634148" } ] }, { "title": "Stable association between G alpha(q) and phospholipase C beta 1 in living cells.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Dowal L, Provitera P, Scarlata S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "16754659", "url": "https://glygen.org/publication/PubMed/16754659" } ] }, { "title": "Structural basis of function in heterotrimeric G proteins.", "journal": "Quarterly reviews of biophysics", "date": "2006", "authors": "Oldham WM, Hamm HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "16923326", "url": "https://glygen.org/publication/PubMed/16923326" } ] }, { "title": "The role of insulin-like growth factor binding proteins.", "journal": "Neuroendocrinology", "date": "2006", "authors": "Holly J, Perks C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17047378", "url": "https://glygen.org/publication/PubMed/17047378" } ] }, { "title": "Cloning and sequence analysis of a cDNA encoding human non-selective type of endothelin receptor.", "journal": "Biochemical and biophysical research communications", "date": "1991", "authors": "Nakamuta M, Takayanagi R, Sakai Y, Sakamoto S, Hagiwara H, Mizuno T, Saito Y, Hirose S, Yamamoto M, Nawata H", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1710450", "url": "https://glygen.org/publication/PubMed/1710450" } ] }, { "title": "Human galanin: primary structure and identification of two molecular forms.", "journal": "FEBS letters", "date": "1991", "authors": "Bersani M, Johnsen AH, Hojrup P, Dunning BE, Andreasen JJ, Holst JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1710578", "url": "https://glygen.org/publication/PubMed/1710578" } ] }, { "title": "Cloning and characterization of cDNA encoding human A-type endothelin receptor.", "journal": "Biochemical and biophysical research communications", "date": "1991", "authors": "Adachi M, Yang YY, Furuichi Y, Miyamoto C", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1719979", "url": "https://glygen.org/publication/PubMed/1719979" } ] }, { "title": "Isolation and primary structure of pituitary human galanin, a 30-residue nonamidated neuropeptide.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1991", "authors": "Schmidt WE, Kratzin H, Eckart K, Drevs D, Mundkowski G, Clemens A, Katsoulis S, Schafer H, Gallwitz B, Creutzfeldt W", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1722333", "url": "https://glygen.org/publication/PubMed/1722333" } ] }, { "title": "Quantitative analysis of insulin-like growth factor-modulated proteolysis of insulin-like growth factor binding protein-4 and -5 by pregnancy-associated plasma protein-A.", "journal": "Biochemistry", "date": "2007", "authors": "Gyrup C, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17249697", "url": "https://glygen.org/publication/PubMed/17249697" } ] }, { "title": "Glycoproteins V and Ib-IX form a noncovalent complex in the platelet membrane.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Modderman PW, Admiraal LG, Sonnenberg A, von dem Borne AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "1730602", "url": "https://glygen.org/publication/PubMed/1730602" } ] }, { "title": "Regulation of insulin-like growth factor (IGF) bioactivity by sequential proteolytic cleavage of IGF binding protein-4 and -5.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2007", "authors": "Laursen LS, Kjaer-Sorensen K, Andersen MH, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17312271", "url": "https://glygen.org/publication/PubMed/17312271" } ] }, { "title": "The pharmacokinetics, pharmacodynamics and tolerability of dabigatran etexilate, a new oral direct thrombin inhibitor, in healthy male subjects.", "journal": "British journal of clinical pharmacology", "date": "2007", "authors": "Stangier J, Rathgen K, Stahle H, Gansser D, Roth W", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "17506785", "url": "https://glygen.org/publication/PubMed/17506785" } ] }, { "title": "In-vitro profile and ex-vivo anticoagulant activity of the direct thrombin inhibitor dabigatran and its orally active prodrug, dabigatran etexilate.", "journal": "Thrombosis and haemostasis", "date": "2007", "authors": "Wienen W, Stassen JM, Priepke H, Ries UJ, Hauel N", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "17598008", "url": "https://glygen.org/publication/PubMed/17598008" } ] }, { "title": "Cooperativity of the N- and C-terminal domains of insulin-like growth factor (IGF) binding protein 2 in IGF binding.", "journal": "Biochemistry", "date": "2007", "authors": "Kuang Z, Yao S, McNeil KA, Thompson JA, Bach LA, Forbes BE, Wallace JC, Norton RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17985932", "url": "https://glygen.org/publication/PubMed/17985932" } ] }, { "title": "Bradykinin, a hypotensive and smooth muscle stimulating factor released from plasma globulin by snake venoms and by trypsin.", "journal": "The American journal of physiology", "date": "1949", "authors": "ROCHA E SILVA M, BERALDO WT, ROSENFELD G", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "18127230", "url": "https://glygen.org/publication/PubMed/18127230" } ] }, { "title": "Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Soundararajan M, Willard FS, Kimple AJ, Turnbull AP, Ball LJ, Schoch GA, Gileadi C, Fedorov OY, Dowler EF, Higman VA, Hutsell SQ, Sundstrom M, Doyle DA, Siderovski DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "18434541", "url": "https://glygen.org/publication/PubMed/18434541" } ] }, { "title": "The chemotactic receptor for human C5a anaphylatoxin.", "journal": "Nature", "date": "1991", "authors": "Gerard NP, Gerard C", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1847994", "url": "https://glygen.org/publication/PubMed/1847994" } ] }, { "title": "Galphaq binds two effectors separately in cells: evidence for predetermined signaling pathways.", "journal": "Biophysical journal", "date": "2008", "authors": "Golebiewska U, Scarlata S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "18515384", "url": "https://glygen.org/publication/PubMed/18515384" } ] }, { "title": "Dissociation of heterotrimeric g proteins in cells.", "journal": "Science signaling", "date": "2008", "authors": "Lambert NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "18577758", "url": "https://glygen.org/publication/PubMed/18577758" } ] }, { "title": "Assembly of high order G alpha q-effector complexes with RGS proteins.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Shankaranarayanan A, Thal DM, Tesmer VM, Roman DL, Neubig RR, Kozasa T, Tesmer JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "18936096", "url": "https://glygen.org/publication/PubMed/18936096" } ] }, { "title": "Human factor VIIIa subunit structure. Reconstruction of factor VIIIa from the isolated A1/A3-C1-C2 dimer and A2 subunit.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Fay PJ, Haidaris PJ, Smudzin TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "1902833", "url": "https://glygen.org/publication/PubMed/1902833" } ] }, { "title": "G alpha 16, a G protein alpha subunit specifically expressed in hematopoietic cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1991", "authors": "Amatruda TT 3rd, Steele DA, Slepak VZ, Simon MI", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "1905813", "url": "https://glygen.org/publication/PubMed/1905813" } ] }, { "title": "A strategy for precise and large scale identification of core fucosylated glycoproteins.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Jia W, Lu Z, Fu Y, Wang HP, Wang LH, Chi H, Yuan ZF, Zheng ZB, Song LN, Han HH, Liang YM, Wang JL, Cai Y, Zhang YK, Deng YL, Ying WT, He SM, Qian XH", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042#ptm_processing" }, { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "reference": [ { "type": "PubMed", "id": "19139490", "url": "https://glygen.org/publication/PubMed/19139490" } ] }, { "title": "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.", "journal": "Journal of proteome research", "date": "2009", "authors": "Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042#ptm_processing" }, { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "reference": [ { "type": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "title": "Inhibition of the thrombin-platelet reactions by DuP 714.", "journal": "Biochemical and biophysical research communications", "date": "1991", "authors": "Chiu AT, Mousa SA, Pease LJ, Roscoe WA, Bozarth JM, Reilly TM, Smith RD, Timmermans PB", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "1930190", "url": "https://glygen.org/publication/PubMed/1930190" } ] }, { "title": "Novel fucosylated biomarkers for the early detection of hepatocellular carcinoma.", "journal": "Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology", "date": "2009-06", "authors": "Wang Mengjun, Long Ronald E, Comunale Mary Ann, Junaidi Omer, Marrero Jorge, Di Bisceglie Adrian M, Block Timothy M, Mehta Anand S", "evidence": [ { "database": "GlyGen", "id": "A0470", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "19454616", "url": "https://glygen.org/publication/PubMed/19454616" } ] }, { "title": "An initial characterization of the serum phosphoproteome.", "journal": "Journal of proteome research", "date": "2009", "authors": "Zhou W, Ross MM, Tessitore A, Ornstein D, Vanmeter A, Liotta LA, Petricoin EF 3rd", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" }, { "database": "iPTMnet", "id": "P01042-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01042-1" } ], "reference": [ { "type": "PubMed", "id": "19824718", "url": "https://glygen.org/publication/PubMed/19824718" } ] }, { "title": "Enrichment of glycopeptides for glycan structure and attachment site identification.", "journal": "Nature methods", "date": "2009", "authors": "Nilsson J, Ruetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042#ptm_processing" }, { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" }, { "database": "UniCarbKB", "id": "P01042", "url": "" }, { "database": "GlyConnect", "id": "810", "url": "https://glyconnect.expasy.org/browser/proteins/810" } ], "reference": [ { "type": "PubMed", "id": "19838169", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "title": "Location of the disulfide bonds in human coagulation factor XI: the presence of tandem apple domains.", "journal": "Biochemistry", "date": "1991", "authors": "McMullen BA, Fujikawa K, Davie EW", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "1998667", "url": "https://glygen.org/publication/PubMed/1998667" } ] }, { "title": "Phosphoproteome analysis of human liver tissue by long-gradient nanoflow LC coupled with multiple stage MS analysis.", "journal": "Electrophoresis", "date": "2010", "authors": "Han G, Ye M, Liu H, Song C, Sun D, Wu Y, Jiang X, Chen R, Wang C, Wang L, Zou H", "evidence": [ { "database": "iPTMnet", "id": "P01042-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01042-1" } ], "reference": [ { "type": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" } ] }, { "title": "A comprehensive and non-prefractionation on the protein level approach for the human urinary proteome: touching phosphorylation in urine.", "journal": "Rapid communications in mass spectrometry : RCM", "date": "2010", "authors": "Li QR, Fan KX, Li RX, Dai J, Wu CC, Zhao SL, Wu JR, Shieh CH, Zeng R", "evidence": [ { "database": "iPTMnet", "id": "P01042-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01042-1" } ], "reference": [ { "type": "PubMed", "id": "20187088", "url": "https://glygen.org/publication/PubMed/20187088" } ] }, { "title": "Activation of human blood coagulation factor XI independent of factor XII. Factor XI is activated by thrombin and factor XIa in the presence of negatively charged surfaces.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Naito K, Fujikawa K", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "2019570", "url": "https://glygen.org/publication/PubMed/2019570" } ] }, { "title": "Ile-Ser-bradykinin is an aberrant permeability factor in various human malignant effusions.", "journal": "Biological chemistry Hoppe-Seyler", "date": "1990", "authors": "Wunderer G, Walter I, Eschenbacher B, Lang M, Kellermann J, Kindermann G", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "reference": [ { "type": "PubMed", "id": "2076202", "url": "https://glygen.org/publication/PubMed/2076202" } ] }, { "title": "Binding of human factor VIII to phospholipid vesicles.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Gilbert GE, Furie BC, Furie B", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "2104832", "url": "https://glygen.org/publication/PubMed/2104832" } ] }, { "title": "Kinetics of coagulation factor X activation by platelet-bound factor IXa.", "journal": "Biochemistry", "date": "1990", "authors": "Rawala-Sheikh R, Ahmad SS, Ashby B, Walsh PN", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "2110473", "url": "https://glygen.org/publication/PubMed/2110473" } ] }, { "title": "Analysis of serpin secretion, misfolding, and surveillance in the endoplasmic reticulum.", "journal": "Methods in enzymology", "date": "2011", "authors": "Pan S, Iannotti MJ, Sifers RN", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "21683246", "url": "https://glygen.org/publication/PubMed/21683246" } ] }, { "title": "Desirudin: a review of the pharmacology and clinical application for the prevention of deep vein thrombosis.", "journal": "Expert review of cardiovascular therapy", "date": "2011", "authors": "Graetz TJ, Tellor BR, Smith JR, Avidan MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "21932952", "url": "https://glygen.org/publication/PubMed/21932952" } ] }, { "title": "A sequential mechanism for exosite-mediated factor IX activation by factor XIa.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Geng Y, Verhamme IM, Messer A, Sun MF, Smith SB, Bajaj SP, Gailani D", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "22961984", "url": "https://glygen.org/publication/PubMed/22961984" } ] }, { "title": "Quantification of the N-glycosylated secretome by super-SILAC during breast cancer progression and in human blood samples.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Boersema PJ, Geiger T, Wisniewski JR, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "23090970", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "title": "Evolutionary analysis of the contact system indicates that kininogen evolved adaptively in mammals and in human populations.", "journal": "Molecular biology and evolution", "date": "2013", "authors": "Cagliani R, Forni D, Riva S, Pozzoli U, Colleoni M, Bresolin N, Clerici M, Sironi M", "evidence": [ { "database": "RefSeq", "id": "NP_000884", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000884" } ], "reference": [ { "type": "PubMed", "id": "23505046", "url": "https://glygen.org/publication/PubMed/23505046" } ] }, { "title": "High precision platelet releasate definition by quantitative reversed protein profiling--brief report.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2013", "authors": "Wijten P, van Holten T, Woo LL, Bleijerveld OB, Roest M, Heck AJ, Scholten A", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "23640497", "url": "https://glygen.org/publication/PubMed/23640497" } ] }, { "title": "GPR37 and GPR37L1 are receptors for the neuroprotective and glioprotective factors prosaptide and prosaposin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Meyer RC, Giddens MM, Schaefer SA, Hall RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "23690594", "url": "https://glygen.org/publication/PubMed/23690594" } ] }, { "title": "Clot-bound thrombin is protected from inhibition by heparin-antithrombin III but is susceptible to inactivation by antithrombin III-independent inhibitors.", "journal": "The Journal of clinical investigation", "date": "1990", "authors": "Weitz JI, Hudoba M, Massel D, Maraganore J, Hirsh J", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "2384594", "url": "https://glygen.org/publication/PubMed/2384594" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "iPTMnet", "id": "P01042", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01042" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "Computational framework for identification of intact glycopeptides in complex samples.", "journal": "Analytical chemistry", "date": "2014", "authors": "Mayampurath A, Yu CY, Song E, Balan J, Mechref Y, Tang H", "evidence": [ { "database": "UniCarbKB", "id": "P01042", "url": "" }, { "database": "GlyConnect", "id": "810", "url": "https://glyconnect.expasy.org/browser/proteins/810" } ], "reference": [ { "type": "PubMed", "id": "24279413", "url": "https://glygen.org/publication/PubMed/24279413" } ] }, { "title": "Glycomic analysis of high density lipoprotein shows a highly sialylated particle.", "journal": "Journal of proteome research", "date": "2014", "authors": "Huang J, Lee H, Zivkovic AM, Smilowitz JT, Rivera N, German JB, Lebrilla CB", "evidence": [ { "database": "GlyConnect", "id": "810", "url": "https://glyconnect.expasy.org/browser/proteins/810" } ], "reference": [ { "type": "PubMed", "id": "24417605", "url": "https://glygen.org/publication/PubMed/24417605" } ] }, { "title": "Selective glycopeptide profiling by acetone enrichment and LC/MS.", "journal": "Journal of proteomics", "date": "2014", "authors": "Takakura D, Harazono A, Hashii N, Kawasaki N", "evidence": [ { "database": "GlyConnect", "id": "810", "url": "https://glyconnect.expasy.org/browser/proteins/810" } ], "reference": [ { "type": "PubMed", "id": "24530628", "url": "https://glygen.org/publication/PubMed/24530628" } ] }, { "title": "Structure of the Mr 140,000 growth hormone-dependent insulin-like growth factor binding protein complex: determination by reconstitution and affinity-labeling.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Baxter RC, Martin JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "2476804", "url": "https://glygen.org/publication/PubMed/2476804" } ] }, { "title": "Cloning, sequence analysis and expression of a cDNA encoding a novel insulin-like growth factor binding protein (IGFBP-2).", "journal": "The EMBO journal", "date": "1989", "authors": "Binkert C, Landwehr J, Mary JL, Schwander J, Heinrich G", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "2479552", "url": "https://glygen.org/publication/PubMed/2479552" } ] }, { "title": "Pharmacokinetic-pharmacodynamic relationships of macitentan, a new endothelin receptor antagonist, after multiple dosing in healthy Korean subjects.", "journal": "American journal of cardiovascular drugs : drugs, devices, and other interventions", "date": "2014", "authors": "Ahn LY, Kim SE, Yi S, Dingemanse J, Lim KS, Jang IJ, Yu KS", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "24906252", "url": "https://glygen.org/publication/PubMed/24906252" } ] }, { "title": "In situ-generated thrombin is the only enzyme that effectively activates factor VIII and factor V in thromboplastin-activated plasma.", "journal": "Blood", "date": "1989", "authors": "Pieters J, Lindhout T, Hemker HC", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "2502206", "url": "https://glygen.org/publication/PubMed/2502206" } ] }, { "title": "Differential proteolytic activation of factor VIII-von Willebrand factor complex by thrombin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Hill-Eubanks DC, Parker CG, Lollar P", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "2505252", "url": "https://glygen.org/publication/PubMed/2505252" } ] }, { "title": "Protein and site specificity of fucosylation in liver-secreted glycoproteins.", "journal": "Journal of proteome research", "date": "2014", "authors": "Pompach P, Ashline DJ, Brnakova Z, Benicky J, Sanda M, Goldman R", "evidence": [ { "database": "GlyConnect", "id": "810", "url": "https://glyconnect.expasy.org/browser/proteins/810" } ], "reference": [ { "type": "PubMed", "id": "25265424", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "title": "Alpha transducin is present in blue-, green-, and red-sensitive cone photoreceptors in the human retina.", "journal": "Neuron", "date": "1989", "authors": "Lerea CL, Bunt-Milam AH, Hurley JB", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "2534964", "url": "https://glygen.org/publication/PubMed/2534964" } ] }, { "title": "The regulation of human factor XIIa by plasma proteinase inhibitors.", "journal": "The Journal of biological chemistry", "date": "1985", "authors": "Pixley RA, Schapira M, Colman RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "2578463", "url": "https://glygen.org/publication/PubMed/2578463" } ] }, { "title": "Distribution of plasma kallikrein between C-1 inactivator and alpha 2-macroglobulin in plasma utilizing a new assay for alpha 2-macroglobulin-kallikrein complexes.", "journal": "The Journal of biological chemistry", "date": "1985", "authors": "Harpel PC, Lewin MF, Kaplan AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "2579948", "url": "https://glygen.org/publication/PubMed/2579948" } ] }, { "title": "A Single Kinase Generates the Majority of the Secreted Phosphoproteome.", "journal": "Cell", "date": "2015", "authors": "Tagliabracci VS, Wiley SE, Guo X, Kinch LN, Durrant E, Wen J, Xiao J, Cui J, Nguyen KB, Engel JL, Coon JJ, Grishin N, Pinna LA, Pagliarini DJ, Dixon JE", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" }, { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" }, { "database": "iPTMnet", "id": "P01042", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01042" } ], "reference": [ { "type": "PubMed", "id": "26091039", "url": "https://glygen.org/publication/PubMed/26091039" } ] }, { "title": "Factor VIII Is Synthesized in Human Endothelial Cells, Packaged in Weibel-Palade Bodies and Secreted Bound to ULVWF Strings.", "journal": "PloS one", "date": "2015", "authors": "Turner NA, Moake JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "26473492", "url": "https://glygen.org/publication/PubMed/26473492" } ] }, { "title": "The human endothelin family: three structurally and pharmacologically distinct isopeptides predicted by three separate genes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Inoue A, Yanagisawa M, Kimura S, Kasuya Y, Miyauchi T, Goto K, Masaki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "2649896", "url": "https://glygen.org/publication/PubMed/2649896" } ] }, { "title": "Site-specific O-Glycosylation Analysis of Human Blood Plasma Proteins.", "journal": "Molecular & cellular proteomics : MCP", "date": "2016", "authors": "Hoffmann M, Marx K, Reichl U, Wuhrer M, Rapp E", "evidence": [ { "database": "UniCarbKB", "id": "P01042", "url": "" } ], "reference": [ { "type": "PubMed", "id": "26598643", "url": "https://glygen.org/publication/PubMed/26598643" } ] }, { "title": "Nucleotide sequence for a cDNA encoding the alpha subunit of retinal transducin (GNAT1) isolated from the human eye.", "journal": "Nucleic acids research", "date": "1989", "authors": "Van Dop C, Medynski DC, Apone LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "2748346", "url": "https://glygen.org/publication/PubMed/2748346" } ] }, { "title": "Preparation and preliminary characterization of recombinant neurolysin for in vivo studies.", "journal": "Journal of biotechnology", "date": "2016", "authors": "Wangler NJ, Jayaraman S, Zhu R, Mechref Y, Abbruscato TJ, Bickel U, Karamyan VT", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "27496565", "url": "https://glygen.org/publication/PubMed/27496565" } ] }, { "title": "Proteomics Analysis of O-GalNAc Glycosylation in Human Serum by an Integrated Strategy.", "journal": "Analytical chemistry", "date": "2017", "authors": "Qin H, Cheng K, Zhu J, Mao J, Wang F, Dong M, Chen R, Guo Z, Liang X, Ye M, Zou H", "evidence": [ { "database": "UniCarbKB", "id": "P01042", "url": "" } ], "reference": [ { "type": "PubMed", "id": "28035807", "url": "https://glygen.org/publication/PubMed/28035807" } ] }, { "title": "Purification and properties of prolylcarboxypeptidase (angiotensinase C) from human kidney.", "journal": "The Journal of biological chemistry", "date": "1978", "authors": "Odya CE, Marinkovic DV, Hammon KJ, Stewart TA, Erdos EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "28321", "url": "https://glygen.org/publication/PubMed/28321" } ] }, { "title": "Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Itoh H, Toyama R, Kozasa T, Tsukamoto T, Matsuoka M, Kaziro Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "2834384", "url": "https://glygen.org/publication/PubMed/2834384" } ] }, { "title": "Purification and characterization of membrane-bound phospholipase C specific for phosphoinositides from human platelets.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Banno Y, Yada Y, Nozawa Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "2841328", "url": "https://glygen.org/publication/PubMed/2841328" } ] }, { "title": "An update on factor XI structure and function.", "journal": "Thrombosis research", "date": "2018", "authors": "Mohammed BM, Matafonov A, Ivanov I, Sun MF, Cheng Q, Dickeson SK, Li C, Sun D, Verhamme IM, Emsley J, Gailani D", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "29223926", "url": "https://glygen.org/publication/PubMed/29223926" } ] }, { "title": "Large-scale intact glycopeptide identification by Mascot database search.", "journal": "Scientific reports", "date": "2018", "authors": "Bollineni RC, Koehler CJ, Gislefoss RE, Anonsen JH, Thiede B", "evidence": [ { "database": "GlyConnect", "id": "810", "url": "https://glyconnect.expasy.org/browser/proteins/810" } ], "reference": [ { "type": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "title": "Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and alpha-1B-Glycoprotein.", "journal": "Analytical chemistry", "date": "2018", "authors": "Sun S, Hu Y, Jia L, Eshghi ST, Liu Y, Shah P, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P01042", "url": "" }, { "database": "GlyConnect", "id": "810", "url": "https://glyconnect.expasy.org/browser/proteins/810" } ], "reference": [ { "type": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "GlyConnect", "id": "810", "url": "https://glyconnect.expasy.org/browser/proteins/810" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "Cloning and sequence analysis of cDNAs for human high molecular weight and low molecular weight prekininogens. Primary structures of two human prekininogens.", "journal": "J. Biol. Chem.", "date": "1985", "authors": "Takagaki Y, Kitamura N, Nakanishi S", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "reference": [ { "type": "PubMed", "id": "2989293", "url": "https://glygen.org/publication/PubMed/2989293" } ] }, { "title": "Structural organization of the human kininogen gene and a model for its evolution.", "journal": "J. Biol. Chem.", "date": "1985", "authors": "Kitamura N, Kitagawa H, Fukushima D, Takagaki Y, Miyata T, Nakanishi S", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "reference": [ { "type": "PubMed", "id": "2989294", "url": "https://glygen.org/publication/PubMed/2989294" } ] }, { "title": "Binding of coagulation factor XI to washed human platelets.", "journal": "Biochemistry", "date": "1986", "authors": "Greengard JS, Heeb MJ, Ersdal E, Walsh PN, Griffin JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "3017409", "url": "https://glygen.org/publication/PubMed/3017409" } ] }, { "title": "Distinct urinary glycoprotein signatures in prostate cancer patients.", "journal": "Oncotarget", "date": "2018", "authors": "Kawahara R, Ortega F, Rosa-Fernandes L, Guimaraes V, Quina D, Nahas W, Schwammle V, Srougi M, Leite KRM, Thaysen-Andersen M, Larsen MR, Palmisano G", "evidence": [ { "database": "GlyConnect", "id": "810", "url": "https://glyconnect.expasy.org/browser/proteins/810" } ], "reference": [ { "type": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "title": "Mapping the O-glycoproteome using site-specific extraction of O-linked glycopeptides (EXoO).", "journal": "Molecular systems biology", "date": "2018", "authors": "Yang W, Ao M, Hu Y, Li QK, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P01042", "url": "" } ], "reference": [ { "type": "PubMed", "id": "30459171", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "title": "Proteolytic processing of human factor VIII. Correlation of specific cleavages by thrombin, factor Xa, and activated protein C with activation and inactivation of factor VIII coagulant activity.", "journal": "Biochemistry", "date": "1986", "authors": "Eaton D, Rodriguez H, Vehar GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "3082357", "url": "https://glygen.org/publication/PubMed/3082357" } ] }, { "title": "The influence of bound GDP on the kinetics of guanine nucleotide binding to G proteins.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Ferguson KM, Higashijima T, Smigel MD, Gilman AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "3086311", "url": "https://glygen.org/publication/PubMed/3086311" } ] }, { "title": "Biosynthesis of complement C1 inhibitor by Hep G2 cells. Reactivity of different glycosylated forms of the inhibitor with C1s.", "journal": "The Biochemical journal", "date": "1986", "authors": "Prandini MH, Reboul A, Colomb MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "3099750", "url": "https://glygen.org/publication/PubMed/3099750" } ] }, { "title": "Hereditary angioedema cosegregating with a novel kininogen 1 gene mutation changing the N-terminal cleavage site of bradykinin.", "journal": "Allergy", "date": "2019", "authors": "Bork K, Wulff K, Rossmann H, Steinmuller-Magin L, Braenne I, Witzke G, Hardt J", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "reference": [ { "type": "PubMed", "id": "31087670", "url": "https://glygen.org/publication/PubMed/31087670" } ] }, { "title": "A Novel Mass Spectrometry Platform for Multiplexed N-Glycoprotein Biomarker Discovery from Patient Biofluids by Antibody Panel Based N-Glycan Imaging.", "journal": "Analytical chemistry", "date": "2019-07-02", "authors": "Black Alyson P, Liang Hongyan, West Connor A, Wang Mengjun, Herrera Harmin P, Haab Brian B, Angel Peggi M, Drake Richard R, Mehta Anand S", "evidence": [ { "database": "GlyGen", "id": "A0245", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "31177770", "url": "https://glygen.org/publication/PubMed/31177770" } ] }, { "title": "Synthesis, processing, and secretion of recombinant human factor VIII expressed in mammalian cells.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Kaufman RJ, Wasley LC, Dorner AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "3129422", "url": "https://glygen.org/publication/PubMed/3129422" } ] }, { "title": "Association of the factor VIII light chain with von Willebrand factor.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Lollar P, Hill-Eubanks DC, Parker CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "3134349", "url": "https://glygen.org/publication/PubMed/3134349" } ] }, { "title": "Antibody Panel Based N-Glycan Imaging for N-Glycoprotein Biomarker Discovery.", "journal": "Current protocols in protein science", "date": "2019-12", "authors": "Black Alyson P, Angel Peggi M, Drake Richard R, Mehta Anand S", "evidence": [ { "database": "GlyGen", "id": "A0245", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "31721442", "url": "https://glygen.org/publication/PubMed/31721442" } ] }, { "title": "Purification and identification of [hydroxyprolyl3]bradykinin in ascitic fluid from a patient with gastric cancer.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Maeda H, Matsumura Y, Kato H", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "reference": [ { "type": "PubMed", "id": "3182782", "url": "https://glygen.org/publication/PubMed/3182782" } ] }, { "title": "Isolation and primary structure of human peptide YY.", "journal": "Biochemical and biophysical research communications", "date": "1988", "authors": "Tatemoto K, Nakano I, Makk G, Angwin P, Mann M, Schilling J, Go VL", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "3202875", "url": "https://glygen.org/publication/PubMed/3202875" } ] }, { "title": "Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes.", "journal": "Journal of proteome research", "date": "2020", "authors": "Zhu J, Lin YH, Dingess KA, Mank M, Stahl B, Heck AJR", "evidence": [ { "database": "GlyConnect", "id": "810", "url": "https://glyconnect.expasy.org/browser/proteins/810" } ], "reference": [ { "type": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "title": "Deciphering the Genetics of Primary Angioedema with Normal Levels of C1 Inhibitor.", "journal": "Journal of clinical medicine", "date": "2020", "authors": "Loules G, Parsopoulou F, Zamanakou M, Csuka D, Bova M, Gonzalez-Quevedo T, Psarros F, Porebski G, Speletas M, Firinu D, Del Giacco S, Suffritti C, Makris M, Vatsiou S, Zanichelli A, Farkas H, Germenis AE", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "reference": [ { "type": "PubMed", "id": "33114181", "url": "https://glygen.org/publication/PubMed/33114181" } ] }, { "title": "Isolation and identification of hydroxyproline analogues of bradykinin in human urine.", "journal": "FEBS letters", "date": "1988", "authors": "Kato H, Matsumura Y, Maeda H", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" }, { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "3366244", "url": "https://glygen.org/publication/PubMed/3366244" } ] }, { "title": "Plasmin-mediated cleavage of high-molecular-weight kininogen contributes to acetaminophen-induced acute liver failure.", "journal": "Blood", "date": "2021", "authors": "Henderson MW, Sparkenbaugh EM, Wang S, Ilich A, Noubouossie DF, Mailer R, Renne T, Flick MJ, Luyendyk JP, Chen ZL, Strickland S, Stravitz RT, McCrae KR, Key NS, Pawlinski R", "evidence": [ { "database": "RefSeq", "id": "NP_000884", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000884" } ], "reference": [ { "type": "PubMed", "id": "33827130", "url": "https://glygen.org/publication/PubMed/33827130" } ] }, { "title": "gC1qR Antibody Can Modulate Endothelial Cell Permeability in Angioedema.", "journal": "Inflammation", "date": "2022", "authors": "Fandaros M, Joseph K, Kaplan AP, Rubenstein DA, Ghebrehiwet B, Yin W", "evidence": [ { "database": "RefSeq", "id": "NP_000884", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000884" } ], "reference": [ { "type": "PubMed", "id": "34494203", "url": "https://glygen.org/publication/PubMed/34494203" } ] }, { "title": "Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis.", "journal": "Nature methods", "date": "2021", "authors": "Kawahara R, Chernykh A, Alagesan K, Bern M, Cao W, Chalkley RJ, Cheng K, Choo MS, Edwards N, Goldman R, Hoffmann M, Hu Y, Huang Y, Kim JY, Kletter D, Liquet B, Liu M, Mechref Y, Meng B, Neelamegham S, Nguyen-Khuong T, Nilsson J, Pap A, Park GW, Parker BL, Pegg CL, Penninger JM, Phung TK, Pioch M, Rapp E, Sakalli E, Sanda M, Schulz BL, Scott NE, Sofronov G, Stadlmann J, Vakhrushev SY, Woo CM, Wu HY, Yang P, Ying W, Zhang H, Zhang Y, Zhao J, Zaia J, Haslam SM, Palmisano G, Yoo JS, Larson G, Khoo KH, Medzihradszky KF, Kolarich D, Packer NH, Thaysen-Andersen M", "evidence": [ { "database": "GlyConnect", "id": "810", "url": "https://glyconnect.expasy.org/browser/proteins/810" } ], "reference": [ { "type": "PubMed", "id": "34725484", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "title": "Completion of the primary structure of human high-molecular-mass kininogen. The amino acid sequence of the entire heavy chain and evidence for its evolution by gene triplication.", "journal": "European journal of biochemistry", "date": "1986", "authors": "Kellermann J, Lottspeich F, Henschen A, Muller-Esterl W", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042#ptm_processing" }, { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" }, { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "3484703", "url": "https://glygen.org/publication/PubMed/3484703" } ] }, { "title": "Human plasma prekallikrein, a zymogen to a serine protease that contains four tandem repeats.", "journal": "Biochemistry", "date": "1986", "authors": "Chung DW, Fujikawa K, McMullen BA, Davie EW", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "3521732", "url": "https://glygen.org/publication/PubMed/3521732" } ] }, { "title": "Amino acid sequence of human von Willebrand factor.", "journal": "Biochemistry", "date": "1986", "authors": "Titani K, Kumar S, Takio K, Ericsson LH, Wade RD, Ashida K, Walsh KA, Chopek MW, Sadler JE, Fujikawa K", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "3524673", "url": "https://glygen.org/publication/PubMed/3524673" } ] }, { "title": "Purification and characterization of a novel neurotensin-degrading peptidase from rat brain synaptic membranes.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Checler F, Vincent JP, Kitabgi P", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "3525564", "url": "https://glygen.org/publication/PubMed/3525564" } ] }, { "title": "High preoperative bradykinin level is a risk factor for severe postoperative hypoxaemia in acute aortic dissection surgery.", "journal": "Experimental physiology", "date": "2023-03-19", "authors": "Guan XinLiang, Li Lei, Li JinZhang, Jiang WenJian, Li HaiYang, Wang XiaoLong, Han Lu, Liu YuYong, Gong Ming, Zhang HongJia", "evidence": [ { "database": "RefSeq", "id": "NP_000884", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000884" } ], "reference": [ { "type": "PubMed", "id": "36934370", "url": "https://glygen.org/publication/PubMed/36934370" } ] }, { "title": "Expression, purification, and characterization of recombinant gamma-carboxylated factor IX synthesized in Chinese hamster ovary cells.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Kaufman RJ, Wasley LC, Furie BC, Furie B, Shoemaker CB", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "3733688", "url": "https://glygen.org/publication/PubMed/3733688" } ] }, { "title": "An HBV susceptibility variant of KNG1 modulates the therapeutic effects of interferons \u03b1 and \u03bb1 in HBV infection by promoting MAVS lysosomal degradation.", "journal": "EBioMedicine", "date": "2023-08", "authors": "Zhang Bin, Han Haijun, Zhao Xinyi, Li Andria N, Wang Yan, Yuan Wenji, Yang Zhongli, Li Ming D", "evidence": [ { "database": "RefSeq", "id": "NP_000884", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000884" } ], "reference": [ { "type": "PubMed", "id": "37442062", "url": "https://glygen.org/publication/PubMed/37442062" } ] }, { "title": "Human C1 inhibitor: primary structure, cDNA cloning, and chromosomal localization.", "journal": "Biochemistry", "date": "1986", "authors": "Bock SC, Skriver K, Nielsen E, Thogersen HC, Wiman B, Donaldson VH, Eddy RL, Marrinan J, Radziejewska E, Huber R, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "3756141", "url": "https://glygen.org/publication/PubMed/3756141" } ] }, { "title": "Bradykinin receptor expression and bradykinin-mediated sensitization of human sensory neurons.", "journal": "Pain", "date": "2024-01-01", "authors": "Yi Jiwon, Bertels Zachariah, Del Rosario John Smith, Widman Allie J, Slivicki Richard A, Payne Maria, Susser Henry M, Copits Bryan A, Gereau Robert W", "evidence": [ { "database": "RefSeq", "id": "NP_000884", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000884" } ], "reference": [ { "type": "PubMed", "id": "37703419", "url": "https://glygen.org/publication/PubMed/37703419" } ] }, { "title": "Human Ile-Ser-bradykinin, identical with rat T-kinin, is a major permeability factor in ovarian carcinoma ascites.", "journal": "Biological chemistry Hoppe-Seyler", "date": "1986", "authors": "Wunderer G, Walter I, Muller E, Henschen A", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "reference": [ { "type": "PubMed", "id": "3828072", "url": "https://glygen.org/publication/PubMed/3828072" } ] }, { "title": "Molecular cloning of the human cholecystokinin gene by use of a synthetic probe containing deoxyinosine.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1985", "authors": "Takahashi Y, Kato K, Hayashizaki Y, Wakabayashi T, Ohtsuka E, Matsuki S, Ikehara M, Matsubara K", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "3856870", "url": "https://glygen.org/publication/PubMed/3856870" } ] }, { "title": "Amino acid sequence of the heavy chain of human alpha-factor XIIa (activated Hageman factor).", "journal": "The Journal of biological chemistry", "date": "1985", "authors": "McMullen BA, Fujikawa K", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "3886654", "url": "https://glygen.org/publication/PubMed/3886654" } ] }, { "title": "The amino acid sequence of the light chain of human high-molecular-mass kininogen.", "journal": "European journal of biochemistry", "date": "1985", "authors": "Lottspeich F, Kellermann J, Henschen A, Foertsch B, Muller-Esterl W", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042#ptm_processing" }, { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" }, { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "4054110", "url": "https://glygen.org/publication/PubMed/4054110" } ] }, { "title": "The inhibition of plasmin, plasma kallikrein, plasma permeability factor, and the C'1r subcomponent of the first component of complement by serum C'1 esterase inhibitor.", "journal": "The Journal of experimental medicine", "date": "1969", "authors": "Ratnoff OD, Pensky J, Ogston D, Naff GB", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "4178758", "url": "https://glygen.org/publication/PubMed/4178758" } ] }, { "title": "A dipeptidyl carboxypeptidase that converts angiotensin I and inactivates bradykinin.", "journal": "Biochimica et biophysica acta", "date": "1970", "authors": "Yang HY, Erdos EG, Levin Y", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "reference": [ { "type": "PubMed", "id": "4322742", "url": "https://glygen.org/publication/PubMed/4322742" } ] }, { "title": "Inhibition by C1INH of Hagemann factor fragment activation of coagulation, fibrinolysis, and kinin generation.", "journal": "The Journal of clinical investigation", "date": "1973", "authors": "Schreiber AD, Kaplan AP, Austen KF", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "4703226", "url": "https://glygen.org/publication/PubMed/4703226" } ] }, { "title": "Structural features of plasma kinins and kininogens.", "journal": "Fed. Proc.", "date": "1968", "authors": "Pierce J V", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "reference": [ { "type": "PubMed", "id": "4952632", "url": "https://glygen.org/publication/PubMed/4952632" } ] }, { "title": "Human high molecular weight kininogen. Studies of structure-function relationships and of proteolysis of the molecule occurring during contact activation of plasma.", "journal": "The Journal of biological chemistry", "date": "1979", "authors": "Kerbiriou DM, Griffin JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "500690", "url": "https://glygen.org/publication/PubMed/500690" } ] }, { "title": "Activation of human factor XI (plasma thromboplastin antecedent) by factor XIIa (activated Hageman factor).", "journal": "Biochemistry", "date": "1977", "authors": "Kurachi K, Davie EW", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "588558", "url": "https://glygen.org/publication/PubMed/588558" } ] }, { "title": "Second kininase in human blood plasma.", "journal": "Nature", "date": "1967", "authors": "Yang HY, Erdos EG", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "reference": [ { "type": "PubMed", "id": "6055465", "url": "https://glygen.org/publication/PubMed/6055465" } ] }, { "title": "Primary structure of human alpha 2-macroglobulin. V. The complete structure.", "journal": "The Journal of biological chemistry", "date": "1984", "authors": "Sottrup-Jensen L, Stepanik TM, Kristensen T, Wierzbicki DM, Jones CM, Lonblad PB, Magnusson S, Petersen TE", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "6203908", "url": "https://glygen.org/publication/PubMed/6203908" } ] }, { "title": "Isolation and structural organization of the human corticotropin--beta-lipotropin precursor gene.", "journal": "FEBS letters", "date": "1981", "authors": "Takahashi H, Teranishi Y, Nakanishi S, Numa S", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "6274691", "url": "https://glygen.org/publication/PubMed/6274691" } ] }, { "title": "Isolation and structural organization of the human preproenkephalin gene.", "journal": "Nature", "date": "1982", "authors": "Noda M, Teranishi Y, Takahashi H, Toyosato M, Notake M, Nakanishi S, Numa S", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "6281660", "url": "https://glygen.org/publication/PubMed/6281660" } ] }, { "title": "Binding of human blood-coagulation Factors IXa and X to phospholipid membranes.", "journal": "The Biochemical journal", "date": "1984", "authors": "Mertens K, Cupers R, Van Wijngaarden A, Bertina RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "6334516", "url": "https://glygen.org/publication/PubMed/6334516" } ] }, { "title": "A cDNA encoding a small common precursor for human pancreatic polypeptide and pancreatic icosapeptide.", "journal": "The EMBO journal", "date": "1984", "authors": "Boel E, Schwartz TW, Norris KE, Fiil NP", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "6373251", "url": "https://glygen.org/publication/PubMed/6373251" } ] }, { "title": "Structure of human factor VIII.", "journal": "Nature", "date": "1984", "authors": "Vehar GA, Keyt B, Eaton D, Rodriguez H, O'Brien DP, Rotblat F, Oppermann H, Keck R, Wood WI, Harkins RN, Tuddenham EG, Lawn RM, Capon DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "6438527", "url": "https://glygen.org/publication/PubMed/6438527" } ] }, { "title": "Isolation of a human cDNA for alpha 2-thiol proteinase inhibitor and its identity with low molecular weight kininogen.", "journal": "Biochemistry", "date": "1984", "authors": "Ohkubo I, Kurachi K, Takasawa T, Shiokawa H, Sasaki M", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "reference": [ { "type": "PubMed", "id": "6441591", "url": "https://glygen.org/publication/PubMed/6441591" } ] }, { "title": "Characterization of the proteins of isolated human platelet alpha-granules. Evidence for a separate alpha-granule-pool of the glycoproteins IIb and IIIa.", "journal": "Biochimica et biophysica acta", "date": "1981", "authors": "Gogstad GO, Hagen I, Korsmo R, Solum NO", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "6457647", "url": "https://glygen.org/publication/PubMed/6457647" } ] }, { "title": "Cloning, characterization, and DNA sequence of a human cDNA encoding neuropeptide tyrosine.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1984", "authors": "Minth CD, Bloom SR, Polak JM, Dixon JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "6589611", "url": "https://glygen.org/publication/PubMed/6589611" } ] }, { "title": "Amino acid sequence of human beta-factor XIIa.", "journal": "The Journal of biological chemistry", "date": "1983", "authors": "Fujikawa K, McMullen BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "6604055", "url": "https://glygen.org/publication/PubMed/6604055" } ] }, { "title": "Primary structure of the human Met- and Leu-enkephalin precursor and its mRNA.", "journal": "Nature", "date": "1982", "authors": "Comb M, Seeburg PH, Adelman J, Eiden L, Herbert E", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "7057924", "url": "https://glygen.org/publication/PubMed/7057924" } ] }, { "title": "Autoactivation of human Hageman factor. Demonstration utilizing a synthetic substrate.", "journal": "The Journal of biological chemistry", "date": "1980", "authors": "Silverberg M, Dunn JT, Garen L, Kaplan AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "7391081", "url": "https://glygen.org/publication/PubMed/7391081" } ] }, { "title": "Heparin, heparan sulfate, and dermatan sulfate regulate formation of the insulin-like growth factor-I and insulin-like growth factor-binding protein complexes.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Arai T, Parker A, Busby W Jr, Clemmons DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7519608", "url": "https://glygen.org/publication/PubMed/7519608" } ] }, { "title": "Matrix metalloproteinases degrade insulin-like growth factor-binding protein-3 in dermal fibroblast cultures.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Fowlkes JL, Enghild JJ, Suzuki K, Nagase H", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7523391", "url": "https://glygen.org/publication/PubMed/7523391" } ] }, { "title": "Molecular cloning of a functional human galanin receptor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Habert-Ortoli E, Amiranoff B, Loquet I, Laburthe M, Mayaux JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "7524088", "url": "https://glygen.org/publication/PubMed/7524088" } ] }, { "title": "Recombinant human insulin-like growth factor (IGF)-binding protein-6 inhibits IGF-II-induced differentiation of L6A1 myoblasts.", "journal": "Endocrinology", "date": "1994", "authors": "Bach LA, Hsieh S, Brown AL, Rechler MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7525263", "url": "https://glygen.org/publication/PubMed/7525263" } ] }, { "title": "Identification of insulin-like growth factor-binding protein-3 (IGFBP-3) fragments and IGFBP-5 proteolytic activity in human seminal plasma: a comparison of normal and vasectomized patients.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1994", "authors": "Lee KO, Oh Y, Giudice LC, Cohen P, Peehl DM, Rosenfeld RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7525634", "url": "https://glygen.org/publication/PubMed/7525634" } ] }, { "title": "Biological effects of prostate specific antigen as an insulin-like growth factor binding protein-3 protease.", "journal": "The Journal of endocrinology", "date": "1994", "authors": "Cohen P, Peehl DM, Graves HC, Rosenfeld RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7525824", "url": "https://glygen.org/publication/PubMed/7525824" } ] }, { "title": "Interactions between insulin-like growth factor-I (IGF-I) and the system of plasminogen activators and their inhibitors in the control of IGF-binding protein-3 production and proteolysis in human osteosarcoma cells.", "journal": "Endocrinology", "date": "1994", "authors": "Lalou C, Silve C, Rosato R, Segovia B, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7527330", "url": "https://glygen.org/publication/PubMed/7527330" } ] }, { "title": "Biochemical analysis of prostate specific antigen-proteolyzed insulin-like growth factor binding protein-3.", "journal": "Growth regulation", "date": "1994", "authors": "Fielder PJ, Rosenfeld RG, Graves HC, Grandbois K, Maack CA, Sawamura S, Ogawa Y, Sommer A, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7538844", "url": "https://glygen.org/publication/PubMed/7538844" } ] }, { "title": "Serum levels of insulin-like growth factor (IGF)-binding protein-3 (IGFBP-3) in healthy infants, children, and adolescents: the relation to IGF-I, IGF-II, IGFBP-1, IGFBP-2, age, sex, body mass index, and pubertal maturation.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1995", "authors": "Juul A, Dalgaard P, Blum WF, Bang P, Hall K, Michaelsen KF, Muller J, Skakkebaek NE", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7543116", "url": "https://glygen.org/publication/PubMed/7543116" } ] }, { "title": "Autocrine regulation of cell proliferation by the insulin-like growth factor (IGF) and IGF binding protein-3 protease system in a human prostate carcinoma cell line (PC-3).", "journal": "Endocrinology", "date": "1995", "authors": "Angelloz-Nicoud P, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7588299", "url": "https://glygen.org/publication/PubMed/7588299" } ] }, { "title": "Purification from human plasma of a tetrapeptide that potentiates insulin-like growth factor-I activity in chick embryo cartilage.", "journal": "FEBS Lett.", "date": "1995", "authors": "Straczek J, Maachi F, Le Nguyen D, Becchi M, Heulin M H, Nabet P, Belleville F", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "reference": [ { "type": "PubMed", "id": "7589467", "url": "https://glygen.org/publication/PubMed/7589467" } ] }, { "title": "The cloning and chromosomal mapping of two novel human opioid-somatostatin-like receptor genes, GPR7 and GPR8, expressed in discrete areas of the brain.", "journal": "Genomics", "date": "1995", "authors": "O'Dowd BF, Scheideler MA, Nguyen T, Cheng R, Rasmussen JS, Marchese A, Zastawny R, Heng HH, Tsui LC, Shi X, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "7590751", "url": "https://glygen.org/publication/PubMed/7590751" } ] }, { "title": "Expression cloning and pharmacological characterization of a human hippocampal neuropeptide Y/peptide YY Y2 receptor subtype.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Gerald C, Walker MW, Vaysse PJ, He C, Branchek TA, Weinshank RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "7592910", "url": "https://glygen.org/publication/PubMed/7592910" } ] }, { "title": "Cloning and functional expression of a human Y4 subtype receptor for pancreatic polypeptide, neuropeptide Y, and peptide YY.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Bard JA, Walker MW, Branchek TA, Weinshank RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "7592911", "url": "https://glygen.org/publication/PubMed/7592911" } ] }, { "title": "kappa-Opioid receptor in humans: cDNA and genomic cloning, chromosomal assignment, functional expression, pharmacology, and expression pattern in the central nervous system.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Simonin F, Gaveriaux-Ruff C, Befort K, Matthes H, Lannes B, Micheletti G, Mattei MG, Charron G, Bloch B, Kieffer B", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "7624359", "url": "https://glygen.org/publication/PubMed/7624359" } ] }, { "title": "Binding of mutants of human insulin-like growth factor II to insulin-like growth factor binding proteins 1-6.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Bach LA, Hsieh S, Sakano K, Fujiwara H, Perdue JF, Rechler MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7683646", "url": "https://glygen.org/publication/PubMed/7683646" } ] }, { "title": "Glucose does not influence the insulin-like growth factor (JGF) binding to carrier proteins (IGFBPs): analysis of rat and human serum by western ligand blotting.", "journal": "Experientia", "date": "1993", "authors": "Cianfarani S, Frost VJ, Savage MO, Holly JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7689487", "url": "https://glygen.org/publication/PubMed/7689487" } ] }, { "title": "Expression of the blood-clotting factor-VIII cDNA is repressed by a transcriptional silencer located in its coding region.", "journal": "Blood", "date": "1995", "authors": "Hoeben RC, Fallaux FJ, Cramer SJ, van den Wollenberg DJ, van Ormondt H, Briet E, van der Eb AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "7727775", "url": "https://glygen.org/publication/PubMed/7727775" } ] }, { "title": "The affinity and stoichiometry of binding of human factor VIII to von Willebrand factor.", "journal": "Blood", "date": "1995", "authors": "Vlot AJ, Koppelman SJ, van den Berg MH, Bouma BN, Sixma JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "7756647", "url": "https://glygen.org/publication/PubMed/7756647" } ] }, { "title": "Endothelin-converting enzyme-2 is a membrane-bound, phosphoramidon-sensitive metalloprotease with acidic pH optimum.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Emoto N, Yanagisawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "7797512", "url": "https://glygen.org/publication/PubMed/7797512" } ] }, { "title": "Human mu opiate receptor. cDNA and genomic clones, pharmacologic characterization and chromosomal assignment.", "journal": "FEBS letters", "date": "1994", "authors": "Wang JB, Johnson PS, Persico AM, Hawkins AL, Griffin CA, Uhl GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "7905839", "url": "https://glygen.org/publication/PubMed/7905839" } ] }, { "title": "Mechanism of GTP hydrolysis by G-protein alpha subunits.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Kleuss C, Raw AS, Lee E, Sprang SR, Gilman AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "7937899", "url": "https://glygen.org/publication/PubMed/7937899" } ] }, { "title": "Human taste cells express the G protein alpha-gustducin and neuron-specific enolase.", "journal": "Brain research. Molecular brain research", "date": "1994", "authors": "Takami S, Getchell TV, McLaughlin SK, Margolskee RF, Getchell ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "8015379", "url": "https://glygen.org/publication/PubMed/8015379" } ] }, { "title": "Pharmacological characterization of bosentan, a new potent orally active nonpeptide endothelin receptor antagonist.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "1994", "authors": "Clozel M, Breu V, Gray GA, Kalina B, Loffler BM, Burri K, Cassal JM, Hirth G, Muller M, Neidhart W, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8035319", "url": "https://glygen.org/publication/PubMed/8035319" } ] }, { "title": "ECE-1: a membrane-bound metalloprotease that catalyzes the proteolytic activation of big endothelin-1.", "journal": "Cell", "date": "1994", "authors": "Xu D, Emoto N, Giaid A, Slaughter C, Kaw S, deWit D, Yanagisawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8062389", "url": "https://glygen.org/publication/PubMed/8062389" } ] }, { "title": "Expression cloning of a human B1 bradykinin receptor.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Menke JG, Borkowski JA, Bierilo KK, MacNeil T, Derrick AW, Schneck KA, Ransom RW, Strader CD, Linemeyer DL, Hess JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8063797", "url": "https://glygen.org/publication/PubMed/8063797" } ] }, { "title": "Biology of factor IX.", "journal": "Blood coagulation & fibrinolysis : an international journal in haemostasis and thrombosis", "date": "1993", "authors": "Kurachi K, Kurachi S, Furukawa M, Yao SN", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "8148489", "url": "https://glygen.org/publication/PubMed/8148489" } ] }, { "title": "Molecular cloning and expression of the gene encoding human angiotensin II type 2 receptor.", "journal": "Biochemical and biophysical research communications", "date": "1994", "authors": "Tsuzuki S, Ichiki T, Nakakubo H, Kitami Y, Guo DF, Shirai H, Inagami T", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8185599", "url": "https://glygen.org/publication/PubMed/8185599" } ] }, { "title": "Isolation, cDNA cloning, and overexpression of a 33-kD cell surface glycoprotein that binds to the globular `heads` of C1q.", "journal": "The Journal of experimental medicine", "date": "1994", "authors": "Ghebrehiwet B, Lim BL, Peerschke EI, Willis AC, Reid KB", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "8195709", "url": "https://glygen.org/publication/PubMed/8195709" } ] }, { "title": "Identification of a human delta opioid receptor: cloning and expression.", "journal": "Life sciences", "date": "1994", "authors": "Knapp RJ, Malatynska E, Fang L, Li X, Babin E, Nguyen M, Santoro G, Varga EV, Hruby VJ, Roeske WR, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8201839", "url": "https://glygen.org/publication/PubMed/8201839" } ] }, { "title": "Cloning of glycoprotein D cDNA, which encodes the major subunit of the Duffy blood group system and the receptor for the Plasmodium vivax malaria parasite.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Chaudhuri A, Polyakova J, Zbrzezna V, Williams K, Gulati S, Pogo AO", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8248172", "url": "https://glygen.org/publication/PubMed/8248172" } ] }, { "title": "A human gene that shows identity with the gene encoding the angiotensin receptor is located on chromosome 11.", "journal": "Gene", "date": "1993", "authors": "O'Dowd BF, Heiber M, Chan A, Heng HH, Tsui LC, Kennedy JL, Shi X, Petronis A, George SR, Nguyen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8294032", "url": "https://glygen.org/publication/PubMed/8294032" } ] }, { "title": "Factor XII-independent activation of factor XI in plasma: effects of sulfatides on tissue factor-induced coagulation.", "journal": "Blood", "date": "1993", "authors": "Gailani D, Broze GJ Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "8338946", "url": "https://glygen.org/publication/PubMed/8338946" } ] }, { "title": "Sequencing and cloning of human prolylcarboxypeptidase (angiotensinase C). Similarity to both serine carboxypeptidase and prolylendopeptidase families.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Tan F, Morris PW, Skidgel RA, Erdos EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "8344943", "url": "https://glygen.org/publication/PubMed/8344943" } ] }, { "title": "Cloning, functional expression and pharmacological characterization of a fourth (hSSTR4) and a fifth (hSSTR5) human somatostatin receptor subtype.", "journal": "Biochemical and biophysical research communications", "date": "1993", "authors": "Yamada Y, Kagimoto S, Kubota A, Yasuda K, Masuda K, Someya Y, Ihara Y, Li Q, Imura H, Seino S, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8373420", "url": "https://glygen.org/publication/PubMed/8373420" } ] }, { "title": "Cloning and expression of a complementary DNA encoding a high affinity human neurotensin receptor.", "journal": "FEBS letters", "date": "1993", "authors": "Vita N, Laurent P, Lefort S, Chalon P, Dumont X, Kaghad M, Gully D, Le Fur G, Ferrara P, Caput D", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8381365", "url": "https://glygen.org/publication/PubMed/8381365" } ] }, { "title": "BRS-3: a novel bombesin receptor subtype selectively expressed in testis and lung carcinoma cells.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Fathi Z, Corjay MH, Shapira H, Wada E, Benya R, Jensen R, Viallet J, Sausville EA, Battey JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8383682", "url": "https://glygen.org/publication/PubMed/8383682" } ] }, { "title": "Molecular cloning of a functional human thyrotropin-releasing hormone receptor.", "journal": "Biochemical and biophysical research communications", "date": "1993", "authors": "Matre V, Karlsen HE, Wright MS, Lundell I, Fjeldheim AK, Gabrielsen OS, Larhammar D, Gautvik KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8395824", "url": "https://glygen.org/publication/PubMed/8395824" } ] }, { "title": "Characterization of the gene encoding human cone transducin alpha-subunit (GNAT2).", "journal": "Genomics", "date": "1993", "authors": "Morris TA, Fong SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "8406495", "url": "https://glygen.org/publication/PubMed/8406495" } ] }, { "title": "Molecular characterization and regulation of the human endothelin receptors.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Elshourbagy NA, Korman DR, Wu HL, Sylvester DR, Lee JA, Nuthalaganti P, Bergsma DJ, Kumar CS, Nambi P", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8440682", "url": "https://glygen.org/publication/PubMed/8440682" } ] }, { "title": "Molecular cloning of a novel melanocortin receptor.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Gantz I, Konda Y, Tashiro T, Shimoto Y, Miwa H, Munzert G, Watson SJ, DelValle J, Yamada T", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8463333", "url": "https://glygen.org/publication/PubMed/8463333" } ] }, { "title": "Platelet alpha-granules.", "journal": "Blood reviews", "date": "1993", "authors": "Harrison P, Cramer EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "8467233", "url": "https://glygen.org/publication/PubMed/8467233" } ] }, { "title": "Molecular cloning and functional expression of the human gallbladder cholecystokinin A receptor.", "journal": "Biochemical and biophysical research communications", "date": "1993", "authors": "Ulrich CD, Ferber I, Holicky E, Hadac E, Buell G, Miller LJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8503909", "url": "https://glygen.org/publication/PubMed/8503909" } ] }, { "title": "Molecular cloning, expression and potential functions of the human proteinase-activated receptor-2.", "journal": "The Biochemical journal", "date": "1996", "authors": "Bohm SK, Kong W, Bromme D, Smeekens SP, Anderson DC, Connolly A, Kahn M, Nelken NA, Coughlin SR, Payan DG, Bunnett NW", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8615752", "url": "https://glygen.org/publication/PubMed/8615752" } ] }, { "title": "Activation of the factor VIIIa-factor IXa enzyme complex of blood coagulation by membranes containing phosphatidyl-L-serine.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Gilbert GE, Arena AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "8626656", "url": "https://glygen.org/publication/PubMed/8626656" } ] }, { "title": "Human G(alpha q): cDNA and tissue distribution.", "journal": "Biochimica et biophysica acta", "date": "1996", "authors": "Chen B, Leverette RD, Schwinn DA, Kwatra MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "8664309", "url": "https://glygen.org/publication/PubMed/8664309" } ] }, { "title": "Cloning and chromosomal mapping of three novel genes, GPR9, GPR10, and GPR14, encoding receptors related to interleukin 8, neuropeptide Y, and somatostatin receptors.", "journal": "Genomics", "date": "1995", "authors": "Marchese A, Heiber M, Nguyen T, Heng HH, Saldivia VR, Cheng R, Murphy PM, Tsui LC, Shi X, Gregor P, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8666380", "url": "https://glygen.org/publication/PubMed/8666380" } ] }, { "title": "Molecular cloning and characterization of the human anaphylatoxin C3a receptor.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Ames RS, Li Y, Sarau HM, Nuthulaganti P, Foley JJ, Ellis C, Zeng Z, Su K, Jurewicz AJ, Hertzberg RP, Bergsma DJ, Kumar C", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8702752", "url": "https://glygen.org/publication/PubMed/8702752" } ] }, { "title": "Identification of the zinc-dependent endothelial cell binding protein for high molecular weight kininogen and factor XII: identity with the receptor that binds to the globular `heads` of C1q (gC1q-R).", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Joseph K, Ghebrehiwet B, Peerschke EI, Reid KB, Kaplan AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "8710908", "url": "https://glygen.org/publication/PubMed/8710908" } ] }, { "title": "Primary structure of human prethrombin 2 and alpha-thrombin.", "journal": "The Journal of biological chemistry", "date": "1977", "authors": "Butkowski RJ, Elion J, Downing MR, Mann KG", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "873923", "url": "https://glygen.org/publication/PubMed/873923" } ] }, { "title": "Activation and function of human Hageman factor. The role of high molecular weight kininogen and prekallikrein.", "journal": "The Journal of clinical investigation", "date": "1977", "authors": "Meier HL, Pierce JV, Colman RW, Kaplan AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "874082", "url": "https://glygen.org/publication/PubMed/874082" } ] }, { "title": "Streptococcal cysteine proteinase releases kinins: a virulence mechanism.", "journal": "The Journal of experimental medicine", "date": "1996", "authors": "Herwald H, Collin M, Muller-Esterl W, Bjorck L", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "reference": [ { "type": "PubMed", "id": "8760820", "url": "https://glygen.org/publication/PubMed/8760820" } ] }, { "title": "Measurement of insulin-like growth factor (IGF)-II binding to purified IGF binding proteins 1-6: comparison of charcoal adsorption and high performance size exclusion chromatography.", "journal": "Biochimica et biophysica acta", "date": "1996", "authors": "Bach LA, Rechler MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8781553", "url": "https://glygen.org/publication/PubMed/8781553" } ] }, { "title": "Insulin-like growth factor binding protein (IGFBP) proteases: functional regulators of cell growth.", "journal": "Progress in growth factor research", "date": "1995", "authors": "Rajah R, Katz L, Nunn S, Solberg P, Beers T, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8817670", "url": "https://glygen.org/publication/PubMed/8817670" } ] }, { "title": "Pharmacokinetics and pharmacodynamics of the endothelin-receptor antagonist bosentan in healthy human subjects.", "journal": "Clinical pharmacology and therapeutics", "date": "1996", "authors": "Weber C, Schmitt R, Birnboeck H, Hopfgartner G, van Marle SP, Peeters PA, Jonkman JH, Jones CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8823230", "url": "https://glygen.org/publication/PubMed/8823230" } ] }, { "title": "Recombinant human insulin-like growth factor (IGF) binding protein-3 stimulates prostate carcinoma cell proliferation via an IGF-dependent mechanism. Role of serine proteases.", "journal": "Growth regulation", "date": "1996", "authors": "Angelloz-Nicoud P, Harel L, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8894645", "url": "https://glygen.org/publication/PubMed/8894645" } ] }, { "title": "Human blood coagulation factor XI. Purification, properties, and mechanism of activation by activated factor XII.", "journal": "The Journal of biological chemistry", "date": "1977", "authors": "Bouma BN, Griffin JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "893417", "url": "https://glygen.org/publication/PubMed/893417" } ] }, { "title": "Isolation and characterization of proteolytic fragments of insulin-like growth factor-binding protein-3.", "journal": "Hormone research", "date": "1996", "authors": "Lalou C, Lassarre C, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8964575", "url": "https://glygen.org/publication/PubMed/8964575" } ] }, { "title": "Discovery of TBC11251, a potent, long acting, orally active endothelin receptor-A selective antagonist.", "journal": "Journal of medicinal chemistry", "date": "1997", "authors": "Wu C, Chan MF, Stavros F, Raju B, Okun I, Mong S, Keller KM, Brock T, Kogan TP, Dixon RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "9171878", "url": "https://glygen.org/publication/PubMed/9171878" } ] }, { "title": "High molecular weight kininogen peptides inhibit the formation of kallikrein on endothelial cell surfaces and subsequent urokinase-dependent plasmin formation.", "journal": "Blood", "date": "1997", "authors": "Lin Y, Harris RB, Yan W, McCrae KR, Zhang H, Colman RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "9226169", "url": "https://glygen.org/publication/PubMed/9226169" } ] }, { "title": "Direct stimulation of Bruton's tyrosine kinase by G(q)-protein alpha-subunit.", "journal": "Nature", "date": "1997", "authors": "Bence K, Ma W, Kozasa T, Huang XY", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "9305846", "url": "https://glygen.org/publication/PubMed/9305846" } ] }, { "title": "High molecular weight kininogen regulates prekallikrein assembly and activation on endothelial cells: a novel mechanism for contact activation.", "journal": "Blood", "date": "1998", "authors": "Motta G, Rojkjaer R, Hasan AA, Cines DB, Schmaier AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "9427705", "url": "https://glygen.org/publication/PubMed/9427705" } ] }, { "title": "Effects of melagatran, a new low-molecular-weight thrombin inhibitor, on thrombin and fibrinolytic enzymes.", "journal": "Thrombosis and haemostasis", "date": "1998", "authors": "Gustafsson D, Antonsson T, Bylund R, Eriksson U, Gyzander E, Nilsson I, Elg M, Mattsson C, Deinum J, Pehrsson S, Karlsson O, Nilsson A, Sorensen H", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "9459334", "url": "https://glygen.org/publication/PubMed/9459334" } ] }, { "title": "Novastan (brand of argatroban): a small-molecule, direct thrombin inhibitor.", "journal": "Seminars in thrombosis and hemostasis", "date": "1997", "authors": "Hursting MJ, Alford KL, Becker JC, Brooks RL, Joffrion JL, Knappenberger GD, Kogan PW, Kogan TP, McKinney AA, Schwarz RP Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "9469622", "url": "https://glygen.org/publication/PubMed/9469622" } ] }, { "title": "Insulin-like growth factor (IGF)-binding protein 5 forms an alternative ternary complex with IGFs and the acid-labile subunit.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Twigg SM, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9497324", "url": "https://glygen.org/publication/PubMed/9497324" } ] }, { "title": "Nocistatin, a peptide that blocks nociceptin action in pain transmission.", "journal": "Nature", "date": "1998", "authors": "Okuda-Ashitaka E, Minami T, Tachibana S, Yoshihara Y, Nishiuchi Y, Kimura T, Ito S", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "9521323", "url": "https://glygen.org/publication/PubMed/9521323" } ] }, { "title": "DNA methylation contributes to expression of the human neurotensin/neuromedin N gene.", "journal": "The American journal of physiology", "date": "1998", "authors": "Dong Z, Wang X, Zhao Q, Townsend CM Jr, Evers BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "9530155", "url": "https://glygen.org/publication/PubMed/9530155" } ] }, { "title": "Association of XK and Kell blood group proteins.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Russo D, Redman C, Lee S", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "9593744", "url": "https://glygen.org/publication/PubMed/9593744" } ] }, { "title": "Biosynthesis, assembly and secretion of coagulation factor VIII.", "journal": "Blood coagulation & fibrinolysis : an international journal in haemostasis and thrombosis", "date": "1997", "authors": "Kaufman RJ, Pipe SW, Tagliavacca L, Swaroop M, Moussalli M", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "9607108", "url": "https://glygen.org/publication/PubMed/9607108" } ] }, { "title": "A prolactin-releasing peptide in the brain.", "journal": "Nature", "date": "1998", "authors": "Hinuma S, Habata Y, Fujii R, Kawamata Y, Hosoya M, Fukusumi S, Kitada C, Masuo Y, Asano T, Matsumoto H, Sekiguchi M, Kurokawa T, Nishimura O, Onda H, Fujino M", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "9607765", "url": "https://glygen.org/publication/PubMed/9607765" } ] }, { "title": "Molecular characterization, pharmacological properties and chromosomal localization of the human GALR2 galanin receptor.", "journal": "Brain research. Molecular brain research", "date": "1998", "authors": "Fathi Z, Battaglino PM, Iben LG, Li H, Baker E, Zhang D, McGovern R, Mahle CD, Sutherland GR, Iismaa TP, Dickinson KE, Zimanyi IA", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "9685625", "url": "https://glygen.org/publication/PubMed/9685625" } ] }, { "title": "Identification of novel high molecular weight insulin-like growth factor-binding protein-3 association proteins in human serum.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1998", "authors": "Collett-Solberg PF, Nunn SE, Gibson TB, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9709957", "url": "https://glygen.org/publication/PubMed/9709957" } ] }, { "title": "Cloned human and rat galanin GALR3 receptors. Pharmacology and activation of G-protein inwardly rectifying K+ channels.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Smith KE, Walker MW, Artymyshyn R, Bard J, Borowsky B, Tamm JA, Yao WJ, Vaysse PJ, Branchek TA, Gerald C, Jones KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "9722565", "url": "https://glygen.org/publication/PubMed/9722565" } ] }, { "title": "The insulin-like growth factor (IGF)binding protein 1 binding epitope on IGF-I probed by heteronuclear NMR spectroscopy and mutational analysis.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Jansson M, Andersson G, Uhlen M, Nilsson B, Kordel J", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9733769", "url": "https://glygen.org/publication/PubMed/9733769" } ] }, { "title": "Identification of the binding site for Gqalpha on its effector Bruton's tyrosine kinase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Ma YC, Huang XY", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "9770463", "url": "https://glygen.org/publication/PubMed/9770463" } ] }, { "title": "Activation of factor VIII by thrombin increases its affinity for binding to synthetic phospholipid membranes and activated platelets.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Saenko EL, Scandella D, Yakhyaev AV, Greco NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "9774404", "url": "https://glygen.org/publication/PubMed/9774404" } ] }, { "title": "Insulin-like growth factor-binding protein 5 complexes with the acid-labile subunit. Role of the carboxyl-terminal domain.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Twigg SM, Kiefer MC, Zapf J, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9786878", "url": "https://glygen.org/publication/PubMed/9786878" } ] }, { "title": "Isolation and characterization of a novel endogenous peptide ligand for the human APJ receptor.", "journal": "Biochemical and biophysical research communications", "date": "1998", "authors": "Tatemoto K, Hosoya M, Habata Y, Fujii R, Kakegawa T, Zou MX, Kawamata Y, Fukusumi S, Hinuma S, Kitada C, Kurokawa T, Onda H, Fujino M", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "9792798", "url": "https://glygen.org/publication/PubMed/9792798" } ] }, { "title": "Molecular characterization and expression of cloned human galanin receptors GALR2 and GALR3.", "journal": "Journal of neurochemistry", "date": "1998", "authors": "Kolakowski LF Jr, O'Neill GP, Howard AD, Broussard SR, Sullivan KA, Feighner SD, Sawzdargo M, Nguyen T, Kargman S, Shiao LL, Hreniuk DL, Tan CP, Evans J, Abramovitz M, Chateauneuf A, Coulombe N, Ng G, Johnson MP, Tharian A, Khoshbouei H, George SR, Smith RG, O'Dowd BF", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "9832121", "url": "https://glygen.org/publication/PubMed/9832121" } ] }, { "title": "The life cycle of coagulation factor VIII in view of its structure and function.", "journal": "Blood", "date": "1998", "authors": "Lenting PJ, van Mourik JA, Mertens K", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "9834200", "url": "https://glygen.org/publication/PubMed/9834200" } ] }, { "title": "Neurotensin is an antagonist of the human neurotensin NT2 receptor expressed in Chinese hamster ovary cells.", "journal": "European journal of pharmacology", "date": "1998", "authors": "Vita N, Oury-Donat F, Chalon P, Guillemot M, Kaghad M, Bachy A, Thurneyssen O, Garcia S, Poinot-Chazel C, Casellas P, Keane P, Le Fur G, Maffrand JP, Soubrie P, Caput D, Ferrara P", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "9851594", "url": "https://glygen.org/publication/PubMed/9851594" } ] }, { "title": "Thrombin activates factor XI on activated platelets in the absence of factor XII.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "1999", "authors": "Oliver JA, Monroe DM, Roberts HR, Hoffman M", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "9888880", "url": "https://glygen.org/publication/PubMed/9888880" } ] }, { "title": "Elevated levels of the IGF-binding protein protease MMP-1 in asthmatic airway smooth muscle.", "journal": "American journal of respiratory cell and molecular biology", "date": "1999", "authors": "Rajah R, Nachajon RV, Collins MH, Hakonarson H, Grunstein MM, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9922210", "url": "https://glygen.org/publication/PubMed/9922210" } ] } ], "pathway": [ { "id": "hsa:3827", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3827", "resource": "KEGG Pathway" }, { "id": "R-HSA-114608", "name": "Platelet degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608", "resource": "Reactome", "description": "Platelet degranulation" }, { "id": "R-HSA-140837", "name": "Intrinsic Pathway of Fibrin Clot Formation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837", "resource": "Reactome", "description": "Intrinsic Pathway of Fibrin Clot Formation" }, { "id": "R-HSA-375276", "name": "Peptide ligand-binding receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276", "resource": "Reactome", "description": "Peptide ligand-binding receptors" }, { "id": "R-HSA-381426", "name": "Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426", "resource": "Reactome", "description": "Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)" }, { "id": "R-HSA-416476", "name": "G alpha (q) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476", "resource": "Reactome", "description": "G alpha (q) signalling events" }, { "id": "R-HSA-418594", "name": "G alpha (i) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594", "resource": "Reactome", "description": "G alpha (i) signalling events" }, { "id": "R-HSA-8957275", "name": "Post-translational protein phosphorylation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8957275", "resource": "Reactome", "description": "Post-translational protein phosphorylation" } ], "orthologs": [ { "uniprot_canonical_ac": "O08677-1", "protein_name": "Kininogen-1", "gene_name": "Kng1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKLITTLLLCSGLLLTLTQGEEAQEIDCNDEAVFQAVDFSLKQFNPGVKSGNQYMLHRVIEGTKTDGSPTFYSFKYLIKEGNCSAQSGLAWQDCDFKDAEEAATGECTATVGKRENEFFIVTQTCKIAPSKAPILKAYFPCIGCVHAISTDSPDLEPVLKHSIEHFNNNTDHSHLFTLRKVKSAHRQVVAGLNFDITYTIVQTNCSKERFPSLHGDCVALPNGDDGECRGNLFMDINNKIANFSQSCTLYSGDDLVEALPKPCPGCPRDIPVDSPELKEVLGHSIAQLNAENDHPFYYKIDTVKKATSQVVAGTKYVIEFIARETKCSKESNTELAEDCEIKHLGQSLDCNANVYMRPWENKVVPTVKCQALDMTEMARRPPGFSPFRSVTVQETKEGRTVSPPYIAREQEERDAETEQGPTHGHGWLHEKQIKANKNHRGHKHGHDHGHWSPRRHGLGHGHQKPHGLGHGHQLKLDYLRHQREDGDDHTHTVGHGHGHGHGHGHGHGHGHGHGHGHGHGHGHGKHTNKDKNSVKQTTQRTESLASSSEYSTTSTQMQGRTEGPTLTPPRAQPTVTSSGFQDSDFIEDVVATTPPYDTGAHDDLIPDIHVQPDSLSFKLISDFPEATSPKCPGRPWKPASWEDPNTETTEFSDFDLLDALS", "length": 661 }, "evidence": [ { "id": "45920697", "url": "http://www.informatics.jax.org/homology/45920697", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P08932-1", "protein_name": "T-kininogen 2", "gene_name": "", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MKLITILLLCSRLLPSLAQEEGAQEMDCNDETVFQAVDTALKKYNAELESGNQFLLYRVTEGTKKDGAETLYSFKYQIKEGNCSVQSGLTWQDCDFKDAEEAATGECTTTLGKKENKFSVATQICNITPGKGPKKTEEDLCVGCFQPIPMDSSDLKPVLKHAVEHFNNNTKHTHLFALTEVKSAHSQVVAGMNYKIIYSIVQTNCSKEDFPFLREDCVPLPYGDHGECRGHTYVDIHNTIAGFSQSCDLYPGDDLFSLLPKKCFGCPKNIPVDSPELKEALGHSIAQLNAQHNHLFYFKIDTVKKATSQVVAGTKYVIEFIARETNCSKQTNTELTADCETKHLGQSLNCNANVYMRPWENKVVPTVRCQALDMMISRPPGFSPFRLVQVQETKEGTTRLLNSCEYKGRLSKAGAGPAPDHQAEASTVTP", "length": 430 }, "evidence": [ { "id": "45920696", "url": "http://www.informatics.jax.org/homology/45920696", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P08934-1", "protein_name": "Kininogen-1", "gene_name": "Kng1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MKLITILLLCSRLLPSLAQEEDAQEMDCNDESLFQAVDTALKKYNAGLKSGNQFVLYQVTEGTKKDGSKTFYSFKYQIKEGNCSVQSGFAWQDCDFKDAEEAATGECTATLEKRRNNKFSIATQICNITPGKGPIVTNEYHCLGCMHPISVDSPELGPVLKHAVEHFNNNTKHTHLFALGEVKSADRQVVAGMNYQIIYSIVQTNCSKEDFPSLHEDCVPLPSGDDGECKGNAFVDIHKTIAGFSDSCEFYPGDDLFELLPEDCPGCPRNIPVDSPELKEALGHSIAQLNAENNHTFYFKIDTVKKATSQVVAGTKYVIEFIARETKCSKESNAELTADCETKRLGQSLNCNANVYMRPWENKVVPTVKCKVLDMTSVIRRPPGFSPFRAPRVKKPKESTTVSPSYIARVQEERDPGNEQGPIHGHGWLHAKQIKNKNHQGHKHGHGIGHGHQKPHGLGHGHQLKLDDLKQQREDGYDHRHPVGHGHGQRHGHGHGHGHGRDKHTNKDKNNVKHTDQRRAPLTSSSEDNTTSTQIQGRTEGFTLNPPLAQPAVISRGFQDSGFTEGVIATTSPYDTETHDDLIPDIHVQPDSLSFKLISDFPEATSHKCPGRPWKPVSRKDPTIETTEFSDFDLLDALS", "length": 639 }, "evidence": [ { "id": "45920697", "url": "http://www.informatics.jax.org/homology/45920697", "database": "MGI" }, { "id": "45920696", "url": "http://www.informatics.jax.org/homology/45920696", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q6S9I3-1", "protein_name": "Kininogen 2", "gene_name": "Kng2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKLITTLLLCSGLLLTLTQGEEAQEIDCNDEAVFQAVDASLKKLNARLQSGNQFVLYRVTKRAKMDGSATFYSFNYQIKEGNCSAQRGLAWQDCDFKDSEEAATGECTATMGKKENKFFIVTQTCKITPGKGPIVTEEYHCASCVHPISADNPDLEPVLKHAIEYFNNNTGHSHLFALREVKSAQGQVVGGLNFDIIYTIVQTNCSKERFPSLRGDCVALPNGDGGECRGNAFLDTDNKIEDFTQSCDLHPGDDLVEALPKPCPGCPRDIPVDSPELKEVLGHSIAQLNTENDHPFYFKIDTVKKATSQVVAGTNYVIEFIARETKCSKESNTELTEDCEIKHLGQSLDCNANVYMRPWENKVIPTVKCQALDKTIPIRRRPPGFSPFRSAKVQETKAGTTVSPPYIVREQKEGNGWLNEKQIKAKNHSGHKYGHDHAHWSPRRHGLGHGHQKPHGLGHGHRLKLDYLRHQREDGSDHTHTEGHGYGHGHGHGHGHGHSHGLGHGHDKQTNKDKSSVKQTAQRTEPLASSSEYSTTSTQIQERTEGPTLTPPRAQPTVTSSGFQDSDFIEDVVAITPPYDTGAPDDLIPDIHVQPDSLSFKLISDFPEATSQKCPGRPWKPASWKDPNTETTEFSDFDLLDVLS", "length": 644 }, "evidence": [ { "id": "45920696", "url": "http://www.informatics.jax.org/homology/45920696", "database": "MGI" }, { "id": "P01042", "url": "https://omabrowser.org/oma/group/P01042/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "signaling receptor binding", "id": "GO:0005102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005102", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "pmid": "" }, { "name": "heparin binding", "id": "GO:0008201", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008201", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "pmid": "" }, { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "pmid": "" }, { "name": "hormone activity", "id": "GO:0005179", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005179", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "pmid": "" }, { "name": "cysteine-type endopeptidase inhibitor activity", "id": "GO:0004869", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004869", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 8, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "pmid": "" }, { "name": "endoplasmic reticulum lumen", "id": "GO:0005788", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005788", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "pmid": "" }, { "name": "platelet alpha granule lumen", "id": "GO:0031093", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031093", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "pmid": "" }, { "name": "blood microparticle", "id": "GO:0072562", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072562", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "pmid": "" }, { "name": "collagen-containing extracellular matrix", "id": "GO:0062023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062023", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "inflammatory response", "id": "GO:0006954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "pmid": "" }, { "name": "negative regulation of cell adhesion", "id": "GO:0007162", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007162", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "pmid": "" }, { "name": "positive regulation of cytosolic calcium ion concentration", "id": "GO:0007204", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007204", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "pmid": "" }, { "name": "positive regulation of apoptotic process", "id": "GO:0043065", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043065", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "pmid": "" }, { "name": "blood coagulation", "id": "GO:0007596", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007596", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "pmid": "" }, { "name": "vasodilation", "id": "GO:0042311", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042311", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "pmid": "" }, { "name": "negative regulation of blood coagulation", "id": "GO:0030195", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030195", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "pmid": "" }, { "name": "negative regulation of proteolysis", "id": "GO:0045861", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045861", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "kininogen-1 N-glycosylated 1 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-169 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P01042-1, Asn-169, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051541", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051541" } ] }, { "name": "kininogen-1 N-glycosylated 2 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-169 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G06247RL. Example: UniProtKB:P01042-1, Asn-169, MOD:00160~GNO:G06247RL. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051542", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051542" } ] }, { "name": "kininogen-1 N-glycosylated 3 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-169 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G11115RO. Example: UniProtKB:P01042-1, Asn-169, MOD:00160~GNO:G11115RO. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051543", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051543" } ] }, { "name": "kininogen-1 N-glycosylated 4 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-169 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G27947YN. Example: UniProtKB:P01042-1, Asn-169, MOD:00160~GNO:G27947YN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051544", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051544" } ] }, { "name": "kininogen-1 N-glycosylated 5 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-169 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P01042-1, Asn-169, MOD:00160~GNO:G29068FM. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051545", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051545" } ] }, { "name": "kininogen-1 N-glycosylated 6 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-169 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P01042-1, Asn-169, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051546", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051546" } ] }, { "name": "kininogen-1 N-glycosylated 7 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-169 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G85144OK. Example: UniProtKB:P01042-1, Asn-169, MOD:00160~GNO:G85144OK. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051547", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051547" } ] }, { "name": "kininogen-1 N-glycosylated 8 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-169 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G94917XT. Example: UniProtKB:P01042-1, Asn-169, MOD:00160~GNO:G94917XT. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051548", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051548" } ] }, { "name": "kininogen-1 N-glycosylated 9 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-169 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G95678HJ. Example: UniProtKB:P01042-1, Asn-169, MOD:00160~GNO:G95678HJ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051549", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051549" } ] }, { "name": "kininogen-1 N-glycosylated 10 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-169 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G99679NM. Example: UniProtKB:P01042-1, Asn-169, MOD:00160~GNO:G99679NM. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051550", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051550" } ] }, { "name": "kininogen-1 N-glycosylated 11 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P01042-1, Asn-205, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051551", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051551" } ] }, { "name": "kininogen-1 N-glycosylated 12 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G06247RL. Example: UniProtKB:P01042-1, Asn-205, MOD:00160~GNO:G06247RL. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051552", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051552" } ] }, { "name": "kininogen-1 N-glycosylated 13 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G08293MJ. Example: UniProtKB:P01042-1, Asn-205, MOD:00160~GNO:G08293MJ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051553", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051553" } ] }, { "name": "kininogen-1 N-glycosylated 14 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G17015OC. Example: UniProtKB:P01042-1, Asn-205, MOD:00160~GNO:G17015OC. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051554", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051554" } ] }, { "name": "kininogen-1 N-glycosylated 15 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G27947YN. Example: UniProtKB:P01042-1, Asn-205, MOD:00160~GNO:G27947YN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051555", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051555" } ] }, { "name": "kininogen-1 N-glycosylated 16 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G40926MX. Example: UniProtKB:P01042-1, Asn-205, MOD:00160~GNO:G40926MX. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051556", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051556" } ] }, { "name": "kininogen-1 N-glycosylated 17 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P01042-1, Asn-205, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051557", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051557" } ] }, { "name": "kininogen-1 N-glycosylated 18 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G85144OK. Example: UniProtKB:P01042-1, Asn-205, MOD:00160~GNO:G85144OK. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051558", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051558" } ] }, { "name": "kininogen-1 N-glycosylated 19 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G86752LQ. Example: UniProtKB:P01042-1, Asn-205, MOD:00160~GNO:G86752LQ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051559", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051559" } ] }, { "name": "kininogen-1 N-glycosylated 20 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G88374WZ. Example: UniProtKB:P01042-1, Asn-205, MOD:00160~GNO:G88374WZ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051560", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051560" } ] }, { "name": "kininogen-1 N-glycosylated 21 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G94917XT. Example: UniProtKB:P01042-1, Asn-205, MOD:00160~GNO:G94917XT. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051561", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051561" } ] }, { "name": "kininogen-1 N-glycosylated 22 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-294 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P01042-1, Asn-294, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051562", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051562" } ] }, { "name": "kininogen-1 N-glycosylated 23 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-294 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G06247RL. Example: UniProtKB:P01042-1, Asn-294, MOD:00160~GNO:G06247RL. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051563", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051563" } ] }, { "name": "kininogen-1 N-glycosylated 24 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-294 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G08293MJ. Example: UniProtKB:P01042-1, Asn-294, MOD:00160~GNO:G08293MJ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051564", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051564" } ] }, { "name": "kininogen-1 N-glycosylated 25 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-294 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G10486CT. Example: UniProtKB:P01042-1, Asn-294, MOD:00160~GNO:G10486CT. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051565", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051565" } ] }, { "name": "kininogen-1 N-glycosylated 26 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-294 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G27947YN. Example: UniProtKB:P01042-1, Asn-294, MOD:00160~GNO:G27947YN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051566", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051566" } ] }, { "name": "kininogen-1 N-glycosylated 27 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-294 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan structure is represented by GlyTouCan:G36131WL. Example: UniProtKB:P01042-1, Asn-294, MOD:00160~GNO:G36131WL. [PRO:DNx, PMID:19838169]", "evidence": [ { "id": "PR:000051567", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051567" } ] }, { "name": "kininogen-1 N-glycosylated 28 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-294 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G40926MX. Example: UniProtKB:P01042-1, Asn-294, MOD:00160~GNO:G40926MX. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051568", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051568" } ] }, { "name": "kininogen-1 N-glycosylated 29 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-294 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan structure is represented by GlyTouCan:G42358LZ. Example: UniProtKB:P01042-1, Asn-294, MOD:00160~GNO:G42358LZ. [PRO:DNx, PMID:24279413]", "evidence": [ { "id": "PR:000051569", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051569" } ] }, { "name": "kininogen-1 N-glycosylated 30 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-294 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P01042-1, Asn-294, MOD:00160~GNO:G43417UB. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051570", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051570" } ] }, { "name": "kininogen-1 N-glycosylated 31 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-294 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P01042-1, Asn-294, MOD:00160~GNO:G58001LT. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051571", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051571" } ] }, { "name": "kininogen-1 N-glycosylated 32 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-294 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P01042-1, Asn-294, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051572", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051572" } ] }, { "name": "kininogen-1 N-glycosylated 33 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-294 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G85144OK. Example: UniProtKB:P01042-1, Asn-294, MOD:00160~GNO:G85144OK. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051573", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051573" } ] }, { "name": "kininogen-1 N-glycosylated 34 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-294 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G94917XT. Example: UniProtKB:P01042-1, Asn-294, MOD:00160~GNO:G94917XT. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051574", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051574" } ] }, { "name": "kininogen-1 N-glycosylated 35 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-48 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P01042-1, Asn-48, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051575", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051575" } ] }, { "name": "kininogen-1 N-glycosylated 36 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-48 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G06247RL. Example: UniProtKB:P01042-1, Asn-48, MOD:00160~GNO:G06247RL. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051576", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051576" } ] }, { "name": "kininogen-1 N-glycosylated 37 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-48 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P01042-1, Asn-48, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051577", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051577" } ] }, { "name": "kininogen-1 N-glycosylated 38 (human)", "definition": "A kininogen-1 (human) that has been N-glycosylated at the residue equivalent to Asn-48 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G88374WZ. Example: UniProtKB:P01042-1, Asn-48, MOD:00160~GNO:G88374WZ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051578", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051578" } ] }, { "name": "kininogen-1 O-glycosylated 1 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Ser-120 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P01042-1, Ser-120, MOD:00002~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000051579", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051579" } ] }, { "name": "kininogen-1 O-glycosylated 2 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Ser-150 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G17015OC. Example: UniProtKB:P01042-1, Ser-150, MOD:00002~GNO:G17015OC. [PRO:DNx, PMID:26598643, PMID:30459171]", "evidence": [ { "id": "PR:000051580", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051580" } ] }, { "name": "kininogen-1 O-glycosylated 3 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Ser-150 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G27947YN. Example: UniProtKB:P01042-1, Ser-150, MOD:00002~GNO:G27947YN. [PRO:DNx, PMID:26598643, PMID:30459171]", "evidence": [ { "id": "PR:000051581", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051581" } ] }, { "name": "kininogen-1 O-glycosylated 4 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Ser-150 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P01042-1, Ser-150, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:26598643, PMID:30459171]", "evidence": [ { "id": "PR:000051582", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051582" } ] }, { "name": "kininogen-1 O-glycosylated 5 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Ser-150 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P01042-1, Ser-150, MOD:00002~GNO:G53434XO. [PRO:DNx, PMID:26598643, PMID:30459171]", "evidence": [ { "id": "PR:000051583", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051583" } ] }, { "name": "kininogen-1 O-glycosylated 6 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Ser-150 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P01042-1, Ser-150, MOD:00002~GNO:G58001LT. [PRO:DNx, PMID:26598643, PMID:30459171]", "evidence": [ { "id": "PR:000051584", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051584" } ] }, { "name": "kininogen-1 O-glycosylated 7 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Ser-408 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P01042-1, Ser-408, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000051585", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051585" } ] }, { "name": "kininogen-1 O-glycosylated 8 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Ser-531 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G73004SD. Example: UniProtKB:P01042-1, Ser-531, MOD:00002~GNO:G73004SD. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000051586", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051586" } ] }, { "name": "kininogen-1 O-glycosylated 9 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Ser-550 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P01042-1, Ser-550, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000051587", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051587" } ] }, { "name": "kininogen-1 O-glycosylated 10 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Ser-577 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G17015OC. Example: UniProtKB:P01042-1, Ser-577, MOD:00002~GNO:G17015OC. [PRO:DNx, PMID:26598643]", "evidence": [ { "id": "PR:000051588", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051588" } ] }, { "name": "kininogen-1 O-glycosylated 11 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Ser-599 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P01042-1, Ser-599, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000051589", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051589" } ] }, { "name": "kininogen-1 O-glycosylated 12 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Ser-599 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P01042-1, Ser-599, MOD:00002~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000051590", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051590" } ] }, { "name": "kininogen-1 O-glycosylated 13 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Ser-604 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G23729WG. Example: UniProtKB:P01042-1, Ser-604, MOD:00002~GNO:G23729WG. [PRO:DNx, PMID:26598643, PMID:30459171]", "evidence": [ { "id": "PR:000051591", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051591" } ] }, { "name": "kininogen-1 O-glycosylated 14 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Ser-604 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P01042-1, Ser-604, MOD:00002~GNO:G29068FM. [PRO:DNx, PMID:26598643, PMID:30459171]", "evidence": [ { "id": "PR:000051592", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051592" } ] }, { "name": "kininogen-1 O-glycosylated 15 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Ser-604 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P01042-1, Ser-604, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:26598643, PMID:30459171]", "evidence": [ { "id": "PR:000051593", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051593" } ] }, { "name": "kininogen-1 O-glycosylated 16 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Thr-137 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G17015OC. Example: UniProtKB:P01042-1, Thr-137, MOD:00005~GNO:G17015OC. [PRO:DNx, PMID:26598643, PMID:30459171]", "evidence": [ { "id": "PR:000051594", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051594" } ] }, { "name": "kininogen-1 O-glycosylated 17 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Thr-137 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G23729WG. Example: UniProtKB:P01042-1, Thr-137, MOD:00005~GNO:G23729WG. [PRO:DNx, PMID:26598643, PMID:30459171]", "evidence": [ { "id": "PR:000051595", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051595" } ] }, { "name": "kininogen-1 O-glycosylated 18 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Thr-137 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P01042-1, Thr-137, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:26598643, PMID:30459171]", "evidence": [ { "id": "PR:000051596", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051596" } ] }, { "name": "kininogen-1 O-glycosylated 19 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Thr-137 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P01042-1, Thr-137, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:26598643, PMID:30459171]", "evidence": [ { "id": "PR:000051597", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051597" } ] }, { "name": "kininogen-1 O-glycosylated 20 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Thr-137 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P01042-1, Thr-137, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:26598643, PMID:30459171]", "evidence": [ { "id": "PR:000051598", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051598" } ] }, { "name": "kininogen-1 O-glycosylated 21 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Thr-137 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G57317CE. Example: UniProtKB:P01042-1, Thr-137, MOD:00005~GNO:G57317CE. [PRO:DNx, PMID:26598643, PMID:30459171]", "evidence": [ { "id": "PR:000051599", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051599" } ] }, { "name": "kininogen-1 O-glycosylated 22 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Thr-137 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P01042-1, Thr-137, MOD:00005~GNO:G58001LT. [PRO:DNx, PMID:26598643, PMID:30459171]", "evidence": [ { "id": "PR:000051600", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051600" } ] }, { "name": "kininogen-1 O-glycosylated 23 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Thr-137 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G94917XT. Example: UniProtKB:P01042-1, Thr-137, MOD:00005~GNO:G94917XT. [PRO:DNx, PMID:26598643, PMID:30459171]", "evidence": [ { "id": "PR:000051601", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051601" } ] }, { "name": "kininogen-1 O-glycosylated 24 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Thr-137 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G95678HJ. Example: UniProtKB:P01042-1, Thr-137, MOD:00005~GNO:G95678HJ. [PRO:DNx, PMID:26598643, PMID:30459171]", "evidence": [ { "id": "PR:000051602", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051602" } ] }, { "name": "kininogen-1 O-glycosylated 25 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Thr-151 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G17015OC. Example: UniProtKB:P01042-1, Thr-151, MOD:00005~GNO:G17015OC. [PRO:DNx, PMID:26598643, PMID:30459171]", "evidence": [ { "id": "PR:000051603", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051603" } ] }, { "name": "kininogen-1 O-glycosylated 26 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Thr-151 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P01042-1, Thr-151, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:26598643, PMID:30459171]", "evidence": [ { "id": "PR:000051604", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051604" } ] }, { "name": "kininogen-1 O-glycosylated 27 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Thr-151 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P01042-1, Thr-151, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:26598643, PMID:30459171]", "evidence": [ { "id": "PR:000051605", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051605" } ] }, { "name": "kininogen-1 O-glycosylated 28 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Thr-273 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P01042-1, Thr-273, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000051606", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051606" } ] }, { "name": "kininogen-1 O-glycosylated 29 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Thr-273 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P01042-1, Thr-273, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000051607", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051607" } ] }, { "name": "kininogen-1 O-glycosylated 30 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Thr-400 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P01042-1, Thr-400, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000051608", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051608" } ] }, { "name": "kininogen-1 O-glycosylated 31 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Thr-400 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G57317CE. Example: UniProtKB:P01042-1, Thr-400, MOD:00005~GNO:G57317CE. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000051609", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051609" } ] }, { "name": "kininogen-1 O-glycosylated 32 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Thr-401 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G06247RL. Example: UniProtKB:P01042-1, Thr-401, MOD:00005~GNO:G06247RL. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000051610", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051610" } ] }, { "name": "kininogen-1 O-glycosylated 33 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Thr-401 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P01042-1, Thr-401, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000051611", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051611" } ] }, { "name": "kininogen-1 O-glycosylated 34 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Thr-401 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P01042-1, Thr-401, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000051612", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051612" } ] }, { "name": "kininogen-1 O-glycosylated 35 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Thr-401 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P01042-1, Thr-401, MOD:00005~GNO:G58001LT. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000051613", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051613" } ] }, { "name": "kininogen-1 O-glycosylated 36 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Thr-407 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P01042-1, Thr-407, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000051614", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051614" } ] }, { "name": "kininogen-1 O-glycosylated 37 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Thr-407 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P01042-1, Thr-407, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000051615", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051615" } ] }, { "name": "kininogen-1 O-glycosylated 38 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Thr-532 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P01042-1, Thr-532, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000051616", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051616" } ] }, { "name": "kininogen-1 O-glycosylated 39 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Thr-532 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P01042-1, Thr-532, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000051617", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051617" } ] }, { "name": "kininogen-1 O-glycosylated 40 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Thr-532 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P01042-1, Thr-532, MOD:00005~GNO:G58001LT. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000051618", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051618" } ] }, { "name": "kininogen-1 O-glycosylated 41 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Thr-533 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P01042-1, Thr-533, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000051619", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051619" } ] }, { "name": "kininogen-1 O-glycosylated 42 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Thr-533 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P01042-1, Thr-533, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000051620", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051620" } ] }, { "name": "kininogen-1 O-glycosylated 43 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Thr-533 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P01042-1, Thr-533, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000051621", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051621" } ] }, { "name": "kininogen-1 O-glycosylated 44 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Thr-542 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P01042-1, Thr-542, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000051622", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051622" } ] }, { "name": "kininogen-1 O-glycosylated 45 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Thr-542 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P01042-1, Thr-542, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000051623", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051623" } ] }, { "name": "kininogen-1 O-glycosylated 46 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Thr-546 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P01042-1, Thr-546, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000051624", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051624" } ] }, { "name": "kininogen-1 O-glycosylated 47 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Thr-546 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P01042-1, Thr-546, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000051625", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051625" } ] }, { "name": "kininogen-1 O-glycosylated 48 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Thr-546 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P01042-1, Thr-546, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000051626", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051626" } ] }, { "name": "kininogen-1 O-glycosylated 49 (human)", "definition": "A kininogen-1 (human) that has been O-glycosylated at the residue equivalent to Thr-571 of the amino acid sequence represented by UniProtKB:P01042-1, in which the glycan composition is represented by GlyTouCan:G23729WG. Example: UniProtKB:P01042-1, Thr-571, MOD:00005~GNO:G23729WG. [PRO:DNx, PMID:26598643]", "evidence": [ { "id": "PR:000051627", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051627" } ] } ], "site_annotation": [ { "start_pos": 169, "end_pos": 171, "annotation": "n_glycosylation_sequon" }, { "start_pos": 205, "end_pos": 207, "annotation": "n_glycosylation_sequon" }, { "start_pos": 294, "end_pos": 296, "annotation": "n_glycosylation_sequon" }, { "start_pos": 48, "end_pos": 50, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "(Microbial infection) Bradykinin is generated upon proteolytic cleavage by S.pyogenes SpeB to produce hypotension during septic shock.", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" }, { "database": "PubMed", "id": "8760820", "url": "https://glygen.org/publication/PubMed/8760820" } ] }, { "annotation": "Bradykinin is inactivated by ACE, which removes the dipeptide Arg-Phe from its C-terminus.", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" }, { "database": "PubMed", "id": "4322742", "url": "https://glygen.org/publication/PubMed/4322742" }, { "database": "PubMed", "id": "6055465", "url": "https://glygen.org/publication/PubMed/6055465" } ] }, { "annotation": "Bradykinin is released from kininogen by plasma kallikrein.", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" }, { "database": "PubMed", "id": "3366244", "url": "https://glygen.org/publication/PubMed/3366244" } ] }, { "annotation": "Hydroxylation of Pro-383 occurs prior to the release of bradykinin.", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" }, { "database": "PubMed", "id": "3366244", "url": "https://glygen.org/publication/PubMed/3366244" }, { "database": "PubMed", "id": "3182782", "url": "https://glygen.org/publication/PubMed/3182782" } ] }, { "annotation": "N- and O-glycosylated. O-glycosylated with core 1 or possibly core 8 glycans.", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" }, { "database": "PubMed", "id": "19838169", "url": "https://glygen.org/publication/PubMed/19838169" }, { "database": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" }, { "database": "PubMed", "id": "14760718", "url": "https://glygen.org/publication/PubMed/14760718" }, { "database": "PubMed", "id": "3484703", "url": "https://glygen.org/publication/PubMed/3484703" }, { "database": "PubMed", "id": "16335952", "url": "https://glygen.org/publication/PubMed/16335952" }, { "database": "PubMed", "id": "12754519", "url": "https://glygen.org/publication/PubMed/12754519" }, { "database": "PubMed", "id": "19139490", "url": "https://glygen.org/publication/PubMed/19139490" } ] }, { "annotation": "Phosphorylated by FAM20C in the extracellular medium.", "evidence": [ { "database": "UniProtKB", "id": "P01042", "url": "https://www.uniprot.org/uniprot/P01042" }, { "database": "PubMed", "id": "26091039", "url": "https://glygen.org/publication/PubMed/26091039" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [ { "assessed_biomarker_entity": "Glyco-typer 50 N-glycan liver disease panel", "biomarker_id": "A0245", "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "31721442", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31721442" }, { "id": "31177770", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31177770" } ], "instances": [ { "best_biomarker_type": "monitoring", "status": "MALDI-MS measured N-glycans", "disease": { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] }, "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "evidence": [ { "id": "GLY_000737", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000737" }, { "id": "31721442", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31721442" }, { "id": "31177770", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31177770" }, { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" } ] } ] }, { "assessed_biomarker_entity": "Liver cancer GOLM1, FC-KIN, FC-A1AT panel", "biomarker_id": "A0470", "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "19454616", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19454616" } ], "instances": [ { "best_biomarker_type": "diagnostic", "status": "increased GOLM1, FC-KIN, FC-A1AT level", "disease": { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] }, "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "19454616", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19454616" } ] } ] } ], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 48, 169, 180, 205, 294, 626 ], "o_linked_sites": [ 120, 137, 150, 151, 273, 393, 398, 400, 401, 407, 408, 418, 521, 531, 532, 533, 542, 546, 550, 557, 571, 577, 599, 604, 621, 628 ], "snv_sites": [ 48, 115, 123, 150, 151, 205, 207, 285, 295, 400, 401, 531, 532, 533, 546, 557, 571, 628, 638 ], "glycation_sites": [], "phosphorylation_sites": [ 326, 327, 329, 332 ], "sequon_annotation_sites": [ { "start_pos": 169, "end_pos": 171 }, { "start_pos": 205, "end_pos": 207 }, { "start_pos": 294, "end_pos": 296 }, { "start_pos": 48, "end_pos": 50 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 224 }, { "field": "total_sites", "count": 28 }, { "field": "n_linked_glycans", "count": 86 }, { "field": "n_linked_glycan_sites", "count": 10 }, { "field": "o_linked_glycans", "count": 14 }, { "field": "o_linked_glycan_sites", "count": 28 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 10 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 6 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 211 }, { "field": "total_sites", "count": 25 }, { "field": "n_linked_glycans", "count": 86 }, { "field": "n_linked_glycan_sites", "count": 5 }, { "field": "o_linked_glycans", "count": 14 }, { "field": "o_linked_glycan_sites", "count": 20 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 25 }, { "field": "total_sites", "count": 19 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 25 }, { "field": "total_sites", "count": 19 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 310 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }