{ "uniprot_canonical_ac": "P01023-1", "uniprot_ac": "P01023", "uniprot_id": "A2MG_HUMAN", "mass": { "chemical_mass": 163291.0, "monoisotopic_mass": 163291.0 }, "refseq": { "ac": "NP_000005", "name": "alpha-2-macroglobulin isoform a precursor", "summary": "The protein encoded by this gene is a protease inhibitor and cytokine transporter. It uses a bait-and-trap mechanism to inhibit a broad spectrum of proteases, including trypsin, thrombin and collagenase. It can also inhibit inflammatory cytokines, and it thus disrupts inflammatory cascades. Mutations in this gene are a cause of alpha-2-macroglobulin deficiency. This gene is implicated in Alzheimer's disease (AD) due to its ability to mediate the clearance and degradation of A-beta, the major component of beta-amyloid deposits. A related pseudogene, which is also located on the p arm of chromosome 12, has been identified. [provided by RefSeq, Nov 2016].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000005" }, "gene_names": [ { "name": "A2M", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P01023", "id": "P01023" }, { "name": "A2MD; CPAMD5; FWP007; S863-7", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000005", "id": "NP_000005" }, { "name": "A2M", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000005", "id": "NP_000005" }, { "name": "CPAMD5", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P01023", "id": "P01023" }, { "name": "FWP007", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P01023", "id": "P01023" } ], "protein_names": [ { "name": "Alpha-2-macroglobulin", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P01023" }, { "name": "Alpha-2-M", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01023" }, { "name": "C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01023" }, { "name": "alpha-2-M; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000005", "id": "NP_000005" }, { "name": "alpha-2-macroglobulin isoform a precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000005", "id": "NP_000005" } ], "function": [ { "annotation": "Alpha-2 macroglobulin activity in SARS-CoV-2 induced infection and in the post-COVID-19 period.", "evidence": [ { "database": "RefSeq", "id": "NP_000005", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000005" }, { "database": "PubMed", "id": "37705485", "url": "https://glygen.org/publication/PubMed/37705485" } ] }, { "annotation": "Alpha-2-Macroglobulin (A2M) and Dopamine Receptor D2 (DRD2) expression analysis and Influence of Separation from Parents in Childhood on the Suicide and Self-injury Behavior and Psychological Adjustment in Adolescence. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000005", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000005" }, { "database": "PubMed", "id": "37213155", "url": "https://glygen.org/publication/PubMed/37213155" } ] }, { "annotation": "Alpha-2-macroglobulin is involved in the occurrence of early-onset pre-eclampsia via its negative impact on uterine spiral artery remodeling and placental angiogenesis. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000005", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000005" }, { "database": "PubMed", "id": "36894970", "url": "https://glygen.org/publication/PubMed/36894970" } ] }, { "annotation": "Alpha-2-macroglobulin prevents platelet aggregation induced by brain-derived neurotrophic factor.", "evidence": [ { "database": "RefSeq", "id": "NP_000005", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000005" }, { "database": "PubMed", "id": "37487878", "url": "https://glygen.org/publication/PubMed/37487878" } ] }, { "annotation": "Is able to inhibit all four classes of proteinases by a unique 'trapping' mechanism. This protein has a peptide stretch, called the 'bait region' which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein which traps the proteinase. The entrapped enzyme remains active against low molecular weight substrates (activity against high molecular weight substrates is greatly reduced). Following cleavage in the bait region, a thioester bond is hydrolyzed and mediates the covalent binding of the protein to the proteinase.", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023#function" } ] }, { "annotation": "The protein encoded by this gene is a protease inhibitor and cytokine transporter. It uses a bait-and-trap mechanism to inhibit a broad spectrum of proteases, including trypsin, thrombin and collagenase. It can also inhibit inflammatory cytokines, and it thus disrupts inflammatory cascades. Mutations in this gene are a cause of alpha-2-macroglobulin deficiency. This gene is implicated in Alzheimer's disease (AD) due to its ability to mediate the clearance and degradation of A-beta, the major component of beta-amyloid deposits. A related pseudogene, which is also located on the p arm of chromosome 12, has been identified. [provided by RefSeq, Nov 2016].", "evidence": [ { "database": "RefSeq", "id": "NP_000005", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000005" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs1456381556", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1456381556" }, { "id": "rs1456381556", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1456381556" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1079, "end_pos": 1079, "sequence_org": "C", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NGC->NGS).", "chr_id": "12", "chr_pos": "9077741", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "C1079", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P01023", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P01023" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1090, "end_pos": 1090, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "A", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NNA->NNT).", "chr_id": "12", "chr_pos": "9077709", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "A1090", "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P01023", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P01023" }, { "id": "rs773333847", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773333847" }, { "id": "rs773333847", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs773333847" }, { "id": "rs773333847", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773333847" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1091, "end_pos": 1091, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "I", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NAI->NAT).", "chr_id": "12", "chr_pos": "9077705", "ref_nt": "A", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "I1091", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs1219589381", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1219589381" }, { "id": "rs1219589381", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1219589381#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 1100, "end_pos": 1100, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TLS->NLS).", "chr_id": "12", "chr_pos": "9077398", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1100", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P01023", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P01023" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1178, "end_pos": 1178, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DNS->NNS).", "chr_id": "12", "chr_pos": "9076756", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "D1178", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1592329586", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1592329586" }, { "id": "rs1592329586", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1592329586" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1296, "end_pos": 1296, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NNN->NNT).", "chr_id": "12", "chr_pos": "9072741", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N1296", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs376258518", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs376258518" }, { "id": "rs376258518", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs376258518" }, { "id": "rs376258518", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs376258518#frequency_tab" }, { "id": "rs376258518", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs376258518" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1297, "end_pos": 1297, "sequence_org": "R", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NNR->NNS).", "chr_id": "12", "chr_pos": "9072739", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "R1297", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P01023", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P01023" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 1406, "end_pos": 1406, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (SRT->NRT).", "chr_id": "12", "chr_pos": "9069791", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S1406", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1212144452", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1212144452" }, { "id": "rs1212144452", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1212144452" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 1424, "end_pos": 1424, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "12", "chr_pos": "9068836", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N1424", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P01023", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P01023" } ], "glycoeffect": [], "start_pos": 174, "end_pos": 174, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "12", "chr_pos": "9110019", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "R174", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P01023", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P01023" } ], "glycoeffect": [], "start_pos": 176, "end_pos": 176, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "A", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "12", "chr_pos": "9110014", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "A176", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] }, { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1565603350", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1565603350" }, { "id": "rs1565603350", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1565603350" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 247, "end_pos": 247, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->DVS).", "chr_id": "12", "chr_pos": "9109340", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N247", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P01023", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P01023" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 249, "end_pos": 249, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "L", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVS->NVL).", "chr_id": "12", "chr_pos": "9109333", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "S249", "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1243013494", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1243013494" }, { "id": "rs1243013494", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1243013494" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 26, "end_pos": 26, "sequence_org": "S", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->A).", "chr_id": "12", "chr_pos": "9115774", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S26", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs564083712", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs564083712" }, { "id": "rs564083712", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs564083712" }, { "id": "rs564083712", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs564083712" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 26, "end_pos": 26, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).", "chr_id": "12", "chr_pos": "9115773", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S26", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P01023", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P01023" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 271, "end_pos": 271, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "K", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (KYS->NYS).", "chr_id": "12", "chr_pos": "9107590", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "K271", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs960174561", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs960174561" }, { "id": "rs960174561", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs960174561" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 393, "end_pos": 393, "sequence_org": "Y", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (YYS->NYS).", "chr_id": "12", "chr_pos": "9104328", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "Y393", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1372954090", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1372954090" }, { "id": "rs1372954090", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1372954090#frequency_tab" }, { "id": "rs1372954090", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1372954090" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 396, "end_pos": 396, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "12", "chr_pos": "9104318", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N396", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1295070139", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1295070139" }, { "id": "rs1295070139", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1295070139" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 397, "end_pos": 397, "sequence_org": "A", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->NPT).", "chr_id": "12", "chr_pos": "9104316", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A397", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs766284551", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766284551" }, { "id": "rs766284551", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766284551" }, { "id": "rs766284551", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs766284551#frequency_tab" }, { "id": "rs766284551", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs766284551" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 410, "end_pos": 410, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->TTT).", "chr_id": "12", "chr_pos": "9104276", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N410", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs750259914", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750259914" }, { "id": "rs750259914", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750259914" }, { "id": "rs750259914", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750259914" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 412, "end_pos": 412, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->NTA).", "chr_id": "12", "chr_pos": "9104271", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T412", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1482300294", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1482300294" }, { "id": "rs1482300294", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1482300294#frequency_tab" }, { "id": "rs1482300294", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1482300294" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 412, "end_pos": 412, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->NTI).", "chr_id": "12", "chr_pos": "9104270", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T412", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1482300294", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1482300294" }, { "id": "rs1482300294", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1482300294#frequency_tab" }, { "id": "rs1482300294", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1482300294" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 412, "end_pos": 412, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->NTN).", "chr_id": "12", "chr_pos": "9104270", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T412", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1592400236", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1592400236" }, { "id": "rs1592400236", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1592400236" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 41, "end_pos": 41, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TET->NET).", "chr_id": "12", "chr_pos": "9113508", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T41", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1361985635", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1361985635" }, { "id": "rs1361985635", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1361985635" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 569, "end_pos": 569, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DLS->NLS).", "chr_id": "12", "chr_pos": "9098753", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D569", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P01023", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P01023" }, { "id": "rs746476250", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746476250" }, { "id": "rs746476250", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746476250" }, { "id": "rs746476250", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746476250" }, { "id": "rs746476250", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746476250" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 571, "end_pos": 571, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (SFS->NFS).", "chr_id": "12", "chr_pos": "9098746", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S571", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs200420993", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200420993" }, { "id": "rs200420993", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200420993" }, { "id": "rs200420993", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200420993" }, { "id": "rs200420993", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200420993#frequency_tab" }, { "id": "rs200420993", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200420993" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 57, "end_pos": 57, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->NEI).", "chr_id": "12", "chr_pos": "9113460", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.000599", "site_lbl": "T57", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1309526285", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1309526285" }, { "id": "rs1309526285", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1309526285" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 588, "end_pos": 588, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "12", "chr_pos": "9098695", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T588", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs765169441", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765169441" }, { "id": "rs765169441", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765169441" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 61, "end_pos": 61, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SAS->NAS).", "chr_id": "12", "chr_pos": "9113448", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S61", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1478396272", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1478396272" }, { "id": "rs1478396272", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1478396272#frequency_tab" }, { "id": "rs1478396272", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1478396272" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 749, "end_pos": 749, "sequence_org": "A", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSA->NSS).", "chr_id": "12", "chr_pos": "9091425", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A749", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1478396272", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1478396272" }, { "id": "rs1478396272", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1478396272#frequency_tab" }, { "id": "rs1478396272", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1478396272" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 749, "end_pos": 749, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSA->NST).", "chr_id": "12", "chr_pos": "9091425", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A749", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P01023", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P01023" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 885, "end_pos": 885, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "A", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->A).", "chr_id": "12", "chr_pos": "9089967", "ref_nt": "T", "alt_nt": "C", "minor_allelic_frequency": "", "site_lbl": "T885", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs200926793", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200926793" }, { "id": "rs200926793", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200926793" }, { "id": "rs200926793", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200926793#frequency_tab" }, { "id": "rs200926793", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200926793" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 993, "end_pos": 993, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->NEI).", "chr_id": "12", "chr_pos": "9079692", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T993", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "99.24", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000175899", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175899" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "94.75", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000175899", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175899" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "99.26", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000175899", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175899" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "99.54", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000175899", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175899" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "99.47", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000175899", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175899" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "99.27", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000175899", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175899" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "98.64", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000175899", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175899" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "99.59", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000175899", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175899" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "99.14", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000175899", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175899" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "99.96", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000175899", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175899" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "99.64", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000175899", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175899" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "98.75", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000175899", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175899" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "99.24", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000175899", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175899" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P01023", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01023" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P01023", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01023" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P01023", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01023" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P01023", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01023" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P01023", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01023" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P01023", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01023" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P01023", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01023" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P01023", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01023" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P01023", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01023" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P01023", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01023" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P01023", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01023" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P01023", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01023" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "common_name": "Human" } ], "gene": [ { "name": "A2M", "url": "https://www.uniprot.org/uniprot/P01023", "locus": { "chromosome": "12", "start_pos": 9067664, "end_pos": 9116229, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000175899", "url": "https://www.ensembl.org/id/ENSG00000175899" } ] } } ], "crossref": [ { "id": "ENSG00000175899", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175899", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P01023", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P01023", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd02897", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd02897", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL4295690", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4295690", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "A2M", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=A2M", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "2", "url": "https://www.ncbi.nlm.nih.gov/gene/2", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "730", "url": "https://glyconnect.expasy.org/browser/proteins/730", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "7", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=7", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P01023", "url": "https://www.ebi.ac.uk/intact/interactors/id:P01023*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001599", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001599", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002890", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002890", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008930", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008930", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009048", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009048", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR010916", "url": "https://www.ebi.ac.uk/interpro/entry/IPR010916", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011625", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011625", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011626", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011626", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014756", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014756", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019742", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019742", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036595", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036595", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR040839", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040839", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR041555", "url": "https://www.ebi.ac.uk/interpro/entry/IPR041555", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR041813", "url": "https://www.ebi.ac.uk/interpro/entry/IPR041813", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047565", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047565", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:2", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "103950", "url": "http://www.omim.org/entry/103950", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P01023", "url": "https://www.nextprot.org/entry/NX_P01023", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P01023", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01023", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "HVNRTEV", "url": "https://omabrowser.org/oma/group/HVNRTEV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2970602at2759", "url": "http://www.orthodb.org/?query=2970602at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11412", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11412", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11412:SF165", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11412:SF165", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1BV8", "url": "https://www.rcsb.org/structure/1BV8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2P9R", "url": "https://www.rcsb.org/structure/2P9R", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6TAV", "url": "https://www.rcsb.org/structure/6TAV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7O7L", "url": "https://www.rcsb.org/structure/7O7L", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7O7M", "url": "https://www.rcsb.org/structure/7O7M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7O7N", "url": "https://www.rcsb.org/structure/7O7N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7O7O", "url": "https://www.rcsb.org/structure/7O7O", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7O7P", "url": "https://www.rcsb.org/structure/7O7P", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7O7Q", "url": "https://www.rcsb.org/structure/7O7Q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7O7R", "url": "https://www.rcsb.org/structure/7O7R", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7O7S", "url": "https://www.rcsb.org/structure/7O7S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7VON", "url": "https://www.rcsb.org/structure/7VON", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7VOO", "url": "https://www.rcsb.org/structure/7VOO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00207", "url": "http://pfam.xfam.org/family/PF00207", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF01835", "url": "http://pfam.xfam.org/family/PF01835", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF07677", "url": "http://pfam.xfam.org/family/PF07677", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF07678", "url": "http://pfam.xfam.org/family/PF07678", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF07703", "url": "http://pfam.xfam.org/family/PF07703", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF17789", "url": "http://pfam.xfam.org/family/PF17789", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF17791", "url": "http://pfam.xfam.org/family/PF17791", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P01023", "url": "https://pharos.nih.gov/targets/P01023", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000051449", "url": "https://proconsortium.org/app/entry/PR:000051449", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051450", "url": "https://proconsortium.org/app/entry/PR:000051450", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051451", "url": "https://proconsortium.org/app/entry/PR:000051451", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051452", "url": "https://proconsortium.org/app/entry/PR:000051452", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051453", "url": "https://proconsortium.org/app/entry/PR:000051453", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051454", "url": "https://proconsortium.org/app/entry/PR:000051454", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051455", "url": "https://proconsortium.org/app/entry/PR:000051455", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051456", "url": "https://proconsortium.org/app/entry/PR:000051456", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051457", "url": "https://proconsortium.org/app/entry/PR:000051457", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051458", "url": "https://proconsortium.org/app/entry/PR:000051458", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051459", "url": "https://proconsortium.org/app/entry/PR:000051459", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051460", "url": "https://proconsortium.org/app/entry/PR:000051460", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051461", "url": "https://proconsortium.org/app/entry/PR:000051461", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051462", "url": "https://proconsortium.org/app/entry/PR:000051462", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051463", "url": "https://proconsortium.org/app/entry/PR:000051463", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051464", "url": "https://proconsortium.org/app/entry/PR:000051464", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051465", "url": "https://proconsortium.org/app/entry/PR:000051465", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051466", "url": "https://proconsortium.org/app/entry/PR:000051466", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051467", "url": "https://proconsortium.org/app/entry/PR:000051467", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051468", "url": "https://proconsortium.org/app/entry/PR:000051468", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051469", "url": "https://proconsortium.org/app/entry/PR:000051469", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051470", "url": "https://proconsortium.org/app/entry/PR:000051470", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051471", "url": "https://proconsortium.org/app/entry/PR:000051471", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051472", "url": "https://proconsortium.org/app/entry/PR:000051472", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051473", "url": "https://proconsortium.org/app/entry/PR:000051473", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051474", "url": "https://proconsortium.org/app/entry/PR:000051474", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051475", "url": "https://proconsortium.org/app/entry/PR:000051475", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051476", "url": "https://proconsortium.org/app/entry/PR:000051476", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051477", "url": "https://proconsortium.org/app/entry/PR:000051477", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051478", "url": "https://proconsortium.org/app/entry/PR:000051478", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051479", "url": "https://proconsortium.org/app/entry/PR:000051479", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P01023", "url": "http://purl.obolibrary.org/obo/PR_P01023", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8963896", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963896", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_000005", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000005", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P01023", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "F5H1E8", "url": "https://www.uniprot.org/uniprot/F5H1E8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H1E8-1", "url": "https://www.uniprot.org/uniprot/F5H1E8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8W7L3", "url": "https://www.uniprot.org/uniprot/F8W7L3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8W7L3-1", "url": "https://www.uniprot.org/uniprot/F8W7L3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YFH1", "url": "https://www.uniprot.org/uniprot/H0YFH1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YFH1-1", "url": "https://www.uniprot.org/uniprot/H0YFH1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01023-1", "url": "https://www.uniprot.org/uniprot/P01023-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGKNKLLHPSLVLLLLVLLPTDASVSGKPQYMVLVPSLLHTETTEKGCVLLSYLNETVTVSASLESVRGNRSLFTDLEAENDVLHCVAFAVPKSSSNEEVMFLTVQVKGPTQEFKKRTTVMVKNEDSLVFVQTDKSIYKPGQTVKFRVVSMDENFHPLNELIPLVYIQDPKGNRIAQWQSFQLEGGLKQFSFPLSSEPFQGSYKVVVQKKSGGRTEHPFTVEEFVLPKFEVQVTVPKIITILEEEMNVSVCGLYTYGKPVPGHVTVSICRKYSDASDCHGEDSQAFCEKFSGQLNSHGCFYQQVKTKVFQLKRKEYEMKLHTEAQIQEEGTVVELTGRQSSEITRTITKLSFVKVDSHFRQGIPFFGQVRLVDGKGVPIPNKVIFIRGNEANYYSNATTDEHGLVQFSINTTNVMGTSLTVRVNYKDRSPCYGYQWVSEEHEEAHHTAYLVFSPSKSFVHLEPMSHELPCGHTQTVQAHYILNGGTLLGLKKLSFYYLIMAKGGIVRTGTHGLLVKQEDMKGHFSISIPVKSDIAPVARLLIYAVLPTGDVIGDSAKYDVENCLANKVDLSFSPSQSLPASHAHLRVTAAPQSVCALRAVDQSVLLMKPDAELSASSVYNLLPEKDLTGFPGPLNDQDNEDCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTETVRKYFPETWIWDLVVVNSAGVAEVGVTVPDTITEWKAGAFCLSEDAGLGISSTASLRAFQPFFVELTMPYSVIRGEAFTLKATVLNYLPKCIRVSVQLEASPAFLAVPVEKEQAPHCICANGRQTVSWAVTPKSLGNVNFTVSAEALESQELCGTEVPSVPEHGRKDTVIKPLLVEPEGLEKETTFNSLLCPSGGEVSEELSLKLPPNVVEESARASVSVLGDILGSAMQNTQNLLQMPYGCGEQNMVLFAPNIYVLDYLNETQQLTPEIKSKAIGYLNTGYQRQLNYKHYDGSYSTFGERYGRNQGNTWLTAFVLKTFAQARAYIFIDEAHITQALIWLSQRQKDNGCFRSSGSLLNNAIKGGVEDEVTLSAYITIALLEIPLTVTHPVVRNALFCLESAWKTAQEGDHGSHVYTKALLAYAFALAGNQDKRKEVLKSLNEEAVKKDNSVHWERPQKPKAPVGHFYEPQAPSAEVEMTSYVLLAYLTAQPAPTSEDLTSATNIVKWITKQQNAQGGFSSTQDTVVALHALSKYGAATFTRTGKAAQVTIQSSGTFSSKFQVDNNNRLLLQQVSLPELPGEYSMKVTGEGCVYLQTSLKYNILPEKEEFPFALGVQTLPQTCDEPKAHTSFQISLSVSYTGSRSASNMAIVDVKMVSGFIPLKPTVKMLERSNHVSRTEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVRDLKPAIVKVYDYYETDEFAIAEYNAPCSKDLGNA", "length": 1474, "header": "sp|P01023-1|A2MG_HUMAN Isoform 1 of Alpha-2-macroglobulin OS=Homo sapiens OX=9606 GN=A2M PE=1 SV=3 CANONICAL=P01023-1" }, "isoforms": [ { "isoform_ac": "F5H1E8-1", "url": "", "sequence": { "sequence": "MGKNKLLHPSLVLLLLVLLPTDASVSGKPQYMVLVPSLLHTETTEKGCVLLSYLNETVTVSASLESVRGNRSLFTDLEAENDVLHCVAFA", "length": 90, "header": "tr|F5H1E8-1|A2MG_HUMAN Computationally mapped isoform of Alpha-2-macroglobulin OS=Homo sapiens OX=9606 GN=A2M PE=1 SV=1 CANONICAL=P01023-1" }, "locus": { "chromosome": "12", "start_pos": 9115849, "end_pos": 9113360, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000539638.5", "url": "https://www.ensembl.org/id/ENST00000539638.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000445717.1", "url": "https://www.ensembl.org/id/ENSP00000445717.1" } ] } }, { "isoform_ac": "F8W7L3-1", "url": "", "sequence": { "sequence": "MGKNKLLHPSLVLLLLVLLPTDASVSGKPQYMVLVPSLLHTETTEKGCVLLSYLNETVTVSASLESVRGNRSLFTDLEAENDVLHCVAFAVPKSSSNEEVMFLTVQVKGPTQEFKKRTTVMVKNEDSLVFVQTDKSIYKPGQTVKFRVVSMDENFHPLNELIPLVYIQ", "length": 168, "header": "tr|F8W7L3-1|A2MG_HUMAN Computationally mapped isoform of Alpha-2-macroglobulin OS=Homo sapiens OX=9606 GN=A2M PE=1 SV=1 CANONICAL=P01023-1" }, "locus": { "chromosome": "12", "start_pos": 9115849, "end_pos": 9110314, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000404455.2", "url": "https://www.ensembl.org/id/ENST00000404455.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000385710.2", "url": "https://www.ensembl.org/id/ENSP00000385710.2" } ] } }, { "isoform_ac": "H0YFH1-1", "url": "", "sequence": { "sequence": "NGGTLLGLKKLSFYYLIMAKGGIVRTGTHGLLVKQEDMKGHFSISIPVKSDIAPVARFTTCYQKRTSLASLGL", "length": 73, "header": "tr|H0YFH1-1|A2MG_HUMAN Computationally mapped isoform of Alpha-2-macroglobulin OS=Homo sapiens OX=9606 GN=A2M PE=1 SV=1 CANONICAL=P01023-1" }, "locus": { "chromosome": "12", "start_pos": 9101494, "end_pos": 9095652, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000546069.1", "url": "https://www.ensembl.org/id/ENST00000546069.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000438599.1", "url": "https://www.ensembl.org/id/ENSP00000438599.1" } ] } }, { "isoform_ac": "P01023-1", "url": "", "sequence": { "sequence": "MGKNKLLHPSLVLLLLVLLPTDASVSGKPQYMVLVPSLLHTETTEKGCVLLSYLNETVTVSASLESVRGNRSLFTDLEAENDVLHCVAFAVPKSSSNEEVMFLTVQVKGPTQEFKKRTTVMVKNEDSLVFVQTDKSIYKPGQTVKFRVVSMDENFHPLNELIPLVYIQDPKGNRIAQWQSFQLEGGLKQFSFPLSSEPFQGSYKVVVQKKSGGRTEHPFTVEEFVLPKFEVQVTVPKIITILEEEMNVSVCGLYTYGKPVPGHVTVSICRKYSDASDCHGEDSQAFCEKFSGQLNSHGCFYQQVKTKVFQLKRKEYEMKLHTEAQIQEEGTVVELTGRQSSEITRTITKLSFVKVDSHFRQGIPFFGQVRLVDGKGVPIPNKVIFIRGNEANYYSNATTDEHGLVQFSINTTNVMGTSLTVRVNYKDRSPCYGYQWVSEEHEEAHHTAYLVFSPSKSFVHLEPMSHELPCGHTQTVQAHYILNGGTLLGLKKLSFYYLIMAKGGIVRTGTHGLLVKQEDMKGHFSISIPVKSDIAPVARLLIYAVLPTGDVIGDSAKYDVENCLANKVDLSFSPSQSLPASHAHLRVTAAPQSVCALRAVDQSVLLMKPDAELSASSVYNLLPEKDLTGFPGPLNDQDNEDCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTETVRKYFPETWIWDLVVVNSAGVAEVGVTVPDTITEWKAGAFCLSEDAGLGISSTASLRAFQPFFVELTMPYSVIRGEAFTLKATVLNYLPKCIRVSVQLEASPAFLAVPVEKEQAPHCICANGRQTVSWAVTPKSLGNVNFTVSAEALESQELCGTEVPSVPEHGRKDTVIKPLLVEPEGLEKETTFNSLLCPSGGEVSEELSLKLPPNVVEESARASVSVLGDILGSAMQNTQNLLQMPYGCGEQNMVLFAPNIYVLDYLNETQQLTPEIKSKAIGYLNTGYQRQLNYKHYDGSYSTFGERYGRNQGNTWLTAFVLKTFAQARAYIFIDEAHITQALIWLSQRQKDNGCFRSSGSLLNNAIKGGVEDEVTLSAYITIALLEIPLTVTHPVVRNALFCLESAWKTAQEGDHGSHVYTKALLAYAFALAGNQDKRKEVLKSLNEEAVKKDNSVHWERPQKPKAPVGHFYEPQAPSAEVEMTSYVLLAYLTAQPAPTSEDLTSATNIVKWITKQQNAQGGFSSTQDTVVALHALSKYGAATFTRTGKAAQVTIQSSGTFSSKFQVDNNNRLLLQQVSLPELPGEYSMKVTGEGCVYLQTSLKYNILPEKEEFPFALGVQTLPQTCDEPKAHTSFQISLSVSYTGSRSASNMAIVDVKMVSGFIPLKPTVKMLERSNHVSRTEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVRDLKPAIVKVYDYYETDEFAIAEYNAPCSKDLGNA", "length": 1474, "header": "sp|P01023-1|A2MG_HUMAN Isoform 1 of Alpha-2-macroglobulin OS=Homo sapiens OX=9606 GN=A2M PE=1 SV=3 CANONICAL=P01023-1" }, "locus": { "chromosome": "12", "start_pos": 9115849, "end_pos": 9067826, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000318602.12", "url": "https://www.ensembl.org/id/ENST00000318602.12" }, { "database": "Ensembl Peptide", "id": "ENSP00000323929.8", "url": "https://www.ensembl.org/id/ENSP00000323929.8" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "automatic_literature_mining", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1089, "start_aa": "Asn", "end_pos": 1089, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1089", "evidence": [ { "id": "12218066", "database": "Automatic Literature Mining", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/12218066" }, { "id": "12218066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12218066" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "LLLQQVSLPELPGEYSMK", "relation": "attached", "comment": "", "start_pos": 1298, "start_aa": "Leu", "end_pos": 1315, "end_aa": "Lys", "evidence": [ { "id": "P01023", "database": "UniCarbKB", "url": "" }, { "id": "28035807", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.6b02887" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "P01023", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P01023@N1424", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N1424" } ] }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "P01023@N1424", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N1424" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G07799LX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "P01023@N1424", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N1424" } ] }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "P01023@N1424", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N1424" } ] }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "P01023@N1424", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N1424" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G15038BD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "P01023@N1424", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N1424" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G22208HN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "P01023", "database": "UniCarbKB", "url": "" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G24835MQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25418HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G25451PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G33791AF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" } ] }, { "glytoucan_ac": "G39619TI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G40926MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "P01023@N1424", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N1424" } ] }, { "glytoucan_ac": "G43669FQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "P01023@N1424", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N1424" } ] }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G44331JI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G51413EV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G51640FO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G52358QA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "P01023@N1424", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N1424" } ] }, { "glytoucan_ac": "G60923RB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "P01023@N1424", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N1424" } ] }, { "glytoucan_ac": "G72667IM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G83555HU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "P01023@N1424", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N1424" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G85144OK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "P01023@N1424", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N1424" } ] }, { "glytoucan_ac": "G86500WE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G86795LJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "P01023", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P01023@N1424", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N1424" } ] }, { "glytoucan_ac": "G91473PK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "P01023@N1424", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N1424" } ] }, { "glytoucan_ac": "G95977AE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "P01023", "database": "UniCarbKB", "url": "" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "P01023", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01023#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "19139490", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19139490" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 247, "start_aa": "Asn", "end_pos": 247, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn247", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 247, "start_aa": "Asn", "end_pos": 247, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn247", "evidence": [ { "id": "P01023@N247", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N247" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 247, "start_aa": "Asn", "end_pos": 247, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn247", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 247, "start_aa": "Asn", "end_pos": 247, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn247", "evidence": [ { "id": "P01023", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G78790NZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 247, "start_aa": "Asn", "end_pos": 247, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn247", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 247, "start_aa": "Asn", "end_pos": 247, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn247", "evidence": [ { "id": "P01023@N247", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N247" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 247, "start_aa": "Asn", "end_pos": 247, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn247", "evidence": [ { "id": "P01023", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01023#ptm_processing" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "6203908", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6203908" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 26, "start_aa": "Ser", "end_pos": 26, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser26", "evidence": [ { "id": "P01023", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P01023", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P01023", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P01023", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G83555HU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P01023", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G85740DB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P01023", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P01023", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P01023", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01023#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "6203908", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6203908" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 410, "start_aa": "Asn", "end_pos": 410, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn410", "evidence": [ { "id": "P01023", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G01650EU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 410, "start_aa": "Asn", "end_pos": 410, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn410", "evidence": [ { "id": "P01023", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 410, "start_aa": "Asn", "end_pos": 410, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn410", "evidence": [ { "id": "P01023", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 410, "start_aa": "Asn", "end_pos": 410, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn410", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 410, "start_aa": "Asn", "end_pos": 410, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn410", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 410, "start_aa": "Asn", "end_pos": 410, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn410", "evidence": [ { "id": "P01023", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 410, "start_aa": "Asn", "end_pos": 410, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn410", "evidence": [ { "id": "P01023", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G15486FH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 410, "start_aa": "Asn", "end_pos": 410, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn410", "evidence": [ { "id": "P01023", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 410, "start_aa": "Asn", "end_pos": 410, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn410", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 410, "start_aa": "Asn", "end_pos": 410, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn410", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G31916IQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 410, "start_aa": "Asn", "end_pos": 410, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn410", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G33609NS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 410, "start_aa": "Asn", "end_pos": 410, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn410", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G34730YF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 410, "start_aa": "Asn", "end_pos": 410, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn410", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G37399XV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 410, "start_aa": "Asn", "end_pos": 410, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn410", "evidence": [ { "id": "P01023", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G39446WN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 410, "start_aa": "Asn", "end_pos": 410, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn410", "evidence": [ { "id": "P01023", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G45504EY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 410, "start_aa": "Asn", "end_pos": 410, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn410", "evidence": [ { "id": "P01023", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 410, "start_aa": "Asn", "end_pos": 410, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn410", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 410, "start_aa": "Asn", "end_pos": 410, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn410", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 410, "start_aa": "Asn", "end_pos": 410, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn410", "evidence": [ { "id": "P01023", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G67324HN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 410, "start_aa": "Asn", "end_pos": 410, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn410", "evidence": [ { "id": "P01023", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G82119TF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 410, "start_aa": "Asn", "end_pos": 410, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn410", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 410, "start_aa": "Asn", "end_pos": 410, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn410", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G83555HU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 410, "start_aa": "Asn", "end_pos": 410, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn410", "evidence": [ { "id": "P01023", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 410, "start_aa": "Asn", "end_pos": 410, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn410", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G85740DB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 410, "start_aa": "Asn", "end_pos": 410, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn410", "evidence": [ { "id": "P01023", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 410, "start_aa": "Asn", "end_pos": 410, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn410", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 410, "start_aa": "Asn", "end_pos": 410, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn410", "evidence": [ { "id": "P01023", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01023#ptm_processing" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "6203908", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6203908" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 55, "start_aa": "Asn", "end_pos": 55, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn55", "evidence": [ { "id": "P01023@N55", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N55" } ] }, { "glytoucan_ac": "G05933EN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 55, "start_aa": "Asn", "end_pos": 55, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn55", "evidence": [ { "id": "P01023@N55", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N55" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 55, "start_aa": "Asn", "end_pos": 55, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn55", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G07799LX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 55, "start_aa": "Asn", "end_pos": 55, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn55", "evidence": [ { "id": "P01023@N55", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N55" } ] }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 55, "start_aa": "Asn", "end_pos": 55, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn55", "evidence": [ { "id": "P01023@N55", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N55" } ] }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 55, "start_aa": "Asn", "end_pos": 55, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn55", "evidence": [ { "id": "P01023@N55", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N55" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 55, "start_aa": "Asn", "end_pos": 55, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn55", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G47737VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 55, "start_aa": "Asn", "end_pos": 55, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn55", "evidence": [ { "id": "P01023@N55", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N55" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 55, "start_aa": "Asn", "end_pos": 55, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn55", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 55, "start_aa": "Asn", "end_pos": 55, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn55", "evidence": [ { "id": "P01023@N55", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N55" } ] }, { "glytoucan_ac": "G60923RB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 55, "start_aa": "Asn", "end_pos": 55, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn55", "evidence": [ { "id": "P01023@N55", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N55" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 55, "start_aa": "Asn", "end_pos": 55, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn55", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 55, "start_aa": "Asn", "end_pos": 55, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn55", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 55, "start_aa": "Asn", "end_pos": 55, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn55", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 55, "start_aa": "Asn", "end_pos": 55, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn55", "evidence": [ { "id": "P01023@N55", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N55" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "Complex", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (complex) asparagine Complex", "start_pos": 55, "start_aa": "Asn", "end_pos": 55, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn55", "evidence": [ { "id": "P01023", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01023#ptm_processing" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "19139490", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19139490" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 575, "start_aa": "Ser", "end_pos": 575, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser575", "evidence": [ { "id": "P01023", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 588, "start_aa": "Thr", "end_pos": 588, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr588", "evidence": [ { "id": "P01023", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 654, "start_aa": "Thr", "end_pos": 654, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr654", "evidence": [ { "id": "P01023", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "P01023", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01023#ptm_processing" }, { "id": "6203908", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6203908" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 763, "start_aa": "Thr", "end_pos": 763, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr763", "evidence": [ { "id": "P01023", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G01650EU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 869, "start_aa": "Asn", "end_pos": 869, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn869", "evidence": [ { "id": "P01023@N869", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N869" } ] }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 869, "start_aa": "Asn", "end_pos": 869, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn869", "evidence": [ { "id": "P01023@N869", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N869" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 869, "start_aa": "Asn", "end_pos": 869, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn869", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 869, "start_aa": "Asn", "end_pos": 869, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn869", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 869, "start_aa": "Asn", "end_pos": 869, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn869", "evidence": [ { "id": "P01023@N869", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N869" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 869, "start_aa": "Asn", "end_pos": 869, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn869", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G28541PG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 869, "start_aa": "Asn", "end_pos": 869, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn869", "evidence": [ { "id": "P01023@N869", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N869" } ] }, { "glytoucan_ac": "G31916IQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 869, "start_aa": "Asn", "end_pos": 869, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn869", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G37399XV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 869, "start_aa": "Asn", "end_pos": 869, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn869", "evidence": [ { "id": "P01023@N869", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N869" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 869, "start_aa": "Asn", "end_pos": 869, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn869", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G39446WN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 869, "start_aa": "Asn", "end_pos": 869, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn869", "evidence": [ { "id": "P01023@N869", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N869" } ] }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 869, "start_aa": "Asn", "end_pos": 869, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn869", "evidence": [ { "id": "P01023@N869", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N869" } ] }, { "glytoucan_ac": "G45504EY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 869, "start_aa": "Asn", "end_pos": 869, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn869", "evidence": [ { "id": "P01023@N869", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N869" } ] }, { "glytoucan_ac": "G47448YK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 869, "start_aa": "Asn", "end_pos": 869, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn869", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 869, "start_aa": "Asn", "end_pos": 869, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn869", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 869, "start_aa": "Asn", "end_pos": 869, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn869", "evidence": [ { "id": "P01023", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P01023@N869", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N869" } ] }, { "glytoucan_ac": "G60923RB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 869, "start_aa": "Asn", "end_pos": 869, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn869", "evidence": [ { "id": "P01023@N869", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N869" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 869, "start_aa": "Asn", "end_pos": 869, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn869", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G72735IY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 869, "start_aa": "Asn", "end_pos": 869, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn869", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72787SB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 869, "start_aa": "Asn", "end_pos": 869, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn869", "evidence": [ { "id": "P01023@N869", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N869" } ] }, { "glytoucan_ac": "G78790NZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 869, "start_aa": "Asn", "end_pos": 869, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn869", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 869, "start_aa": "Asn", "end_pos": 869, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn869", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G83204BU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 869, "start_aa": "Asn", "end_pos": 869, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn869", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" } ] }, { "glytoucan_ac": "G85740DB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 869, "start_aa": "Asn", "end_pos": 869, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn869", "evidence": [ { "id": "P01023@N869", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N869" } ] }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 869, "start_aa": "Asn", "end_pos": 869, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn869", "evidence": [ { "id": "P01023@N869", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N869" } ] }, { "glytoucan_ac": "G95865ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 869, "start_aa": "Asn", "end_pos": 869, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn869", "evidence": [ { "id": "P01023@N869", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01023@N869" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 869, "start_aa": "Asn", "end_pos": 869, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn869", "evidence": [ { "id": "P01023", "database": "UniCarbKB", "url": "" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "P01023", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01023#ptm_processing" }, { "id": "14760718", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 885, "start_aa": "Thr", "end_pos": 885, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr885", "evidence": [ { "id": "P01023", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 885, "start_aa": "Thr", "end_pos": 885, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr885", "evidence": [ { "id": "P01023", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 991, "start_aa": "Asn", "end_pos": 991, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn991", "evidence": [ { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 991, "start_aa": "Asn", "end_pos": 991, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn991", "evidence": [ { "id": "P01023", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01023#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "12754519", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12754519" }, { "id": "6203908", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6203908" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P01023", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01023" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" } ] } ], "phosphorylation": [ { "start_pos": 679, "end_pos": 679, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01023", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01023" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr679" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "Proteomics Analysis of O-GalNAc Glycosylation in Human Serum by an Integrated Strategy", "journal": "Anal. Chem.", "date": "2017", "authors": "Qin H., Cheng K., Zhu J., Mao J., Wang F., Dong M., Chen R., Guo Z., Liang X., Ye M., Zou H.", "evidence": [ { "database": "UniCarbKB", "id": "P01023", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1021/acs.analchem.6b02887", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.6b02887" } ] }, { "title": "Fibrillin degradation by matrix metalloproteinases: implications for connective tissue remodelling.", "journal": "The Biochemical journal", "date": "1999", "authors": "Ashworth JL, Murphy G, Rock MJ, Sherratt MJ, Shapiro SD, Shuttleworth CA, Kielty CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "10229672", "url": "https://glygen.org/publication/PubMed/10229672" } ] }, { "title": "Fibrillin degradation by matrix metalloproteinases: identification of amino- and carboxy-terminal cleavage sites.", "journal": "FEBS letters", "date": "1999", "authors": "Hindson VJ, Ashworth JL, Rock MJ, Cunliffe S, Shuttleworth CA, Kielty CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "10386589", "url": "https://glygen.org/publication/PubMed/10386589" } ] }, { "title": "Mechanisms for the involvement of high molecular weight kininogen in surface-dependent reactions of Hageman factor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1976", "authors": "Griffin JH, Cochrane CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "1066663", "url": "https://glygen.org/publication/PubMed/1066663" } ] }, { "title": "EMMPRIN (CD147), an inducer of matrix metalloproteinase synthesis, also binds interstitial collagenase to the tumor cell surface.", "journal": "Cancer research", "date": "2000", "authors": "Guo H, Li R, Zucker S, Toole BP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "10706100", "url": "https://glygen.org/publication/PubMed/10706100" } ] }, { "title": "Thrombin-mediated feedback activation of factor XI on the activated platelet surface is preferred over contact activation by factor XIIa or factor XIa.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Baglia FA, Walsh PN", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "10781579", "url": "https://glygen.org/publication/PubMed/10781579" } ] }, { "title": "Biochemical characterization of the catalytic domain of human matrix metalloproteinase 19. Evidence for a role as a potent basement membrane degrading enzyme.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Stracke JO, Hutton M, Stewart M, Pendas AM, Smith B, Lopez-Otin C, Murphy G, Knauper V", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "10809722", "url": "https://glygen.org/publication/PubMed/10809722" } ] }, { "title": "Brevican is degraded by matrix metalloproteinases and aggrecanase-1 (ADAMTS4) at different sites.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Nakamura H, Fujii Y, Inoki I, Sugimoto K, Tanzawa K, Matsuki H, Miura R, Yamaguchi Y, Okada Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "10986281", "url": "https://glygen.org/publication/PubMed/10986281" } ] }, { "title": "Factor XII-dependent contact activation on endothelial cells and binding proteins gC1qR and cytokeratin 1.", "journal": "Thrombosis and haemostasis", "date": "2001", "authors": "Joseph K, Shibayama Y, Ghebrehiwet B, Kaplan AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "11204562", "url": "https://glygen.org/publication/PubMed/11204562" } ] }, { "title": "Model for a factor IX activation complex on blood platelets: dimeric conformation of factor XIa is essential.", "journal": "Blood", "date": "2001", "authors": "Gailani D, Ho D, Sun MF, Cheng Q, Walsh PN", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "11342438", "url": "https://glygen.org/publication/PubMed/11342438" } ] }, { "title": "Osteopontin, a novel substrate for matrix metalloproteinase-3 (stromelysin-1) and matrix metalloproteinase-7 (matrilysin).", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Agnihotri R, Crawford HC, Haro H, Matrisian LM, Havrda MC, Liaw L", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "11375993", "url": "https://glygen.org/publication/PubMed/11375993" } ] }, { "title": "Factor XI binding to the platelet glycoprotein Ib-IX-V complex promotes factor XI activation by thrombin.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Baglia FA, Badellino KO, Li CQ, Lopez JA, Walsh PN", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "11696542", "url": "https://glygen.org/publication/PubMed/11696542" } ] }, { "title": "Identification and characterization of prolylcarboxypeptidase as an endothelial cell prekallikrein activator.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Shariat-Madar Z, Mahdi F, Schmaier AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "11830581", "url": "https://glygen.org/publication/PubMed/11830581" } ] }, { "title": "Bivalirudin: a direct thrombin inhibitor.", "journal": "Clinical therapeutics", "date": "2002", "authors": "Gladwell TD", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "11833835", "url": "https://glygen.org/publication/PubMed/11833835" } ] }, { "title": "Overexpression of alpha(v)beta6 integrin in serous epithelial ovarian cancer regulates extracellular matrix degradation via the plasminogen activation cascade.", "journal": "Carcinogenesis", "date": "2002", "authors": "Ahmed N, Pansino F, Clyde R, Murthi P, Quinn MA, Rice GE, Agrez MV, Mok S, Baker MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "11872628", "url": "https://glygen.org/publication/PubMed/11872628" } ] }, { "title": "Factor XII interacts with the multiprotein assembly of urokinase plasminogen activator receptor, gC1qR, and cytokeratin 1 on endothelial cell membranes.", "journal": "Blood", "date": "2002", "authors": "Mahdi F, Madar ZS, Figueroa CD, Schmaier AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "11986212", "url": "https://glygen.org/publication/PubMed/11986212" } ] }, { "title": "Identification of prolylcarboxypeptidase as the cell matrix-associated prekallikrein activator.", "journal": "FEBS letters", "date": "2002", "authors": "Moreira CR, Schmaier AH, Mahdi F, da Motta G, Nader HB, Shariat-Madar Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "12123826", "url": "https://glygen.org/publication/PubMed/12123826" } ] }, { "title": "Matriptase-2, a membrane-bound mosaic serine proteinase predominantly expressed in human liver and showing degrading activity against extracellular matrix proteins.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Velasco G, Cal S, Quesada V, Sanchez LM, Lopez-Otin C", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "12149247", "url": "https://glygen.org/publication/PubMed/12149247" } ] }, { "title": "Protein kinase A site-specific phosphorylation regulates ATP-binding cassette A1 (ABCA1)-mediated phospholipid efflux.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "See RH, Caday-Malcolm RA, Singaraja RR, Zhou S, Silverston A, Huber MT, Moran J, James ER, Janoo R, Savill JM, Rigot V, Zhang LH, Wang M, Chimini G, Wellington CL, Tafuri SR, Hayden MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963896", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963896" } ], "reference": [ { "type": "PubMed", "id": "12196520", "url": "https://glygen.org/publication/PubMed/12196520" } ] }, { "title": "Localization of carbohydrate attachment sites and disulfide bridges in limulus alpha 2-macroglobulin. Evidence for two forms differing primarily in their bait region sequences.", "journal": "The Journal of biological chemistry", "date": "2002-11-15", "authors": "Husted Lise B, Sorensen Esben S, Armstrong Peter B, Quigley James P, Kristensen Lene, Sottrup-Jensen Lars", "evidence": [ { "database": "Automatic Literature Mining", "id": "12218066", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/12218066" } ], "reference": [ { "type": "PubMed", "id": "12218066", "url": "https://glygen.org/publication/PubMed/12218066" } ] }, { "title": "Localization of the adhesion receptor glycoprotein Ib-IX-V complex to lipid rafts is required for platelet adhesion and activation.", "journal": "The Journal of experimental medicine", "date": "2002", "authors": "Shrimpton CN, Borthakur G, Larrucea S, Cruz MA, Dong JF, Lopez JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "12391017", "url": "https://glygen.org/publication/PubMed/12391017" } ] }, { "title": "Membrane type-1-matrix metalloproteinase expressed by prostate carcinoma cells cleaves human laminin-5 beta3 chain and induces cell migration.", "journal": "Cancer research", "date": "2003", "authors": "Udayakumar TS, Chen ML, Bair EL, Von Bredow DC, Cress AE, Nagle RB, Bowden GT", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "12727852", "url": "https://glygen.org/publication/PubMed/12727852" } ] }, { "title": "Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.", "journal": "Nature biotechnology", "date": "2003", "authors": "Zhang H, Li XJ, Martin DB, Aebersold R", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023#ptm_processing" }, { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "reference": [ { "type": "PubMed", "id": "12754519", "url": "https://glygen.org/publication/PubMed/12754519" } ] }, { "title": "The calpain system.", "journal": "Physiological reviews", "date": "2003", "authors": "Goll DE, Thompson VF, Li H, Wei W, Cong J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "12843408", "url": "https://glygen.org/publication/PubMed/12843408" } ] }, { "title": "The relative priority of prekallikrein and factors XI/XIa assembly on cultured endothelial cells.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Mahdi F, Shariat-Madar Z, Schmaier AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "12944405", "url": "https://glygen.org/publication/PubMed/12944405" } ] }, { "title": "Cloning of the human alpha 2-macroglobulin gene and detection of mutations in two functional domains: the bait region and the thiolester site.", "journal": "Human genetics", "date": "1992", "authors": "Poller W, Faber JP, Klobeck G, Olek K", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "reference": [ { "type": "PubMed", "id": "1370808", "url": "https://glygen.org/publication/PubMed/1370808" } ] }, { "title": "Structure of the human alpha-2 macroglobulin gene and its promotor.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1992", "authors": "Matthijs G, Devriendt K, Cassiman J J, Van den Berghe H, Marynen P", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "reference": [ { "type": "PubMed", "id": "1374237", "url": "https://glygen.org/publication/PubMed/1374237" } ] }, { "title": "Isolation of dense granules from human platelets.", "journal": "Methods in enzymology", "date": "1992", "authors": "Fukami MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "1435334", "url": "https://glygen.org/publication/PubMed/1435334" } ] }, { "title": "Characterization of the proteins released from activated platelets leads to localization of novel platelet proteins in human atherosclerotic lesions.", "journal": "Blood", "date": "2004", "authors": "Coppinger JA, Cagney G, Toomey S, Kislinger T, Belton O, McRedmond JP, Cahill DJ, Emili A, Fitzgerald DJ, Maguire PB", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "14630798", "url": "https://glygen.org/publication/PubMed/14630798" } ] }, { "title": "The physiologic basis of assembly and activation of the plasma kallikrein/kinin system.", "journal": "Thrombosis and haemostasis", "date": "2004", "authors": "Schmaier AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "14691562", "url": "https://glygen.org/publication/PubMed/14691562" } ] }, { "title": "Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.", "journal": "Proteomics", "date": "2004", "authors": "Bunkenborg J, Pilch BJ, Podtelejnikov AV, Wisniewski JR", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023#ptm_processing" }, { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "reference": [ { "type": "PubMed", "id": "14760718", "url": "https://glygen.org/publication/PubMed/14760718" } ] }, { "title": "HtrA1 serine protease inhibits signaling mediated by Tgfbeta family proteins.", "journal": "Development (Cambridge, England)", "date": "2004", "authors": "Oka C, Tsujimoto R, Kajikawa M, Koshiba-Takeuchi K, Ina J, Yano M, Tsuchiya A, Ueta Y, Soma A, Kanda H, Matsumoto M, Kawaichi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "14973287", "url": "https://glygen.org/publication/PubMed/14973287" } ] }, { "title": "Recombinant prolylcarboxypeptidase activates plasma prekallikrein.", "journal": "Blood", "date": "2004", "authors": "Shariat-Madar Z, Mahdi F, Schmaier AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "14996700", "url": "https://glygen.org/publication/PubMed/14996700" } ] }, { "title": "A novel secreted, cell-surface glycoprotein containing multiple epidermal growth factor-like repeats and one CUB domain is highly expressed in primary osteoblasts and bones.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Wu BT, Su YH, Tsai MT, Wasserman SM, Topper JN, Yang RB", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "15234972", "url": "https://glygen.org/publication/PubMed/15234972" } ] }, { "title": "Characterization of oligomeric human ATP binding cassette transporter A1. Potential implications for determining the structure of nascent high density lipoprotein particles.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Denis M, Haidar B, Marcil M, Bouvier M, Krimbou L, Genest J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963896", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963896" } ], "reference": [ { "type": "PubMed", "id": "15280376", "url": "https://glygen.org/publication/PubMed/15280376" } ] }, { "title": "The nucleotide transporter MRP4 (ABCC4) is highly expressed in human platelets and present in dense granules, indicating a role in mediator storage.", "journal": "Blood", "date": "2004", "authors": "Jedlitschky G, Tirschmann K, Lubenow LE, Nieuwenhuis HK, Akkerman JW, Greinacher A, Kroemer HK", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "15297306", "url": "https://glygen.org/publication/PubMed/15297306" } ] }, { "title": "BMP-1/Tolloid-like metalloproteases process endorepellin, the angiostatic C-terminal fragment of perlecan.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Gonzalez EM, Reed CC, Bix G, Fu J, Zhang Y, Gopalakrishnan B, Greenspan DS, Iozzo RV", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "15591058", "url": "https://glygen.org/publication/PubMed/15591058" } ] }, { "title": "Alpha(2) macroglobulin, a PSA-binding protein, is expressed in human prostate stroma.", "journal": "Prostate", "date": "2005", "authors": "Lin Victor K, Wang Shih-Ya, Boetticher Nicholas C, Vazquez Dolores V, Saboorian Hossein, McConnell John D, Roehrborn Claus G", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "reference": [ { "type": "PubMed", "id": "15611997", "url": "https://glygen.org/publication/PubMed/15611997" } ] }, { "title": "ADAM10 mediates E-cadherin shedding and regulates epithelial cell-cell adhesion, migration, and beta-catenin translocation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Maretzky T, Reiss K, Ludwig A, Buchholz J, Scholz F, Proksch E, de Strooper B, Hartmann D, Saftig P", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "15958533", "url": "https://glygen.org/publication/PubMed/15958533" } ] }, { "title": "Human glioblastomas overexpress ADAMTS-5 that degrades brevican.", "journal": "Acta neuropathologica", "date": "2005", "authors": "Nakada M, Miyamori H, Kita D, Takahashi T, Yamashita J, Sato H, Miura R, Yamaguchi Y, Okada Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "16133547", "url": "https://glygen.org/publication/PubMed/16133547" } ] }, { "title": "Characterization of the interaction between the A2 subunit and A1/A3-C1-C2 dimer in human factor VIIIa.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Fay PJ, Smudzin TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "1618828", "url": "https://glygen.org/publication/PubMed/1618828" } ] }, { "title": "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.", "journal": "Journal of proteome research", "date": "2005", "authors": "Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023#ptm_processing" }, { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "reference": [ { "type": "PubMed", "id": "16335952", "url": "https://glygen.org/publication/PubMed/16335952" } ] }, { "title": "Matrix metalloproteinase degradation of elastin, type IV collagen and proteoglycan. A quantitative comparison of the activities of 95 kDa and 72 kDa gelatinases, stromelysins-1 and -2 and punctuated metalloproteinase (PUMP).", "journal": "The Biochemical journal", "date": "1991", "authors": "Murphy G, Cockett MI, Ward RV, Docherty AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "1649600", "url": "https://glygen.org/publication/PubMed/1649600" } ] }, { "title": "Mechanism of prebeta-HDL formation and activation.", "journal": "Biochemistry", "date": "2006", "authors": "Chau P, Nakamura Y, Fielding CJ, Fielding PE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963896", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963896" } ], "reference": [ { "type": "PubMed", "id": "16548525", "url": "https://glygen.org/publication/PubMed/16548525" } ] }, { "title": "Alpha-V-dependent outside-in signaling is required for the regulation of CD44 surface expression, MMP-2 secretion, and cell migration by osteopontin in human melanoma cells.", "journal": "Experimental cell research", "date": "2006", "authors": "Samanna V, Wei H, Ego-Osuala D, Chellaiah MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "16631740", "url": "https://glygen.org/publication/PubMed/16631740" } ] }, { "title": "Cathepsin s promotes human preadipocyte differentiation: possible involvement of fibronectin degradation.", "journal": "Endocrinology", "date": "2006", "authors": "Taleb S, Cancello R, Clement K, Lacasa D", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "16825321", "url": "https://glygen.org/publication/PubMed/16825321" } ] }, { "title": "A genetic polymorphism in a functional domain of human pregnancy zone protein: the bait region. Genomic structure of the bait domains of human pregnancy zone protein and alpha 2 macroglobulin.", "journal": "FEBS Lett.", "date": "1990", "authors": "Marynen P, Devriendt K, Van den Berghe H, Cassiman JJ", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "reference": [ { "type": "PubMed", "id": "1692292", "url": "https://glygen.org/publication/PubMed/1692292" } ] }, { "title": "Sequence identity between the alpha 2-macroglobulin receptor and low density lipoprotein receptor-related protein suggests that this molecule is a multifunctional receptor.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Strickland DK, Ashcom JD, Williams S, Burgess WH, Migliorini M, Argraves WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "1698775", "url": "https://glygen.org/publication/PubMed/1698775" } ] }, { "title": "Sequence polymorphism in the human alpha2-macroglobulin (A2M) gene.", "journal": "Nucleic Acids Res.", "date": "1991", "authors": "Poller W, Faber J P, Olek K", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "reference": [ { "type": "PubMed", "id": "1707161", "url": "https://glygen.org/publication/PubMed/1707161" } ] }, { "title": "Inhibition of bone morphogenetic protein 1 by native and altered forms of alpha2-macroglobulin.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Zhang Y, Ge G, Greenspan DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963896", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963896" } ], "reference": [ { "type": "PubMed", "id": "17071617", "url": "https://glygen.org/publication/PubMed/17071617" } ] }, { "title": "Hyaluronan and its binding proteins, the hyaladherins.", "journal": "Current opinion in cell biology", "date": "1990", "authors": "Toole BP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "1707285", "url": "https://glygen.org/publication/PubMed/1707285" } ] }, { "title": "Glycoproteins V and Ib-IX form a noncovalent complex in the platelet membrane.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Modderman PW, Admiraal LG, Sonnenberg A, von dem Borne AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "1730602", "url": "https://glygen.org/publication/PubMed/1730602" } ] }, { "title": "Engagement of collagen-binding integrins promotes matrix metalloproteinase-9-dependent E-cadherin ectodomain shedding in ovarian carcinoma cells.", "journal": "Cancer research", "date": "2007", "authors": "Symowicz J, Adley BP, Gleason KJ, Johnson JJ, Ghosh S, Fishman DA, Hudson LG, Stack MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "17332331", "url": "https://glygen.org/publication/PubMed/17332331" } ] }, { "title": "Kallikrein 7 enhances pancreatic cancer cell invasion by shedding E-cadherin.", "journal": "Cancer", "date": "2007", "authors": "Johnson SK, Ramani VC, Hennings L, Haun RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "17354228", "url": "https://glygen.org/publication/PubMed/17354228" } ] }, { "title": "ABCA1-induced cell surface binding sites for ApoA-I.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2007", "authors": "Vedhachalam C, Ghering AB, Davidson WS, Lund-Katz S, Rothblat GH, Phillips MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963896", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963896" } ], "reference": [ { "type": "PubMed", "id": "17478755", "url": "https://glygen.org/publication/PubMed/17478755" } ] }, { "title": "The pharmacokinetics, pharmacodynamics and tolerability of dabigatran etexilate, a new oral direct thrombin inhibitor, in healthy male subjects.", "journal": "British journal of clinical pharmacology", "date": "2007", "authors": "Stangier J, Rathgen K, Stahle H, Gansser D, Roth W", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "17506785", "url": "https://glygen.org/publication/PubMed/17506785" } ] }, { "title": "Bone morphogenetic protein-1 (BMP-1) cleaves human proapolipoprotein A1 and regulates its activation for lipid binding.", "journal": "Biochemistry", "date": "2007", "authors": "Chau P, Fielding PE, Fielding CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963896", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963896" } ], "reference": [ { "type": "PubMed", "id": "17580958", "url": "https://glygen.org/publication/PubMed/17580958" } ] }, { "title": "In-vitro profile and ex-vivo anticoagulant activity of the direct thrombin inhibitor dabigatran and its orally active prodrug, dabigatran etexilate.", "journal": "Thrombosis and haemostasis", "date": "2007", "authors": "Wienen W, Stassen JM, Priepke H, Ries UJ, Hauel N", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "17598008", "url": "https://glygen.org/publication/PubMed/17598008" } ] }, { "title": "Mechanism of ATP-binding cassette transporter A1-mediated cellular lipid efflux to apolipoprotein A-I and formation of high density lipoprotein particles.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Vedhachalam C, Duong PT, Nickel M, Nguyen D, Dhanasekaran P, Saito H, Rothblat GH, Lund-Katz S, Phillips MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963896", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963896" } ], "reference": [ { "type": "PubMed", "id": "17604270", "url": "https://glygen.org/publication/PubMed/17604270" } ] }, { "title": "Human alpha2-macroglobulin is composed of multiple domains, as predicted by homology with complement component C3.", "journal": "Biochem. J.", "date": "2007", "authors": "Doan Ninh, Gettins Peter G W", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "reference": [ { "type": "PubMed", "id": "17608619", "url": "https://glygen.org/publication/PubMed/17608619" } ] }, { "title": "The calpains: modular designs and functional diversity.", "journal": "Genome biology", "date": "2007", "authors": "Croall DE, Ersfeld K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "17608959", "url": "https://glygen.org/publication/PubMed/17608959" } ] }, { "title": "The ectodomain shedding of E-cadherin by ADAM15 supports ErbB receptor activation.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Najy AJ, Day KC, Day ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "18434311", "url": "https://glygen.org/publication/PubMed/18434311" } ] }, { "title": "Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry.", "journal": "Journal of chromatography. B, Analytical technologies in the biomedical and life sciences", "date": "2008", "authors": "Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T", "evidence": [ { "database": "GlyConnect", "id": "730", "url": "https://glyconnect.expasy.org/browser/proteins/730" } ], "reference": [ { "type": "PubMed", "id": "18514042", "url": "https://glygen.org/publication/PubMed/18514042" } ] }, { "title": "Caspase-3 activation triggers extracellular cathepsin L release and endorepellin proteolysis.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Cailhier JF, Sirois I, Laplante P, Lepage S, Raymond MA, Brassard N, Prat A, Iozzo RV, Pshezhetsky AV, Hebert MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "18658137", "url": "https://glygen.org/publication/PubMed/18658137" } ] }, { "title": "Membrane-type 1 matrix metalloproteinase regulates macrophage-dependent elastolytic activity and aneurysm formation in vivo.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Xiong W, Knispel R, MacTaggart J, Greiner TC, Weiss SJ, Baxter BT", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "19010778", "url": "https://glygen.org/publication/PubMed/19010778" } ] }, { "title": "Human factor VIIIa subunit structure. Reconstruction of factor VIIIa from the isolated A1/A3-C1-C2 dimer and A2 subunit.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Fay PJ, Haidaris PJ, Smudzin TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "1902833", "url": "https://glygen.org/publication/PubMed/1902833" } ] }, { "title": "A strategy for precise and large scale identification of core fucosylated glycoproteins.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Jia W, Lu Z, Fu Y, Wang HP, Wang LH, Chi H, Yuan ZF, Zheng ZB, Song LN, Han HH, Liang YM, Wang JL, Cai Y, Zhang YK, Deng YL, Ying WT, He SM, Qian XH", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023#ptm_processing" }, { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "reference": [ { "type": "PubMed", "id": "19139490", "url": "https://glygen.org/publication/PubMed/19139490" } ] }, { "title": "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.", "journal": "Journal of proteome research", "date": "2009", "authors": "Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023#ptm_processing" }, { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "reference": [ { "type": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "title": "Inhibition of the thrombin-platelet reactions by DuP 714.", "journal": "Biochemical and biophysical research communications", "date": "1991", "authors": "Chiu AT, Mousa SA, Pease LJ, Roscoe WA, Bozarth JM, Reilly TM, Smith RD, Timmermans PB", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "1930190", "url": "https://glygen.org/publication/PubMed/1930190" } ] }, { "title": "Palmitoylation of ATP-binding cassette transporter A1 is essential for its trafficking and function.", "journal": "Circulation research", "date": "2009", "authors": "Singaraja RR, Kang MH, Vaid K, Sanders SS, Vilas GL, Arstikaitis P, Coutinho J, Drisdel RC, El-Husseini Ael D, Green WN, Berthiaume L, Hayden MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963896", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963896" } ], "reference": [ { "type": "PubMed", "id": "19556522", "url": "https://glygen.org/publication/PubMed/19556522" } ] }, { "title": "MT1-MMP-mediated cleavage of decorin in corneal angiogenesis.", "journal": "Journal of vascular research", "date": "2009", "authors": "Mimura T, Han KY, Onguchi T, Chang JH, Kim TI, Kojima T, Zhou Z, Azar DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "19571574", "url": "https://glygen.org/publication/PubMed/19571574" } ] }, { "title": "Identification of a novel HtrA1-susceptible cleavage site in human aggrecan: evidence for the involvement of HtrA1 in aggrecan proteolysis in vivo.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Chamberland A, Wang E, Jones AR, Collins-Racie LA, LaVallie ER, Huang Y, Liu L, Morris EA, Flannery CR, Yang Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "19657146", "url": "https://glygen.org/publication/PubMed/19657146" } ] }, { "title": "ADAM-8 isolated from human osteoarthritic chondrocytes cleaves fibronectin at Ala(271).", "journal": "Arthritis and rheumatism", "date": "2009", "authors": "Zack MD, Malfait AM, Skepner AP, Yates MP, Griggs DW, Hall T, Hills RL, Alston JT, Nemirovskiy OV, Radabaugh MR, Leone JW, Arner EC, Tortorella MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "19714641", "url": "https://glygen.org/publication/PubMed/19714641" } ] }, { "title": "Location of the disulfide bonds in human coagulation factor XI: the presence of tandem apple domains.", "journal": "Biochemistry", "date": "1991", "authors": "McMullen BA, Fujikawa K, Davie EW", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "1998667", "url": "https://glygen.org/publication/PubMed/1998667" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P01023", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01023" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Matrix metalloproteinase-19 is highly expressed in astroglial tumors and promotes invasion of glioma cells.", "journal": "Journal of neuropathology and experimental neurology", "date": "2010", "authors": "Lettau I, Hattermann K, Held-Feindt J, Brauer R, Sedlacek R, Mentlein R", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "20142769", "url": "https://glygen.org/publication/PubMed/20142769" } ] }, { "title": "Activation of human blood coagulation factor XI independent of factor XII. Factor XI is activated by thrombin and factor XIa in the presence of negatively charged surfaces.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Naito K, Fujikawa K", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "2019570", "url": "https://glygen.org/publication/PubMed/2019570" } ] }, { "title": "Expanding members and roles of the calpain superfamily and their genetically modified animals.", "journal": "Experimental animals", "date": "2010", "authors": "Sorimachi H, Hata S, Ono Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "21030783", "url": "https://glygen.org/publication/PubMed/21030783" } ] }, { "title": "Binding of human factor VIII to phospholipid vesicles.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Gilbert GE, Furie BC, Furie B", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "2104832", "url": "https://glygen.org/publication/PubMed/2104832" } ] }, { "title": "Kinetics of coagulation factor X activation by platelet-bound factor IXa.", "journal": "Biochemistry", "date": "1990", "authors": "Rawala-Sheikh R, Ahmad SS, Ashby B, Walsh PN", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "2110473", "url": "https://glygen.org/publication/PubMed/2110473" } ] }, { "title": "Substrate-induced remodeling of the active site regulates human HTRA1 activity.", "journal": "Nature structural & molecular biology", "date": "2011", "authors": "Truebestein L, Tennstaedt A, Monig T, Krojer T, Canellas F, Kaiser M, Clausen T, Ehrmann M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "21297635", "url": "https://glygen.org/publication/PubMed/21297635" } ] }, { "title": "SCUBE3 is an endogenous TGF-beta receptor ligand and regulates the epithelial-mesenchymal transition in lung cancer.", "journal": "Oncogene", "date": "2011", "authors": "Wu YY, Peck K, Chang YL, Pan SH, Cheng YF, Lin JC, Yang RB, Hong TM, Yang PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "21441952", "url": "https://glygen.org/publication/PubMed/21441952" } ] }, { "title": "Calpain chronicle--an enzyme family under multidisciplinary characterization.", "journal": "Proceedings of the Japan Academy. Series B, Physical and biological sciences", "date": "2011", "authors": "Sorimachi H, Hata S, Ono Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "21670566", "url": "https://glygen.org/publication/PubMed/21670566" } ] }, { "title": "Analysis of serpin secretion, misfolding, and surveillance in the endoplasmic reticulum.", "journal": "Methods in enzymology", "date": "2011", "authors": "Pan S, Iannotti MJ, Sifers RN", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "21683246", "url": "https://glygen.org/publication/PubMed/21683246" } ] }, { "title": "Classical and neonatal Marfan syndrome mutations in fibrillin-1 cause differential protease susceptibilities and protein function.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Kirschner R, Hubmacher D, Iyengar G, Kaur J, Fagotto-Kaufmann C, Bromme D, Bartels R, Reinhardt DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "21784848", "url": "https://glygen.org/publication/PubMed/21784848" } ] }, { "title": "Calpains: an elaborate proteolytic system.", "journal": "Biochimica et biophysica acta", "date": "2012", "authors": "Ono Y, Sorimachi H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "21864727", "url": "https://glygen.org/publication/PubMed/21864727" } ] }, { "title": "Desirudin: a review of the pharmacology and clinical application for the prevention of deep vein thrombosis.", "journal": "Expert review of cardiovascular therapy", "date": "2011", "authors": "Graetz TJ, Tellor BR, Smith JR, Avidan MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "21932952", "url": "https://glygen.org/publication/PubMed/21932952" } ] }, { "title": "MT1-MMP regulates the turnover and endocytosis of extracellular matrix fibronectin.", "journal": "Journal of cell science", "date": "2011", "authors": "Shi F, Sottile J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "22159414", "url": "https://glygen.org/publication/PubMed/22159414" } ] }, { "title": "A sequential mechanism for exosite-mediated factor IX activation by factor XIa.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Geng Y, Verhamme IM, Messer A, Sun MF, Smith SB, Bajaj SP, Gailani D", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "22961984", "url": "https://glygen.org/publication/PubMed/22961984" } ] }, { "title": "Structure-function relationships in calpains.", "journal": "The Biochemical journal", "date": "2012", "authors": "Campbell RL, Davies PL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "23035980", "url": "https://glygen.org/publication/PubMed/23035980" } ] }, { "title": "Quantification of the N-glycosylated secretome by super-SILAC during breast cancer progression and in human blood samples.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Boersema PJ, Geiger T, Wisniewski JR, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "23090970", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "title": "High precision platelet releasate definition by quantitative reversed protein profiling--brief report.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2013", "authors": "Wijten P, van Holten T, Woo LL, Bleijerveld OB, Roest M, Heck AJ, Scholten A", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "23640497", "url": "https://glygen.org/publication/PubMed/23640497" } ] }, { "title": "Characterization of opticin digestion by proteases involved in osteoarthritis development.", "journal": "Joint, bone, spine : revue du rhumatisme", "date": "2014", "authors": "Tio L, Martel-Pelletier J, Pelletier JP, Bishop PN, Roughley P, Farran A, Benito P, Monfort J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "23845380", "url": "https://glygen.org/publication/PubMed/23845380" } ] }, { "title": "Clot-bound thrombin is protected from inhibition by heparin-antithrombin III but is susceptible to inactivation by antithrombin III-independent inhibitors.", "journal": "The Journal of clinical investigation", "date": "1990", "authors": "Weitz JI, Hudoba M, Massel D, Maraganore J, Hirsh J", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "2384594", "url": "https://glygen.org/publication/PubMed/2384594" } ] }, { "title": "Human alpha 2-macroglobulin gene is located on chromosome 12.", "journal": "Somat. Cell Mol. Genet.", "date": "1985", "authors": "Bell G I, Rall L B, Sanchez-Pescador R, Merryweather J P, Scott J, Eddy R L, Shows T B", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "reference": [ { "type": "PubMed", "id": "2408344", "url": "https://glygen.org/publication/PubMed/2408344" } ] }, { "title": "Computational framework for identification of intact glycopeptides in complex samples.", "journal": "Analytical chemistry", "date": "2014", "authors": "Mayampurath A, Yu CY, Song E, Balan J, Mechref Y, Tang H", "evidence": [ { "database": "UniCarbKB", "id": "P01023", "url": "" }, { "database": "GlyConnect", "id": "730", "url": "https://glyconnect.expasy.org/browser/proteins/730" } ], "reference": [ { "type": "PubMed", "id": "24279413", "url": "https://glygen.org/publication/PubMed/24279413" } ] }, { "title": "Primary structure of human alpha 2-macroglobulin. Complete disulfide bridge assignment and localization of two interchain bridges in the dimeric proteinase binding unit.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Jensen PE, Sottrup-Jensen L", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "reference": [ { "type": "PubMed", "id": "2430963", "url": "https://glygen.org/publication/PubMed/2430963" } ] }, { "title": "Selective glycopeptide profiling by acetone enrichment and LC/MS.", "journal": "Journal of proteomics", "date": "2014", "authors": "Takakura D, Harazono A, Hashii N, Kawasaki N", "evidence": [ { "database": "GlyConnect", "id": "730", "url": "https://glyconnect.expasy.org/browser/proteins/730" } ], "reference": [ { "type": "PubMed", "id": "24530628", "url": "https://glygen.org/publication/PubMed/24530628" } ] }, { "title": "In situ-generated thrombin is the only enzyme that effectively activates factor VIII and factor V in thromboplastin-activated plasma.", "journal": "Blood", "date": "1989", "authors": "Pieters J, Lindhout T, Hemker HC", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "2502206", "url": "https://glygen.org/publication/PubMed/2502206" } ] }, { "title": "Differential proteolytic activation of factor VIII-von Willebrand factor complex by thrombin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Hill-Eubanks DC, Parker CG, Lollar P", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "2505252", "url": "https://glygen.org/publication/PubMed/2505252" } ] }, { "title": "The regulation of human factor XIIa by plasma proteinase inhibitors.", "journal": "The Journal of biological chemistry", "date": "1985", "authors": "Pixley RA, Schapira M, Colman RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "2578463", "url": "https://glygen.org/publication/PubMed/2578463" } ] }, { "title": "Distribution of plasma kallikrein between C-1 inactivator and alpha 2-macroglobulin in plasma utilizing a new assay for alpha 2-macroglobulin-kallikrein complexes.", "journal": "The Journal of biological chemistry", "date": "1985", "authors": "Harpel PC, Lewin MF, Kaplan AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "2579948", "url": "https://glygen.org/publication/PubMed/2579948" } ] }, { "title": "Nucleotide sequence of cDNA encoding human alpha 2-macroglobulin and assignment of the chromosomal locus.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1985", "authors": "Kan C C, Solomon E, Belt K T, Chain A C, Hiorns L R, Fey G", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "reference": [ { "type": "PubMed", "id": "2581245", "url": "https://glygen.org/publication/PubMed/2581245" } ] }, { "title": "Factor VIII Is Synthesized in Human Endothelial Cells, Packaged in Weibel-Palade Bodies and Secreted Bound to ULVWF Strings.", "journal": "PloS one", "date": "2015", "authors": "Turner NA, Moake JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "26473492", "url": "https://glygen.org/publication/PubMed/26473492" } ] }, { "title": "Proteomics Analysis of O-GalNAc Glycosylation in Human Serum by an Integrated Strategy.", "journal": "Analytical chemistry", "date": "2017", "authors": "Qin H, Cheng K, Zhu J, Mao J, Wang F, Dong M, Chen R, Guo Z, Liang X, Ye M, Zou H", "evidence": [ { "database": "UniCarbKB", "id": "P01023", "url": "" } ], "reference": [ { "type": "PubMed", "id": "28035807", "url": "https://glygen.org/publication/PubMed/28035807" } ] }, { "title": "Purification and properties of prolylcarboxypeptidase (angiotensinase C) from human kidney.", "journal": "The Journal of biological chemistry", "date": "1978", "authors": "Odya CE, Marinkovic DV, Hammon KJ, Stewart TA, Erdos EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "28321", "url": "https://glygen.org/publication/PubMed/28321" } ] }, { "title": "An update on factor XI structure and function.", "journal": "Thrombosis research", "date": "2018", "authors": "Mohammed BM, Matafonov A, Ivanov I, Sun MF, Cheng Q, Dickeson SK, Li C, Sun D, Verhamme IM, Emsley J, Gailani D", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "29223926", "url": "https://glygen.org/publication/PubMed/29223926" } ] }, { "title": "Large-scale intact glycopeptide identification by Mascot database search.", "journal": "Scientific reports", "date": "2018", "authors": "Bollineni RC, Koehler CJ, Gislefoss RE, Anonsen JH, Thiede B", "evidence": [ { "database": "GlyConnect", "id": "730", "url": "https://glyconnect.expasy.org/browser/proteins/730" } ], "reference": [ { "type": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "title": "Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and alpha-1B-Glycoprotein.", "journal": "Analytical chemistry", "date": "2018", "authors": "Sun S, Hu Y, Jia L, Eshghi ST, Liu Y, Shah P, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P01023", "url": "" }, { "database": "GlyConnect", "id": "730", "url": "https://glyconnect.expasy.org/browser/proteins/730" } ], "reference": [ { "type": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "GlyConnect", "id": "730", "url": "https://glyconnect.expasy.org/browser/proteins/730" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "Binding of coagulation factor XI to washed human platelets.", "journal": "Biochemistry", "date": "1986", "authors": "Greengard JS, Heeb MJ, Ersdal E, Walsh PN, Griffin JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "3017409", "url": "https://glygen.org/publication/PubMed/3017409" } ] }, { "title": "Combinatorial regulation of hepatic cytoplasmic signaling and nuclear transcriptional events by the OGT/REV-ERBalpha complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2018", "authors": "Berthier A, Vinod M, Porez G, Steenackers A, Alexandre J, Yamakawa N, Gheeraert C, Ploton M, Marechal X, Dubois-Chevalier J, Hovasse A, Schaeffer-Reiss C, Cianferani S, Rolando C, Bray F, Duez H, Eeckhoute J, Lefebvre T, Staels B, Lefebvre P", "evidence": [ { "database": "O-GlcNAc Database", "id": "P01023", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01023" } ], "reference": [ { "type": "PubMed", "id": "30397120", "url": "https://glygen.org/publication/PubMed/30397120" } ] }, { "title": "Mapping the O-glycoproteome using site-specific extraction of O-linked glycopeptides (EXoO).", "journal": "Molecular systems biology", "date": "2018", "authors": "Yang W, Ao M, Hu Y, Li QK, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P01023", "url": "" } ], "reference": [ { "type": "PubMed", "id": "30459171", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "title": "Proteolytic processing of human factor VIII. Correlation of specific cleavages by thrombin, factor Xa, and activated protein C with activation and inactivation of factor VIII coagulant activity.", "journal": "Biochemistry", "date": "1986", "authors": "Eaton D, Rodriguez H, Vehar GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "3082357", "url": "https://glygen.org/publication/PubMed/3082357" } ] }, { "title": "Biosynthesis of complement C1 inhibitor by Hep G2 cells. Reactivity of different glycosylated forms of the inhibitor with C1s.", "journal": "The Biochemical journal", "date": "1986", "authors": "Prandini MH, Reboul A, Colomb MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "3099750", "url": "https://glygen.org/publication/PubMed/3099750" } ] }, { "title": "Synthesis, processing, and secretion of recombinant human factor VIII expressed in mammalian cells.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Kaufman RJ, Wasley LC, Dorner AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "3129422", "url": "https://glygen.org/publication/PubMed/3129422" } ] }, { "title": "Association of the factor VIII light chain with von Willebrand factor.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Lollar P, Hill-Eubanks DC, Parker CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "3134349", "url": "https://glygen.org/publication/PubMed/3134349" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P01023", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01023" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis.", "journal": "Nature methods", "date": "2021", "authors": "Kawahara R, Chernykh A, Alagesan K, Bern M, Cao W, Chalkley RJ, Cheng K, Choo MS, Edwards N, Goldman R, Hoffmann M, Hu Y, Huang Y, Kim JY, Kletter D, Liquet B, Liu M, Mechref Y, Meng B, Neelamegham S, Nguyen-Khuong T, Nilsson J, Pap A, Park GW, Parker BL, Pegg CL, Penninger JM, Phung TK, Pioch M, Rapp E, Sakalli E, Sanda M, Schulz BL, Scott NE, Sofronov G, Stadlmann J, Vakhrushev SY, Woo CM, Wu HY, Yang P, Ying W, Zhang H, Zhang Y, Zhao J, Zaia J, Haslam SM, Palmisano G, Yoo JS, Larson G, Khoo KH, Medzihradszky KF, Kolarich D, Packer NH, Thaysen-Andersen M", "evidence": [ { "database": "GlyConnect", "id": "730", "url": "https://glyconnect.expasy.org/browser/proteins/730" } ], "reference": [ { "type": "PubMed", "id": "34725484", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "title": "Completion of the primary structure of human high-molecular-mass kininogen. The amino acid sequence of the entire heavy chain and evidence for its evolution by gene triplication.", "journal": "European journal of biochemistry", "date": "1986", "authors": "Kellermann J, Lottspeich F, Henschen A, Muller-Esterl W", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "3484703", "url": "https://glygen.org/publication/PubMed/3484703" } ] }, { "title": "Human plasma prekallikrein, a zymogen to a serine protease that contains four tandem repeats.", "journal": "Biochemistry", "date": "1986", "authors": "Chung DW, Fujikawa K, McMullen BA, Davie EW", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "3521732", "url": "https://glygen.org/publication/PubMed/3521732" } ] }, { "title": "Amino acid sequence of human von Willebrand factor.", "journal": "Biochemistry", "date": "1986", "authors": "Titani K, Kumar S, Takio K, Ericsson LH, Wade RD, Ashida K, Walsh KA, Chopek MW, Sadler JE, Fujikawa K", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "3524673", "url": "https://glygen.org/publication/PubMed/3524673" } ] }, { "title": "Alpha-2-macroglobulin is involved in the occurrence of early-onset pre-eclampsia via its negative impact on uterine spiral artery remodeling and placental angiogenesis.", "journal": "BMC medicine", "date": "2023-03-09", "authors": "Wang Jingyun, Zhang Ping, Liu Mengyuan, Huang Zhengrui, Yang Xiaofeng, Ding Yuzhen, Liu Jia, Cheng Xin, Xu Shujie, He Meiyao, Zhang Fengxiang, Wang Guang, Li Ruiman, Yang Xuesong", "evidence": [ { "database": "RefSeq", "id": "NP_000005", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000005" } ], "reference": [ { "type": "PubMed", "id": "36894970", "url": "https://glygen.org/publication/PubMed/36894970" } ] }, { "title": "Alpha-2-Macroglobulin (A2M) and Dopamine Receptor D2 (DRD2) expression analysis and Influence of Separation from Parents in Childhood on the Suicide and Self-injury Behavior and Psychological Adjustment in Adolescence.", "journal": "Cellular and molecular biology (Noisy-le-Grand, France)", "date": "2023-01-31", "authors": "Xu Qing, Xu Haoming, Li Shuhan", "evidence": [ { "database": "RefSeq", "id": "NP_000005", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000005" } ], "reference": [ { "type": "PubMed", "id": "37213155", "url": "https://glygen.org/publication/PubMed/37213155" } ] }, { "title": "Expression, purification, and characterization of recombinant gamma-carboxylated factor IX synthesized in Chinese hamster ovary cells.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Kaufman RJ, Wasley LC, Furie BC, Furie B, Shoemaker CB", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "3733688", "url": "https://glygen.org/publication/PubMed/3733688" } ] }, { "title": "Alpha-2-macroglobulin prevents platelet aggregation induced by brain-derived neurotrophic factor.", "journal": "Biochemical pharmacology", "date": "2023-09", "authors": "Jourdi Georges, Boukhatem Imane, Barcelona Pablo F, Fleury Samuel, Welman Melanie, Saragovi H Uri, Pasquali Samuela, Lordkipanidz\u00e9 Marie", "evidence": [ { "database": "RefSeq", "id": "NP_000005", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000005" } ], "reference": [ { "type": "PubMed", "id": "37487878", "url": "https://glygen.org/publication/PubMed/37487878" } ] }, { "title": "Human C1 inhibitor: primary structure, cDNA cloning, and chromosomal localization.", "journal": "Biochemistry", "date": "1986", "authors": "Bock SC, Skriver K, Nielsen E, Thogersen HC, Wiman B, Donaldson VH, Eddy RL, Marrinan J, Radziejewska E, Huber R, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "3756141", "url": "https://glygen.org/publication/PubMed/3756141" } ] }, { "title": "Alpha-2 macroglobulin activity in SARS-CoV-2 induced infection and in the post-COVID-19 period.", "journal": "Biomeditsinskaia khimiia", "date": "2023-09", "authors": "Akbasheva O E, Mitrofanova D K, Spirina L V, Samoilova Yu G, Matveeva M V, Podchinenova D V, Oleynik O A", "evidence": [ { "database": "RefSeq", "id": "NP_000005", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000005" } ], "reference": [ { "type": "PubMed", "id": "37705485", "url": "https://glygen.org/publication/PubMed/37705485" } ] }, { "title": "Amino acid sequence of the heavy chain of human alpha-factor XIIa (activated Hageman factor).", "journal": "The Journal of biological chemistry", "date": "1985", "authors": "McMullen BA, Fujikawa K", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "3886654", "url": "https://glygen.org/publication/PubMed/3886654" } ] }, { "title": "The amino acid sequence of the light chain of human high-molecular-mass kininogen.", "journal": "European journal of biochemistry", "date": "1985", "authors": "Lottspeich F, Kellermann J, Henschen A, Foertsch B, Muller-Esterl W", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "4054110", "url": "https://glygen.org/publication/PubMed/4054110" } ] }, { "title": "The inhibition of plasmin, plasma kallikrein, plasma permeability factor, and the C'1r subcomponent of the first component of complement by serum C'1 esterase inhibitor.", "journal": "The Journal of experimental medicine", "date": "1969", "authors": "Ratnoff OD, Pensky J, Ogston D, Naff GB", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "4178758", "url": "https://glygen.org/publication/PubMed/4178758" } ] }, { "title": "Inhibition by C1INH of Hagemann factor fragment activation of coagulation, fibrinolysis, and kinin generation.", "journal": "The Journal of clinical investigation", "date": "1973", "authors": "Schreiber AD, Kaplan AP, Austen KF", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "4703226", "url": "https://glygen.org/publication/PubMed/4703226" } ] }, { "title": "Human high molecular weight kininogen. Studies of structure-function relationships and of proteolysis of the molecule occurring during contact activation of plasma.", "journal": "The Journal of biological chemistry", "date": "1979", "authors": "Kerbiriou DM, Griffin JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "500690", "url": "https://glygen.org/publication/PubMed/500690" } ] }, { "title": "Activation of human factor XI (plasma thromboplastin antecedent) by factor XIIa (activated Hageman factor).", "journal": "Biochemistry", "date": "1977", "authors": "Kurachi K, Davie EW", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "588558", "url": "https://glygen.org/publication/PubMed/588558" } ] }, { "title": "Primary structure of the 'bait' region for proteinases in alpha 2-macroglobulin. Nature of the complex.", "journal": "FEBS Lett.", "date": "1981", "authors": "Sottrup-Jensen L, L\u00f8nblad P B, Stepanik T M, Petersen T E, Magnusson S, J\u00f6rnvall H", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "reference": [ { "type": "PubMed", "id": "6165619", "url": "https://glygen.org/publication/PubMed/6165619" } ] }, { "title": "Proteolytic cleavage sites on alpha 2-macroglobulin resulting in proteinase binding are different for trypsin and Staphylococcus aureus V-8 proteinase.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1981", "authors": "Hall P K, Nelles L P, Travis J, Roberts R C", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "reference": [ { "type": "PubMed", "id": "6167263", "url": "https://glygen.org/publication/PubMed/6167263" } ] }, { "title": "Primary and secondary cleavage sites in the bait region of alpha 2-macroglobulin.", "journal": "FEBS Lett.", "date": "1981", "authors": "Mortensen S B, Sottrup-Jensen L, Hansen H F, Petersen T E, Magnusson S", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "reference": [ { "type": "PubMed", "id": "6172288", "url": "https://glygen.org/publication/PubMed/6172288" } ] }, { "title": "Human neutrophil elastase and cathepsin G cleavage sites in the bait region of alpha 2-macroglobulin. Proposed structural limits of the bait region.", "journal": "Hoppe-Seyler's Z. Physiol. Chem.", "date": "1983", "authors": "Virca G D, Salvesen G S, Travis J", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "reference": [ { "type": "PubMed", "id": "6195065", "url": "https://glygen.org/publication/PubMed/6195065" } ] }, { "title": "Primary structure of human alpha 2-macroglobulin. V. The complete structure.", "journal": "The Journal of biological chemistry", "date": "1984", "authors": "Sottrup-Jensen L, Stepanik TM, Kristensen T, Wierzbicki DM, Jones CM, Lonblad PB, Magnusson S, Petersen TE", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023#ptm_processing" }, { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" }, { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "6203908", "url": "https://glygen.org/publication/PubMed/6203908" } ] }, { "title": "Binding of human blood-coagulation Factors IXa and X to phospholipid membranes.", "journal": "The Biochemical journal", "date": "1984", "authors": "Mertens K, Cupers R, Van Wijngaarden A, Bertina RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "6334516", "url": "https://glygen.org/publication/PubMed/6334516" } ] }, { "title": "Structure of human factor VIII.", "journal": "Nature", "date": "1984", "authors": "Vehar GA, Keyt B, Eaton D, Rodriguez H, O'Brien DP, Rotblat F, Oppermann H, Keck R, Wood WI, Harkins RN, Tuddenham EG, Lawn RM, Capon DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "6438527", "url": "https://glygen.org/publication/PubMed/6438527" } ] }, { "title": "Characterization of the proteins of isolated human platelet alpha-granules. Evidence for a separate alpha-granule-pool of the glycoproteins IIb and IIIa.", "journal": "Biochimica et biophysica acta", "date": "1981", "authors": "Gogstad GO, Hagen I, Korsmo R, Solum NO", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "6457647", "url": "https://glygen.org/publication/PubMed/6457647" } ] }, { "title": "Amino acid sequence of human beta-factor XIIa.", "journal": "The Journal of biological chemistry", "date": "1983", "authors": "Fujikawa K, McMullen BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "6604055", "url": "https://glygen.org/publication/PubMed/6604055" } ] }, { "title": "Characterization of the binding domains in the fragments cleaved by cathepsin G from human plasma fibronectin.", "journal": "European journal of biochemistry", "date": "1982", "authors": "Vartio T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "7075587", "url": "https://glygen.org/publication/PubMed/7075587" } ] }, { "title": "Autoactivation of human Hageman factor. Demonstration utilizing a synthetic substrate.", "journal": "The Journal of biological chemistry", "date": "1980", "authors": "Silverberg M, Dunn JT, Garen L, Kaplan AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "7391081", "url": "https://glygen.org/publication/PubMed/7391081" } ] }, { "title": "Release of biological activities from quiescent fibronectin by a conformational change and limited proteolysis by matrix metalloproteinases.", "journal": "Biochemistry", "date": "1995", "authors": "Fukai F, Ohtaki M, Fujii N, Yajima H, Ishii T, Nishizawa Y, Miyazaki K, Katayama T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "7547873", "url": "https://glygen.org/publication/PubMed/7547873" } ] }, { "title": "Expression of the blood-clotting factor-VIII cDNA is repressed by a transcriptional silencer located in its coding region.", "journal": "Blood", "date": "1995", "authors": "Hoeben RC, Fallaux FJ, Cramer SJ, van den Wollenberg DJ, van Ormondt H, Briet E, van der Eb AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "7727775", "url": "https://glygen.org/publication/PubMed/7727775" } ] }, { "title": "The affinity and stoichiometry of binding of human factor VIII to von Willebrand factor.", "journal": "Blood", "date": "1995", "authors": "Vlot AJ, Koppelman SJ, van den Berg MH, Bouma BN, Sixma JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "7756647", "url": "https://glygen.org/publication/PubMed/7756647" } ] }, { "title": "Biology of factor IX.", "journal": "Blood coagulation & fibrinolysis : an international journal in haemostasis and thrombosis", "date": "1993", "authors": "Kurachi K, Kurachi S, Furukawa M, Yao SN", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "8148489", "url": "https://glygen.org/publication/PubMed/8148489" } ] }, { "title": "Isolation, cDNA cloning, and overexpression of a 33-kD cell surface glycoprotein that binds to the globular `heads` of C1q.", "journal": "The Journal of experimental medicine", "date": "1994", "authors": "Ghebrehiwet B, Lim BL, Peerschke EI, Willis AC, Reid KB", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "8195709", "url": "https://glygen.org/publication/PubMed/8195709" } ] }, { "title": "Cloning and characterization of a unique elastolytic metalloproteinase produced by human alveolar macrophages.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Shapiro SD, Kobayashi DK, Ley TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "8226919", "url": "https://glygen.org/publication/PubMed/8226919" } ] }, { "title": "Factor XII-independent activation of factor XI in plasma: effects of sulfatides on tissue factor-induced coagulation.", "journal": "Blood", "date": "1993", "authors": "Gailani D, Broze GJ Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "8338946", "url": "https://glygen.org/publication/PubMed/8338946" } ] }, { "title": "Sequencing and cloning of human prolylcarboxypeptidase (angiotensinase C). Similarity to both serine carboxypeptidase and prolylendopeptidase families.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Tan F, Morris PW, Skidgel RA, Erdos EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "8344943", "url": "https://glygen.org/publication/PubMed/8344943" } ] }, { "title": "Platelet alpha-granules.", "journal": "Blood reviews", "date": "1993", "authors": "Harrison P, Cramer EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "8467233", "url": "https://glygen.org/publication/PubMed/8467233" } ] }, { "title": "The degradation of human endothelial cell-derived perlecan and release of bound basic fibroblast growth factor by stromelysin, collagenase, plasmin, and heparanases.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Whitelock JM, Murdoch AD, Iozzo RV, Underwood PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "8626565", "url": "https://glygen.org/publication/PubMed/8626565" } ] }, { "title": "Activation of the factor VIIIa-factor IXa enzyme complex of blood coagulation by membranes containing phosphatidyl-L-serine.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Gilbert GE, Arena AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "8626656", "url": "https://glygen.org/publication/PubMed/8626656" } ] }, { "title": "Identification of the zinc-dependent endothelial cell binding protein for high molecular weight kininogen and factor XII: identity with the receptor that binds to the globular `heads` of C1q (gC1q-R).", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Joseph K, Ghebrehiwet B, Peerschke EI, Reid KB, Kaplan AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "8710908", "url": "https://glygen.org/publication/PubMed/8710908" } ] }, { "title": "Activation and function of human Hageman factor. The role of high molecular weight kininogen and prekallikrein.", "journal": "The Journal of clinical investigation", "date": "1977", "authors": "Meier HL, Pierce JV, Colman RW, Kaplan AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "874082", "url": "https://glygen.org/publication/PubMed/874082" } ] }, { "title": "Human blood coagulation factor XI. Purification, properties, and mechanism of activation by activated factor XII.", "journal": "The Journal of biological chemistry", "date": "1977", "authors": "Bouma BN, Griffin JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "893417", "url": "https://glygen.org/publication/PubMed/893417" } ] }, { "title": "The role of the C-terminal domain of human collagenase-3 (MMP-13) in the activation of procollagenase-3, substrate specificity, and tissue inhibitor of metalloproteinase interaction.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Knauper V, Cowell S, Smith B, Lopez-Otin C, O'Shea M, Morris H, Zardi L, Murphy G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "9065415", "url": "https://glygen.org/publication/PubMed/9065415" } ] }, { "title": "Hydrolysis of a broad spectrum of extracellular matrix proteins by human macrophage elastase.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Gronski TJ Jr, Martin RL, Kobayashi DK, Walsh BC, Holman MC, Huber M, Van Wart HE, Shapiro SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "9115292", "url": "https://glygen.org/publication/PubMed/9115292" } ] }, { "title": "Degradation of decorin by matrix metalloproteinases: identification of the cleavage sites, kinetic analyses and transforming growth factor-beta1 release.", "journal": "The Biochemical journal", "date": "1997", "authors": "Imai K, Hiramatsu A, Fukushima D, Pierschbacher MD, Okada Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "9148753", "url": "https://glygen.org/publication/PubMed/9148753" } ] }, { "title": "High molecular weight kininogen peptides inhibit the formation of kallikrein on endothelial cell surfaces and subsequent urokinase-dependent plasmin formation.", "journal": "Blood", "date": "1997", "authors": "Lin Y, Harris RB, Yan W, McCrae KR, Zhang H, Colman RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "9226169", "url": "https://glygen.org/publication/PubMed/9226169" } ] }, { "title": "High molecular weight kininogen regulates prekallikrein assembly and activation on endothelial cells: a novel mechanism for contact activation.", "journal": "Blood", "date": "1998", "authors": "Motta G, Rojkjaer R, Hasan AA, Cines DB, Schmaier AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "9427705", "url": "https://glygen.org/publication/PubMed/9427705" } ] }, { "title": "Effects of melagatran, a new low-molecular-weight thrombin inhibitor, on thrombin and fibrinolytic enzymes.", "journal": "Thrombosis and haemostasis", "date": "1998", "authors": "Gustafsson D, Antonsson T, Bylund R, Eriksson U, Gyzander E, Nilsson I, Elg M, Mattsson C, Deinum J, Pehrsson S, Karlsson O, Nilsson A, Sorensen H", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "9459334", "url": "https://glygen.org/publication/PubMed/9459334" } ] }, { "title": "Membrane-type matrix metalloproteinases 1 and 2 exhibit broad-spectrum proteolytic capacities comparable to many matrix metalloproteinases.", "journal": "European journal of biochemistry", "date": "1997", "authors": "d'Ortho MP, Will H, Atkinson S, Butler G, Messent A, Gavrilovic J, Smith B, Timpl R, Zardi L, Murphy G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "9461298", "url": "https://glygen.org/publication/PubMed/9461298" } ] }, { "title": "Novastan (brand of argatroban): a small-molecule, direct thrombin inhibitor.", "journal": "Seminars in thrombosis and hemostasis", "date": "1997", "authors": "Hursting MJ, Alford KL, Becker JC, Brooks RL, Joffrion JL, Knappenberger GD, Kogan PW, Kogan TP, McKinney AA, Schwarz RP Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "9469622", "url": "https://glygen.org/publication/PubMed/9469622" } ] }, { "title": "Biosynthesis, assembly and secretion of coagulation factor VIII.", "journal": "Blood coagulation & fibrinolysis : an international journal in haemostasis and thrombosis", "date": "1997", "authors": "Kaufman RJ, Pipe SW, Tagliavacca L, Swaroop M, Moussalli M", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "9607108", "url": "https://glygen.org/publication/PubMed/9607108" } ] }, { "title": "Activation of factor VIII by thrombin increases its affinity for binding to synthetic phospholipid membranes and activated platelets.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Saenko EL, Scandella D, Yakhyaev AV, Greco NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "9774404", "url": "https://glygen.org/publication/PubMed/9774404" } ] }, { "title": "The life cycle of coagulation factor VIII in view of its structure and function.", "journal": "Blood", "date": "1998", "authors": "Lenting PJ, van Mourik JA, Mertens K", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "9834200", "url": "https://glygen.org/publication/PubMed/9834200" } ] }, { "title": "Human HtrA, an evolutionarily conserved serine protease identified as a differentially expressed gene product in osteoarthritic cartilage.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Hu SI, Carozza M, Klein M, Nantermet P, Luk D, Crowl RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "9852107", "url": "https://glygen.org/publication/PubMed/9852107" } ] }, { "title": "Localization of basic residues required for receptor binding to the single alpha-helix of the receptor binding domain of human alpha2-macroglobulin.", "journal": "Protein Sci.", "date": "1998", "authors": "Huang W, Dolmer K, Liao X, Gettins P G", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "reference": [ { "type": "PubMed", "id": "9865955", "url": "https://glygen.org/publication/PubMed/9865955" } ] }, { "title": "Thrombin activates factor XI on activated platelets in the absence of factor XII.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "1999", "authors": "Oliver JA, Monroe DM, Roberts HR, Hoffman M", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "9888880", "url": "https://glygen.org/publication/PubMed/9888880" } ] } ], "pathway": [ { "id": "hsa:2", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2", "resource": "KEGG Pathway" }, { "id": "R-HSA-114608", "name": "Platelet degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608", "resource": "Reactome", "description": "Platelet degranulation" }, { "id": "R-HSA-140837", "name": "Intrinsic Pathway of Fibrin Clot Formation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837", "resource": "Reactome", "description": "Intrinsic Pathway of Fibrin Clot Formation" }, { "id": "R-HSA-1474228", "name": "Degradation of the extracellular matrix", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228", "resource": "Reactome", "description": "Degradation of the extracellular matrix" }, { "id": "R-HSA-8963896", "name": "HDL assembly", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963896", "resource": "Reactome", "description": "HDL assembly" } ], "orthologs": [ { "uniprot_canonical_ac": "P06238-1", "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2m", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGKHRLRSLALLPLLLRLLLLLLPTDASAPQKPIYMVMVPSLLHAGTPEKACFLFSHLNETVAVRVSLESVRGNQSLFTDLVVDKDLFHCTSFTVPQSSSDEVMFFTVQVKGATHEFRRRSTVLVKKKESLVFAQTDKPIYKPGQTVRFRVVSLDESFHPLNELIPLLYIQDPKNNRIAQWQNFNLEGGLKQLSFPLSSEPTQGSYKVVIRTESGRTVEHPFSVEEFVLPKFEVRVTVPETITILEEEMNVSVCGIYTYGKPVPGRVTVNICRKYSNPSNCFGEESVAFCEKLSQQLDGRGCFSQLVKTKSFQLKRQEYEMQLDVHAKIQEEGTGVEETGKGLTKITRTITKLSFVNVDSHFRQGIPFVGQVLLVDGRGTPIPYETIFIGADEANLYINTTTDKHGLARFSINTDDIMGTSLTVRAKYKDSNACYGFRWLTEENVEAWHTAYAVFSPSRSFLHLESLPDKLRCDQTLEVQAHYILNGEAMQELKELVFYYLMMAKGGIVRAGTHVLPLKQGQMRGHFSILISMETDLAPVARLVLYAILPNGEVVGDTAKYEIENCLANKVDLVFRPNSGLPATRALLSVMASPQSLCGLRAVDQSVLLMKPETELSASLIYDLLPVKDLTGFPQGADQREEDTNGCVKQNDTYINGILYSPVQNTNEEDMYGFLKDMGLKVFTNSNIRKPKVCERLRDNKGIPAAYHLVSQSHMDAFLESSESPTETRRSYFPETWIWDLVVVDSAGVAEVEVTVPDTITEWKAGAFCLSNDTGLGLSPVVQFQAFQPFFVELTMPYSVIRGEAFTLKATVLNYLPTCIRVAVQLEASPDFLAAPEEKEQRSHCICMNQRHTASWAVIPKSLGNVNFTVSAEALNSKELCGNEVPVVPEQGKKDTIIKSLLVEPEGLENEVTFNSLLCPMGAEVSELIALKLPSDVVEESARASVTVLGDILGSAMQNTQDLLKMPYGCGEQNMVLFAPNIYVLDYLNETQQLTQEIKTKAIAYLNTGYQRQLNYKHRDGSYSTFGDKPGRNHANTWLTAFVLKSFAQARKYIFIDEVHITQALLWLSQQQKDNGCFRSSGSLLNNAMKGGVEDEVTLSAYITIALLEMSLPVTHPVVRNALFCLDTAWKSARGGAGGSHVYTKALLAYAFALAGNQDTKKEILKSLDEEAVKEEDSVHWTRPQKPSVSVALWYQPQAPSAEVEMTAYVLLAYLTTEPAPTQEDLTAAMLIVKWLTKQQNSHGGFSSTQDTVVALHALSKYGSATFTRAKKAAQVTIHSSGTFSTKFQVNNNNQLLLQRVTLPTVPGDYTVKVTGEGCVYLQTSLKYSVLPREEEFPFTVVVQTLPGTCEDPKAHTSFQISLNISYTGSRSESNMAIADVKMVSGFIPLKPTVKMLERSVHVSRTEVSNNHVLIYLDKVSNQTVNLSFTVQQDIPIRDLKPAVVKVYDYYEKDEFAVAKYSAPCSTDYGNA", "length": 1472 }, "evidence": [ { "id": "45922377", "url": "http://www.informatics.jax.org/homology/45922377", "database": "MGI" }, { "id": "P01023", "url": "https://omabrowser.org/oma/group/P01023/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q6GQT1-1", "protein_name": "Alpha-2-macroglobulin-P", "gene_name": "A2m", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGKRWLPSLALLPLPPPLLLLLLLLLPTNASAPQKPIYMVMVPSLLHAGTPEKGCLLFNHLNETVTVKVSMESVRGNQSLFTDLVVDKDLFHCASFIVPQSSSNEVMFLTVQVKGPTHEFRRRSTVLIKTKESLVFAQTDKPIYKPGQMVRFRVVSLDENFHPLNELIPLLYIQDSKKNRIAQWQNFRLEGGLKQLSFPLSSEPTQGSYKVVIRTESGRTVEHPFSVKEFVLPKFEVKVAVPETITILEEEMNVSVCGIYTYGKPVPGHVTVNICRKYSNPSSCFGEESLAFCEKFSQQLDGRGCFSQLVKTKSFQLKRQEYEMQLDVNAKIQEEGTGVEETGKGLTKITRTITKLSFVNVDTHFRQGIPFVGQVLLVDGRGTPIPYEMIFIGADEANQNINTTTDKNGLARFSINTDDIMGTSLTVRAKYKDSNVCYGFRWLTEENVEAWHTANAVFSPSRSFVHLESLPYKLRCEQTLAVQAHYILNDEAVLERKELVFYYLMMAKGGIVRAGTHVLPVTQGHKKGHFSILISMETDLAPVARLVLYTILPNGEVVGDTVKYEIEKCLANKVDLVFHPNIGLPATRAFLSVMASPQSLCGLRAVDQSVLLTKPEAELSASLVYDLLPVKDLTGFPKGVNQQEEDTNGCLKQNDTYINGILYSPVQNTNEEDMYGFLKDMGLKVFTNLNIRKPKVCERLGVNKIPAAYHLVSQGHMDAFLESSESPTETTRSYFPETWIWDLVIVDSTGVAEMEVTVPDTITEWKAGAFCLSNDTGLGLSPVIDFQAFQPFFVDLTMPYSVIRGEAFTLKATVLNYLQTCIRVGVQLEASPDFLATPEEKEQKSHCICMNERHTMSWAVIPKSLGNVNFTVSAEALDSKELCRNEVPVVPERGKKDTIIKSLLVEPEGLENEVTFNSLLCPTGAEVSEQISLKLPSDVVEESARASVTVLGDILGSAMQNTQDLLKMPYGCGEQNMVLFAPNIYVLDYLNETEQLTQEIKTKAITYLNTGYQRQLNYKHRDGSYSTFGDKPGRSHANTWLTAFVLKSFAQARRYIFIDESHITQALTWLSQQQKDNGCFRSSGSLLNNAMKGGVEDEVTLSAYITIALLEMSLPVTHPVVRNALFCLDTAWKSARRGASGNHVYTKALLAYAFALAGNQDTKKEILKSLDEEAVKEDNSVHWTRAQKPRVPADLWYQPQAPSAEVEMTAYVLLAYLTTELVPTREDLTAAMLIVKWLTKQQNSHGGFSSTQDTVVALHALSKYGAATFTRAKKAAHVTIQSSGAFYTKFQVNNDNQLLLQRVTLPTVPGDYTAKVAGEGCVYLQTSLKYSVLPREKEFPFALVVQTLPGTCEDLKAHTTFQISLNISYIGSRSDSNMAIADVKMVSGFIPLKPTVKMLERSVHVSRTEVSNNHVLIYLDKVSNQMLTLFFMVQQDIPVRDLKPAIVKVYDYYEKDEFAVAKYSAPCSAGYGNA", "length": 1474 }, "evidence": [ { "id": "45922377", "url": "http://www.informatics.jax.org/homology/45922377", "database": "MGI" }, { "id": "P01023", "url": "https://omabrowser.org/oma/group/P01023/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 13, "go_terms": [ { "name": "nerve growth factor binding", "id": "GO:0048406", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048406", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "pmid": "" }, { "name": "protease binding", "id": "GO:0002020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002020", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "pmid": "" }, { "name": "serine-type endopeptidase inhibitor activity", "id": "GO:0004867", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004867", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "pmid": "" }, { "name": "signaling receptor binding", "id": "GO:0005102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005102", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "pmid": "" }, { "name": "growth factor binding", "id": "GO:0019838", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019838", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "pmid": "" }, { "name": "enzyme binding", "id": "GO:0019899", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019899", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "pmid": "" }, { "name": "interleukin-8 binding", "id": "GO:0019959", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019959", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "pmid": "" }, { "name": "interleukin-1 binding", "id": "GO:0019966", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019966", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "pmid": "" }, { "name": "tumor necrosis factor binding", "id": "GO:0043120", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043120", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "pmid": "" }, { "name": "calcium-dependent protein binding", "id": "GO:0048306", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048306", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "pmid": "" }, { "name": "endopeptidase inhibitor activity", "id": "GO:0004866", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004866", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "pmid": "" }, { "name": "brain-derived neurotrophic factor binding", "id": "GO:0048403", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048403", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 10, "go_terms": [ { "name": "embryonic liver development", "id": "GO:1990402", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990402", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "pmid": "" }, { "name": "negative regulation of complement activation, lectin pathway", "id": "GO:0001869", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001869", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "pmid": "" }, { "name": "response to nutrient", "id": "GO:0007584", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007584", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "pmid": "" }, { "name": "stem cell differentiation", "id": "GO:0048863", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048863", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "pmid": "" }, { "name": "acute-phase response", "id": "GO:0006953", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006953", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "pmid": "" }, { "name": "response to glucocorticoid", "id": "GO:0051384", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051384", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "pmid": "" }, { "name": "acute inflammatory response to antigenic stimulus", "id": "GO:0002438", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002438", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "pmid": "" }, { "name": "luteinization", "id": "GO:0001553", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001553", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "pmid": "" }, { "name": "response to prostaglandin E", "id": "GO:0034695", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034695", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "pmid": "" }, { "name": "response to carbon dioxide", "id": "GO:0010037", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010037", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "pmid": "" }, { "name": "platelet alpha granule lumen", "id": "GO:0031093", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031093", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "pmid": "" }, { "name": "blood microparticle", "id": "GO:0072562", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072562", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "pmid": "" }, { "name": "collagen-containing extracellular matrix", "id": "GO:0062023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062023", "evidence": [ { "database": "UniProtKB", "id": "P01023", "url": "https://www.uniprot.org/uniprot/P01023" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "alpha-2-macroglobulin N-glycosylated 1 (human)", "definition": "An alpha-2-macroglobulin (human) that has been N-glycosylated at the residue equivalent to Asn-1424 of the amino acid sequence represented by UniProtKB:P01023-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P01023-1, Asn-1424, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051449", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051449" } ] }, { "name": "alpha-2-macroglobulin N-glycosylated 2 (human)", "definition": "An alpha-2-macroglobulin (human) that has been N-glycosylated at the residue equivalent to Asn-1424 of the amino acid sequence represented by UniProtKB:P01023-1, in which the glycan structure is represented by GlyTouCan:G22208HN. Example: UniProtKB:P01023-1, Asn-1424, MOD:00160~GNO:G22208HN. [PRO:DNx, PMID:24279413]", "evidence": [ { "id": "PR:000051450", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051450" } ] }, { "name": "alpha-2-macroglobulin N-glycosylated 3 (human)", "definition": "An alpha-2-macroglobulin (human) that has been N-glycosylated at the residue equivalent to Asn-1424 of the amino acid sequence represented by UniProtKB:P01023-1, in which the glycan composition is represented by GlyTouCan:G88374WZ. Example: UniProtKB:P01023-1, Asn-1424, MOD:00160~GNO:G88374WZ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051451", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051451" } ] }, { "name": "alpha-2-macroglobulin N-glycosylated 4 (human)", "definition": "An alpha-2-macroglobulin (human) that has been N-glycosylated at the residue equivalent to Asn-247 of the amino acid sequence represented by UniProtKB:P01023-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P01023-1, Asn-247, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051452", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051452" } ] }, { "name": "alpha-2-macroglobulin N-glycosylated 5 (human)", "definition": "An alpha-2-macroglobulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P01023-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P01023-1, Asn-396, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051453", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051453" } ] }, { "name": "alpha-2-macroglobulin N-glycosylated 6 (human)", "definition": "An alpha-2-macroglobulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P01023-1, in which the glycan composition is represented by GlyTouCan:G08293MJ. Example: UniProtKB:P01023-1, Asn-396, MOD:00160~GNO:G08293MJ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051454", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051454" } ] }, { "name": "alpha-2-macroglobulin N-glycosylated 7 (human)", "definition": "An alpha-2-macroglobulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P01023-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P01023-1, Asn-396, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051455", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051455" } ] }, { "name": "alpha-2-macroglobulin N-glycosylated 8 (human)", "definition": "An alpha-2-macroglobulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P01023-1, in which the glycan composition is represented by GlyTouCan:G83555HU. Example: UniProtKB:P01023-1, Asn-396, MOD:00160~GNO:G83555HU. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051456", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051456" } ] }, { "name": "alpha-2-macroglobulin N-glycosylated 9 (human)", "definition": "An alpha-2-macroglobulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P01023-1, in which the glycan composition is represented by GlyTouCan:G85740DB. Example: UniProtKB:P01023-1, Asn-396, MOD:00160~GNO:G85740DB. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051457", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051457" } ] }, { "name": "alpha-2-macroglobulin N-glycosylated 10 (human)", "definition": "An alpha-2-macroglobulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P01023-1, in which the glycan composition is represented by GlyTouCan:G88374WZ. Example: UniProtKB:P01023-1, Asn-396, MOD:00160~GNO:G88374WZ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051458", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051458" } ] }, { "name": "alpha-2-macroglobulin N-glycosylated 11 (human)", "definition": "An alpha-2-macroglobulin (human) that has been N-glycosylated at the residue equivalent to Asn-410 of the amino acid sequence represented by UniProtKB:P01023-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P01023-1, Asn-410, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051459", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051459" } ] }, { "name": "alpha-2-macroglobulin N-glycosylated 12 (human)", "definition": "An alpha-2-macroglobulin (human) that has been N-glycosylated at the residue equivalent to Asn-410 of the amino acid sequence represented by UniProtKB:P01023-1, in which the glycan composition is represented by GlyTouCan:G01650EU. Example: UniProtKB:P01023-1, Asn-410, MOD:00160~GNO:G01650EU. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051460", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051460" } ] }, { "name": "alpha-2-macroglobulin N-glycosylated 13 (human)", "definition": "An alpha-2-macroglobulin (human) that has been N-glycosylated at the residue equivalent to Asn-410 of the amino acid sequence represented by UniProtKB:P01023-1, in which the glycan composition is represented by GlyTouCan:G02815KT. Example: UniProtKB:P01023-1, Asn-410, MOD:00160~GNO:G02815KT. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051461", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051461" } ] }, { "name": "alpha-2-macroglobulin N-glycosylated 14 (human)", "definition": "An alpha-2-macroglobulin (human) that has been N-glycosylated at the residue equivalent to Asn-410 of the amino acid sequence represented by UniProtKB:P01023-1, in which the glycan composition is represented by GlyTouCan:G08293MJ. Example: UniProtKB:P01023-1, Asn-410, MOD:00160~GNO:G08293MJ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051462", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051462" } ] }, { "name": "alpha-2-macroglobulin N-glycosylated 15 (human)", "definition": "An alpha-2-macroglobulin (human) that has been N-glycosylated at the residue equivalent to Asn-410 of the amino acid sequence represented by UniProtKB:P01023-1, in which the glycan composition is represented by GlyTouCan:G10486CT. Example: UniProtKB:P01023-1, Asn-410, MOD:00160~GNO:G10486CT. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051463", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051463" } ] }, { "name": "alpha-2-macroglobulin N-glycosylated 16 (human)", "definition": "An alpha-2-macroglobulin (human) that has been N-glycosylated at the residue equivalent to Asn-410 of the amino acid sequence represented by UniProtKB:P01023-1, in which the glycan composition is represented by GlyTouCan:G15486FH. Example: UniProtKB:P01023-1, Asn-410, MOD:00160~GNO:G15486FH. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051464", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051464" } ] }, { "name": "alpha-2-macroglobulin N-glycosylated 17 (human)", "definition": "An alpha-2-macroglobulin (human) that has been N-glycosylated at the residue equivalent to Asn-410 of the amino acid sequence represented by UniProtKB:P01023-1, in which the glycan composition is represented by GlyTouCan:G37399XV. Example: UniProtKB:P01023-1, Asn-410, MOD:00160~GNO:G37399XV. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051465", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051465" } ] }, { "name": "alpha-2-macroglobulin N-glycosylated 18 (human)", "definition": "An alpha-2-macroglobulin (human) that has been N-glycosylated at the residue equivalent to Asn-410 of the amino acid sequence represented by UniProtKB:P01023-1, in which the glycan composition is represented by GlyTouCan:G39446WN. Example: UniProtKB:P01023-1, Asn-410, MOD:00160~GNO:G39446WN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051466", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051466" } ] }, { "name": "alpha-2-macroglobulin N-glycosylated 19 (human)", "definition": "An alpha-2-macroglobulin (human) that has been N-glycosylated at the residue equivalent to Asn-410 of the amino acid sequence represented by UniProtKB:P01023-1, in which the glycan composition is represented by GlyTouCan:G45504EY. Example: UniProtKB:P01023-1, Asn-410, MOD:00160~GNO:G45504EY. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051467", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051467" } ] }, { "name": "alpha-2-macroglobulin N-glycosylated 20 (human)", "definition": "An alpha-2-macroglobulin (human) that has been N-glycosylated at the residue equivalent to Asn-410 of the amino acid sequence represented by UniProtKB:P01023-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P01023-1, Asn-410, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051468", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051468" } ] }, { "name": "alpha-2-macroglobulin N-glycosylated 21 (human)", "definition": "An alpha-2-macroglobulin (human) that has been N-glycosylated at the residue equivalent to Asn-410 of the amino acid sequence represented by UniProtKB:P01023-1, in which the glycan composition is represented by GlyTouCan:G67324HN. Example: UniProtKB:P01023-1, Asn-410, MOD:00160~GNO:G67324HN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051469", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051469" } ] }, { "name": "alpha-2-macroglobulin N-glycosylated 22 (human)", "definition": "An alpha-2-macroglobulin (human) that has been N-glycosylated at the residue equivalent to Asn-410 of the amino acid sequence represented by UniProtKB:P01023-1, in which the glycan composition is represented by GlyTouCan:G83555HU. Example: UniProtKB:P01023-1, Asn-410, MOD:00160~GNO:G83555HU. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051470", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051470" } ] }, { "name": "alpha-2-macroglobulin N-glycosylated 23 (human)", "definition": "An alpha-2-macroglobulin (human) that has been N-glycosylated at the residue equivalent to Asn-410 of the amino acid sequence represented by UniProtKB:P01023-1, in which the glycan composition is represented by GlyTouCan:G85740DB. Example: UniProtKB:P01023-1, Asn-410, MOD:00160~GNO:G85740DB. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051471", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051471" } ] }, { "name": "alpha-2-macroglobulin N-glycosylated 24 (human)", "definition": "An alpha-2-macroglobulin (human) that has been N-glycosylated at the residue equivalent to Asn-869 of the amino acid sequence represented by UniProtKB:P01023-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P01023-1, Asn-869, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000051472", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051472" } ] }, { "name": "alpha-2-macroglobulin O-glycosylated 1 (human)", "definition": "An alpha-2-macroglobulin (human) that has been O-glycosylated at the residue equivalent to Ser-26 of the amino acid sequence represented by UniProtKB:P01023-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P01023-1, Ser-26, MOD:00002~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000051473", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051473" } ] }, { "name": "alpha-2-macroglobulin O-glycosylated 2 (human)", "definition": "An alpha-2-macroglobulin (human) that has been O-glycosylated at the residue equivalent to Ser-575 of the amino acid sequence represented by UniProtKB:P01023-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P01023-1, Ser-575, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000051474", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051474" } ] }, { "name": "alpha-2-macroglobulin O-glycosylated 3 (human)", "definition": "An alpha-2-macroglobulin (human) that has been O-glycosylated at the residue equivalent to Thr-588 of the amino acid sequence represented by UniProtKB:P01023-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P01023-1, Thr-588, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000051475", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051475" } ] }, { "name": "alpha-2-macroglobulin O-glycosylated 4 (human)", "definition": "An alpha-2-macroglobulin (human) that has been O-glycosylated at the residue equivalent to Thr-654 of the amino acid sequence represented by UniProtKB:P01023-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P01023-1, Thr-654, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000051476", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051476" } ] }, { "name": "alpha-2-macroglobulin O-glycosylated 5 (human)", "definition": "An alpha-2-macroglobulin (human) that has been O-glycosylated at the residue equivalent to Thr-763 of the amino acid sequence represented by UniProtKB:P01023-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P01023-1, Thr-763, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000051477", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051477" } ] }, { "name": "alpha-2-macroglobulin O-glycosylated 6 (human)", "definition": "An alpha-2-macroglobulin (human) that has been O-glycosylated at the residue equivalent to Thr-885 of the amino acid sequence represented by UniProtKB:P01023-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P01023-1, Thr-885, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000051478", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051478" } ] }, { "name": "alpha-2-macroglobulin O-glycosylated 7 (human)", "definition": "An alpha-2-macroglobulin (human) that has been O-glycosylated at the residue equivalent to Thr-885 of the amino acid sequence represented by UniProtKB:P01023-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P01023-1, Thr-885, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000051479", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051479" } ] } ], "site_annotation": [ { "start_pos": 1424, "end_pos": 1426, "annotation": "n_glycosylation_sequon" }, { "start_pos": 247, "end_pos": 249, "annotation": "n_glycosylation_sequon" }, { "start_pos": 396, "end_pos": 398, "annotation": "n_glycosylation_sequon" }, { "start_pos": 410, "end_pos": 412, "annotation": "n_glycosylation_sequon" }, { "start_pos": 55, "end_pos": 57, "annotation": "n_glycosylation_sequon" }, { "start_pos": 70, "end_pos": 72, "annotation": "n_glycosylation_sequon" }, { "start_pos": 869, "end_pos": 871, "annotation": "n_glycosylation_sequon" }, { "start_pos": 991, "end_pos": 993, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 55, 70, 247, 396, 410, 869, 991, 1089, 1424 ], "o_linked_sites": [ 26, 575, 588, 654, 763, 885, 1298 ], "snv_sites": [ 26, 41, 57, 61, 174, 176, 247, 249, 271, 393, 396, 397, 410, 412, 569, 571, 588, 749, 885, 993, 1079, 1090, 1091, 1100, 1178, 1296, 1297, 1406, 1424 ], "glycation_sites": [], "phosphorylation_sites": [ 679 ], "sequon_annotation_sites": [ { "start_pos": 1424, "end_pos": 1426 }, { "start_pos": 247, "end_pos": 249 }, { "start_pos": 396, "end_pos": 398 }, { "start_pos": 410, "end_pos": 412 }, { "start_pos": 55, "end_pos": 57 }, { "start_pos": 70, "end_pos": 72 }, { "start_pos": 869, "end_pos": 871 }, { "start_pos": 991, "end_pos": 993 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 149 }, { "field": "total_sites", "count": 16 }, { "field": "n_linked_glycans", "count": 74 }, { "field": "n_linked_glycan_sites", "count": 16 }, { "field": "o_linked_glycans", "count": 4 }, { "field": "o_linked_glycan_sites", "count": 7 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 8 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 8 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 140 }, { "field": "total_sites", "count": 14 }, { "field": "n_linked_glycans", "count": 74 }, { "field": "n_linked_glycan_sites", "count": 7 }, { "field": "o_linked_glycans", "count": 4 }, { "field": "o_linked_glycan_sites", "count": 7 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 33 }, { "field": "total_sites", "count": 29 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 10 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 23 }, { "field": "total_sites", "count": 19 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 173 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }