{ "uniprot_canonical_ac": "P00973-1", "uniprot_ac": "P00973", "uniprot_id": "OAS1_HUMAN", "mass": { "chemical_mass": 46029.0, "monoisotopic_mass": 46029.0 }, "refseq": { "ac": "NP_001027581", "name": "2'-5'-oligoadenylate synthase 1 isoform 3", "summary": "This interferon-induced gene encodes a protein that synthesizes 2',5'-oligoadenylates (2-5As). This protein plays a key role in innate cellular antiviral response, and has been implicated in other cellular processes like cell growth and apoptosis. Alternative splicing results in multiple transcript variants with different enzymatic activities. Polymorphisms in this gene have been associated with susceptibility to viral infection, including SARS-CoV-2, and diabetes mellitus, type 1. This gene is located in a cluster of related genes on chromosome 12. [provided by RefSeq, May 2022].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001027581" }, "gene_names": [ { "name": "OAS1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P00973", "id": "P00973" }, { "name": "E18/E16; IFI-4; IMD100; OIAS; OIASI", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001027581", "id": "NP_001027581" }, { "name": "OAS1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001027581", "id": "NP_001027581" }, { "name": "OIAS", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P00973", "id": "P00973" } ], "protein_names": [ { "name": "2'-5'-oligoadenylate synthase 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P00973" }, { "name": "(2-5')oligo(A) synthase 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P00973" }, { "name": "2'-5'-oligoadenylate synthase 1 isoform 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001027581", "id": "NP_001027581" }, { "name": "2-5A synthase 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P00973" }, { "name": "2.7.7.84", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P00973" }, { "name": "E16 (2'-5') oligo A synthetase; 2'-5'-oligoadenylate synthetase 1, 40/46kDa; 2'-5'-oligoisoadenylate synthetase 1; 2',5'-oligo A synthetase 1; 2-5A synthetase 1; 2'-5'-oligoadenylate synthase 1; 2-5A synthase 1; (2-5')oligo(A) synthase 1; 2'-5'-oligoadenylate synthase 1 isoform p42", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001027581", "id": "NP_001027581" }, { "name": "E18/E16", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P00973" }, { "name": "p46/p42 OAS", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P00973" } ], "function": [ { "annotation": "Elevation of H3K27me3 level contributes to the radioresistance of nasopharyngeal carcinoma by inhibiting OAS1 expression.", "evidence": [ { "database": "RefSeq", "id": "NP_001027581", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001027581" }, { "database": "PubMed", "id": "38009194", "url": "https://glygen.org/publication/PubMed/38009194" } ] }, { "annotation": "Features of Distribution of the Allelic Variant of the OAS1 Gene Associated with Severe Form of the Coronavirus Infection in the Russian and Global Populations.", "evidence": [ { "database": "RefSeq", "id": "NP_001027581", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001027581" }, { "database": "PubMed", "id": "38191878", "url": "https://glygen.org/publication/PubMed/38191878" } ] }, { "annotation": "Findings provide insights into the potential role of OAS1 polymorphisms in respiratory infection.", "evidence": [ { "database": "RefSeq", "id": "NP_001027581", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001027581" }, { "database": "PubMed", "id": "23220500", "url": "https://glygen.org/publication/PubMed/23220500" } ] }, { "annotation": "Interferon-induced, dsRNA-activated antiviral enzyme which plays a critical role in cellular innate antiviral response (PubMed:34581622). In addition, it may also play a role in other cellular processes such as apoptosis, cell growth, differentiation and gene regulation. Synthesizes higher oligomers of 2'-5'-oligoadenylates (2-5A) from ATP which then bind to the inactive monomeric form of ribonuclease L (RNase L) leading to its dimerization and subsequent activation. Activation of RNase L leads to degradation of cellular as well as viral RNA, resulting in the inhibition of protein synthesis, thus terminating viral replication (PubMed:34581622, PubMed:34145065). Can mediate the antiviral effect via the classical RNase L-dependent pathway or an alternative antiviral pathway independent of RNase L. The secreted form displays antiviral effect against vesicular stomatitis virus (VSV), herpes simplex virus type 2 (HSV-2), and encephalomyocarditis virus (EMCV) and stimulates the alternative antiviral pathway independent of RNase L.", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973#function" }, { "database": "PubMed", "id": "12799444", "url": "https://glygen.org/publication/PubMed/12799444" }, { "database": "PubMed", "id": "19923450", "url": "https://glygen.org/publication/PubMed/19923450" }, { "database": "PubMed", "id": "23319625", "url": "https://glygen.org/publication/PubMed/23319625" }, { "database": "PubMed", "id": "18931074", "url": "https://glygen.org/publication/PubMed/18931074" }, { "database": "PubMed", "id": "34581622", "url": "https://glygen.org/publication/PubMed/34581622" }, { "database": "PubMed", "id": "34145065", "url": "https://glygen.org/publication/PubMed/34145065" } ] }, { "annotation": "Not prenylated at C-terminal, is diffusely localized and unable to initiate a detectable block to SARS-CoV-2 replication.", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973#function" }, { "database": "PubMed", "id": "34581622", "url": "https://glygen.org/publication/PubMed/34581622" } ] }, { "annotation": "Sequence motifs in OAS1 regulate polyadenylation", "evidence": [ { "database": "RefSeq", "id": "NP_001027581", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001027581" }, { "database": "PubMed", "id": "12082089", "url": "https://glygen.org/publication/PubMed/12082089" } ] }, { "annotation": "The OAS1 p46 isoform localizes to the mitochondria. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001027581", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001027581" }, { "database": "PubMed", "id": "25205466", "url": "https://glygen.org/publication/PubMed/25205466" } ] }, { "annotation": "This genetic polymorphism makes OAS1 an excellent candidate for a human gene that influences host susceptibility to viral infection.", "evidence": [ { "database": "RefSeq", "id": "NP_001027581", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001027581" }, { "database": "PubMed", "id": "15732009", "url": "https://glygen.org/publication/PubMed/15732009" } ] }, { "annotation": "This interferon-induced gene encodes a protein that synthesizes 2',5'-oligoadenylates (2-5As). This protein plays a key role in innate cellular antiviral response, and has been implicated in other cellular processes like cell growth and apoptosis. Alternative splicing results in multiple transcript variants with different enzymatic activities. Polymorphisms in this gene have been associated with susceptibility to viral infection, including SARS-CoV-2, and diabetes mellitus, type 1. This gene is located in a cluster of related genes on chromosome 12. [provided by RefSeq, May 2022].", "evidence": [ { "database": "RefSeq", "id": "NP_001027581", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001027581" } ] }, { "annotation": "When prenylated at C-terminal, acts as a double-stranded RNA (dsRNA) sensor specifically targeted to membranous replicative organelles in SARS coronavirus-2/SARS-CoV-2 infected cells where it binds to dsRNA structures in the SARS-CoV-2 5'-UTR and initiates a potent block to SARS-CoV-2 replication. Recognizes short stretches of dsRNA and activates RNase L. The binding is remarkably specific, with two conserved stem loops in the SARS-CoV-2 5'- untranslated region (UTR) constituting the principal viral target (PubMed:34581622). The same mechanism is necessary to initiate a block to cardiovirus EMCV (PubMed:34581622).", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973#function" }, { "database": "PubMed", "id": "34581622", "url": "https://glygen.org/publication/PubMed/34581622" } ] } ], "disease": [ { "disease_id": "MONDO:0020840", "recommended_name": { "id": "MONDO:0020840", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0020840", "name": "pulmonary alveolar proteinosis with hypogammaglobulinemia", "description": "A primarily a lung disorder characterized by onset of respiratory insufficiency due to pulmonary alveolar proteinosis (PAP) in the first months of life. Affected individuals may have normal respiratory function at birth. Development of the disorder appears to be influenced or triggered by viral infection, manifest as progressive respiratory insufficiency, confluent consolidations on lung imaging, and diffuse collection of periodic acid-Schiff (PAS)-positive material in pulmonary alveoli associated with small and nonfoamy alveolar macrophages. Patients also have hypogammaglobulinemia, leukocytosis, and splenomegaly. Many patients die of respiratory failure in infancy or early childhood; hematopoietic stem cell transplantation (HSCT) is curative. The pathogenesis may be related to abnormal function of alveolar macrophages, resulting in decreased catabolism of surfactant. The disorder results from a gain-of-function effect that particularly affects B cells and monocytes." }, "synonyms": [ { "id": "MONDO:0020840", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0020840", "name": "PAPHG", "description": "" }, { "id": "MONDO:0020840", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0020840", "name": "immunodeficiency (due to OAS1 gain-of-function variant) with pulmonary alveolar proteinosis and hypogammaglobulinemia", "description": "" }, { "id": "MONDO:0020840", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0020840", "name": "pulmonary alveolar proteinosis with hypogammaglobulinemia", "description": "" }, { "id": "MIM:618042", "resource": "MIM", "url": "https://www.omim.org/entry/618042", "name": "Immunodeficiency 100 with pulmonary alveolar proteinosis and hypogammaglobulinemia", "description": "Immunodeficiency 100 with pulmonary alveolar proteinosis and hypogammaglobulinemia" } ], "evidence": [ { "id": "618042", "database": "MIM", "url": "https://www.omim.org/entry/618042" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 148, "end_pos": 148, "sequence_org": "D", "sequence_mut": "A", "comment": "Strongly reduced enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" }, { "database": "PubMed", "id": "23319625", "url": "https://glygen.org/publication/PubMed/23319625" } ] }, { "start_pos": 233, "end_pos": 233, "sequence_org": "E", "sequence_mut": "A", "comment": "Loss of enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" }, { "database": "PubMed", "id": "23319625", "url": "https://glygen.org/publication/PubMed/23319625" } ] }, { "start_pos": 331, "end_pos": 331, "sequence_org": "C", "sequence_mut": "A", "comment": "Loss of activity; when associated with A-332 and A-333.", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" }, { "database": "PubMed", "id": "9407111", "url": "https://glygen.org/publication/PubMed/9407111" } ] }, { "start_pos": 332, "end_pos": 332, "sequence_org": "F", "sequence_mut": "A", "comment": "Loss of activity; when associated with A-331 and A-333.", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" }, { "database": "PubMed", "id": "9407111", "url": "https://glygen.org/publication/PubMed/9407111" } ] }, { "start_pos": 333, "end_pos": 333, "sequence_org": "K", "sequence_mut": "A", "comment": "Loss of activity; when associated with A-331 and A-332.", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" }, { "database": "PubMed", "id": "9407111", "url": "https://glygen.org/publication/PubMed/9407111" } ] }, { "start_pos": 397, "end_pos": 397, "sequence_org": "C", "sequence_mut": "A", "comment": "Not prenylated and diffusely distributed. Loss of antiviral activity.", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" }, { "database": "PubMed", "id": "34581622", "url": "https://glygen.org/publication/PubMed/34581622" } ] }, { "start_pos": 66, "end_pos": 66, "sequence_org": "K", "sequence_mut": "A", "comment": "Decreased enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" }, { "database": "PubMed", "id": "23319625", "url": "https://glygen.org/publication/PubMed/23319625" } ] }, { "start_pos": 75, "end_pos": 75, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of activity; when associated with A-77.", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" }, { "database": "PubMed", "id": "10464285", "url": "https://glygen.org/publication/PubMed/10464285" }, { "database": "PubMed", "id": "25775560", "url": "https://glygen.org/publication/PubMed/25775560" } ] }, { "start_pos": 77, "end_pos": 77, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of activity; when associated with A-75.", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" }, { "database": "PubMed", "id": "10464285", "url": "https://glygen.org/publication/PubMed/10464285" }, { "database": "PubMed", "id": "25775560", "url": "https://glygen.org/publication/PubMed/25775560" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "77.69", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000089127", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000089127" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "85.76", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000089127", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000089127" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "84.9", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000089127", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000089127" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000089127", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000089127" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "87.84", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000089127", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000089127" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "96.05", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000089127", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000089127" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "70.44", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000089127", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000089127" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "86", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000089127", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000089127" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "74.19", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000089127", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000089127" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "56.67", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000089127", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000089127" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "82.69", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000089127", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000089127" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "81.49", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000089127", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000089127" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "85.16", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000089127", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000089127" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P00973", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00973" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P00973", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00973" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P00973", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00973" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P00973", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00973" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P00973", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00973" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P00973", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00973" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P00973", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00973" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P00973", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00973" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P00973", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00973" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P00973", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00973" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P00973", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00973" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P00973", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00973" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "common_name": "Human" } ], "gene": [ { "name": "OAS1", "url": "https://www.uniprot.org/uniprot/P00973", "locus": { "chromosome": "12", "start_pos": 112933219, "end_pos": 112905856, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000089127", "url": "https://www.ensembl.org/id/ENSG00000089127" } ] } } ], "crossref": [ { "id": "ENSG00000089127", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000089127", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "2.7.7.84", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.7.7.84&UniProtAcc=P00973", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd05400", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05400", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "OAS1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=OAS1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "4938", "url": "https://www.ncbi.nlm.nih.gov/gene/4938", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "8086", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=8086", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P00973", "url": "https://www.ebi.ac.uk/intact/interactors/id:P00973*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002934", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002934", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006116", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006116", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006117", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006117", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018952", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018952", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043518", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043518", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043519", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043519", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:4938", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:4938", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "164350", "url": "http://www.omim.org/entry/164350", "database": "MIM", "categories": [ "Other" ] }, { "id": "618042", "url": "http://www.omim.org/entry/618042", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P00973", "url": "https://www.nextprot.org/entry/NX_P00973", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "VHIISTF", "url": "https://omabrowser.org/oma/group/VHIISTF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4638494at2759", "url": "http://www.orthodb.org/?query=4638494at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11258", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11258", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11258:SF13", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11258:SF13", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "4IG8", "url": "https://www.rcsb.org/structure/4IG8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF01909", "url": "http://pfam.xfam.org/family/PF01909", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF10421", "url": "http://pfam.xfam.org/family/PF10421", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P00973", "url": "https://pharos.nih.gov/targets/P00973", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P00973", "url": "http://purl.obolibrary.org/obo/PR_P00973", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8983711", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8983711", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001027581", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001027581", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "34407", "url": "https://www.rhea-db.org/rhea/34407", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A6Q8PHR1", "url": "https://www.uniprot.org/uniprot/A0A6Q8PHR1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A6Q8PHR1-1", "url": "https://www.uniprot.org/uniprot/A0A6Q8PHR1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0T854", "url": "https://www.uniprot.org/uniprot/A0A7P0T854", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0T854-1", "url": "https://www.uniprot.org/uniprot/A0A7P0T854-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0T879", "url": "https://www.uniprot.org/uniprot/A0A7P0T879", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0T879-1", "url": "https://www.uniprot.org/uniprot/A0A7P0T879-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0T8E1", "url": "https://www.uniprot.org/uniprot/A0A7P0T8E1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0T8E1-1", "url": "https://www.uniprot.org/uniprot/A0A7P0T8E1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0T8F9", "url": "https://www.uniprot.org/uniprot/A0A7P0T8F9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0T8F9-1", "url": "https://www.uniprot.org/uniprot/A0A7P0T8F9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0T960", "url": "https://www.uniprot.org/uniprot/A0A7P0T960", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0T960-1", "url": "https://www.uniprot.org/uniprot/A0A7P0T960-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0T9J4", "url": "https://www.uniprot.org/uniprot/A0A7P0T9J4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0T9J4-1", "url": "https://www.uniprot.org/uniprot/A0A7P0T9J4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0T9Q4", "url": "https://www.uniprot.org/uniprot/A0A7P0T9Q4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0T9Q4-1", "url": "https://www.uniprot.org/uniprot/A0A7P0T9Q4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0TAY6", "url": "https://www.uniprot.org/uniprot/A0A7P0TAY6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0TAY6-1", "url": "https://www.uniprot.org/uniprot/A0A7P0TAY6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0TB35", "url": "https://www.uniprot.org/uniprot/A0A7P0TB35", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0TB35-1", "url": "https://www.uniprot.org/uniprot/A0A7P0TB35-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0TBG0", "url": "https://www.uniprot.org/uniprot/A0A7P0TBG0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0TBG0-1", "url": "https://www.uniprot.org/uniprot/A0A7P0TBG0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0Z444", "url": "https://www.uniprot.org/uniprot/A0A7P0Z444", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0Z444-1", "url": "https://www.uniprot.org/uniprot/A0A7P0Z444-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0Z4B6", "url": "https://www.uniprot.org/uniprot/A0A7P0Z4B6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0Z4B6-1", "url": "https://www.uniprot.org/uniprot/A0A7P0Z4B6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0Z4N8", "url": "https://www.uniprot.org/uniprot/A0A7P0Z4N8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0Z4N8-1", "url": "https://www.uniprot.org/uniprot/A0A7P0Z4N8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B4DWE7", "url": "https://www.uniprot.org/uniprot/B4DWE7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B4DWE7-1", "url": "https://www.uniprot.org/uniprot/B4DWE7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8VPW7", "url": "https://www.uniprot.org/uniprot/F8VPW7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8VPW7-1", "url": "https://www.uniprot.org/uniprot/F8VPW7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8VUC8", "url": "https://www.uniprot.org/uniprot/F8VUC8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8VUC8-1", "url": "https://www.uniprot.org/uniprot/F8VUC8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YIB8", "url": "https://www.uniprot.org/uniprot/H0YIB8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YIB8-1", "url": "https://www.uniprot.org/uniprot/H0YIB8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P00973-1", "url": "https://www.uniprot.org/uniprot/P00973-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P00973-2", "url": "https://www.uniprot.org/uniprot/P00973-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P00973-3", "url": "https://www.uniprot.org/uniprot/P00973-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P00973-4", "url": "https://www.uniprot.org/uniprot/P00973-4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "S4R3A5", "url": "https://www.uniprot.org/uniprot/S4R3A5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "S4R3A5-1", "url": "https://www.uniprot.org/uniprot/S4R3A5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "S4R467", "url": "https://www.uniprot.org/uniprot/S4R467", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "S4R467-1", "url": "https://www.uniprot.org/uniprot/S4R467-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL", "length": 400, "header": "sp|P00973-1|OAS1_HUMAN Isoform 1 of 2'-5'-oligoadenylate synthase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=4 CANONICAL=P00973-1" }, "isoforms": [ { "isoform_ac": "A0A6Q8PHR1-1", "url": "", "sequence": { "sequence": "MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALAHRGVHRPAERGRVLHLLHRTTERLPEAAPHQAQEPHPPSQALVPKCMALPPGLCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLVRPPASSLPFIPAPLHEA", "length": 356, "header": "tr|A0A6Q8PHR1-1|OAS1_HUMAN Computationally mapped isoform of 2'-5'-oligoadenylate synthase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=1 CANONICAL=P00973-1" }, "locus": { "chromosome": "12", "start_pos": 112917754, "end_pos": 112907040, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000675868.2", "url": "https://www.ensembl.org/id/ENST00000675868.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000502804.1", "url": "https://www.ensembl.org/id/ENSP00000502804.1" } ] } }, { "isoform_ac": "A0A7P0T854-1", "url": "", "sequence": { "sequence": "MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLLQCRKTP", "length": 353, "header": "tr|A0A7P0T854-1|OAS1_HUMAN Computationally mapped isoform of 2'-5'-oligoadenylate synthase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=1 CANONICAL=P00973-1" }, "locus": { "chromosome": "12", "start_pos": 112919359, "end_pos": 112907040, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000680659.1", "url": "https://www.ensembl.org/id/ENST00000680659.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504942.1", "url": "https://www.ensembl.org/id/ENSP00000504942.1" } ] } }, { "isoform_ac": "A0A7P0T879-1", "url": "", "sequence": { "sequence": "MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLMRQRLREAESNSADDETDDPRRYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL", "length": 407, "header": "tr|A0A7P0T879-1|OAS1_HUMAN Computationally mapped isoform of 2'-5'-oligoadenylate synthase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=1 CANONICAL=P00973-1" }, "locus": { "chromosome": "12", "start_pos": 112919550, "end_pos": 112907040, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000679987.1", "url": "https://www.ensembl.org/id/ENST00000679987.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504970.1", "url": "https://www.ensembl.org/id/ENSP00000504970.1" } ] } }, { "isoform_ac": "A0A7P0T8E1-1", "url": "", "sequence": { "sequence": "MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRLKATVQTMRPTIPGGIRNMVTLEHMSTLISLIDPAHSRQHPPHRQKRTGPAPSSECQCILGERAPVLSGPVPSFSGGTLDPERTKLLSELVYNPGQNPGLLTPGLLCPLSYHR", "length": 408, "header": "tr|A0A7P0T8E1-1|OAS1_HUMAN Computationally mapped isoform of 2'-5'-oligoadenylate synthase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=1 CANONICAL=P00973-1" }, "locus": { "chromosome": "12", "start_pos": 112919728, "end_pos": 112907040, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000679494.1", "url": "https://www.ensembl.org/id/ENST00000679494.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000505090.1", "url": "https://www.ensembl.org/id/ENSP00000505090.1" } ] } }, { "isoform_ac": "A0A7P0T8F9-1", "url": "", "sequence": { "sequence": "MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL", "length": 242, "header": "tr|A0A7P0T8F9-1|OAS1_HUMAN Computationally mapped isoform of 2'-5'-oligoadenylate synthase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=1 CANONICAL=P00973-1" }, "locus": { "chromosome": "12", "start_pos": 112919550, "end_pos": 112907040, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000680455.1", "url": "https://www.ensembl.org/id/ENST00000680455.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000505165.1", "url": "https://www.ensembl.org/id/ENSP00000505165.1" } ] } }, { "isoform_ac": "A0A7P0T960-1", "url": "", "sequence": { "sequence": "MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALV", "length": 157, "header": "tr|A0A7P0T960-1|OAS1_HUMAN Computationally mapped isoform of 2'-5'-oligoadenylate synthase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=1 CANONICAL=P00973-1" }, "locus": { "chromosome": "12", "start_pos": 112916510, "end_pos": 112907040, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000679767.1", "url": "https://www.ensembl.org/id/ENST00000679767.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000505476.1", "url": "https://www.ensembl.org/id/ENSP00000505476.1" } ] } }, { "isoform_ac": "A0A7P0T9J4-1", "url": "", "sequence": { "sequence": "MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALAHRGVHRPAERGRVLHLLHRTTERLPEAAPHQAQEPHPPSQALVPK", "length": 202, "header": "tr|A0A7P0T9J4-1|OAS1_HUMAN Computationally mapped isoform of 2'-5'-oligoadenylate synthase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=1 CANONICAL=P00973-1" }, "locus": { "chromosome": "12", "start_pos": 112911235, "end_pos": 112907040, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000679841.1", "url": "https://www.ensembl.org/id/ENST00000679841.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000505725.1", "url": "https://www.ensembl.org/id/ENSP00000505725.1" } ] } }, { "isoform_ac": "A0A7P0T9Q4-1", "url": "", "sequence": { "sequence": "MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLTQHTPGSIHPTGRRGLDLHHPLNASASWGKGLQCYLDQFLHFQVGLLIQRGQSSSVSWCIIQDRTQVS", "length": 256, "header": "tr|A0A7P0T9Q4-1|OAS1_HUMAN Computationally mapped isoform of 2'-5'-oligoadenylate synthase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=1 CANONICAL=P00973-1" }, "locus": { "chromosome": "12", "start_pos": 112919690, "end_pos": 112907040, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000679971.1", "url": "https://www.ensembl.org/id/ENST00000679971.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000505786.1", "url": "https://www.ensembl.org/id/ENSP00000505786.1" } ] } }, { "isoform_ac": "A0A7P0TAY6-1", "url": "", "sequence": { "sequence": "MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALVDWRL", "length": 161, "header": "tr|A0A7P0TAY6-1|OAS1_HUMAN Computationally mapped isoform of 2'-5'-oligoadenylate synthase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=1 CANONICAL=P00973-1" }, "locus": { "chromosome": "12", "start_pos": 112911069, "end_pos": 112907040, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000680522.1", "url": "https://www.ensembl.org/id/ENST00000680522.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000506485.1", "url": "https://www.ensembl.org/id/ENSP00000506485.1" } ] } }, { "isoform_ac": "A0A7P0TB35-1", "url": "", "sequence": { "sequence": "MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNVWPSHQACVRRSLGSCHLSMPWSS", "length": 242, "header": "tr|A0A7P0TB35-1|OAS1_HUMAN Computationally mapped isoform of 2'-5'-oligoadenylate synthase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=1 CANONICAL=P00973-1" }, "locus": { "chromosome": "12", "start_pos": 112916557, "end_pos": 112907040, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000680919.1", "url": "https://www.ensembl.org/id/ENST00000680919.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000506474.1", "url": "https://www.ensembl.org/id/ENSP00000506474.1" } ] } }, { "isoform_ac": "A0A7P0TBG0-1", "url": "", "sequence": { "sequence": "MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALDFARTGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL", "length": 405, "header": "tr|A0A7P0TBG0-1|OAS1_HUMAN Computationally mapped isoform of 2'-5'-oligoadenylate synthase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=1 CANONICAL=P00973-1" }, "locus": { "chromosome": "12", "start_pos": 112919550, "end_pos": 112907040, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000679467.1", "url": "https://www.ensembl.org/id/ENST00000679467.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000506593.1", "url": "https://www.ensembl.org/id/ENSP00000506593.1" } ] } }, { "isoform_ac": "A0A7P0Z444-1", "url": "", "sequence": { "sequence": "MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPSTLQAASTPQAEEDWTCTIL", "length": 316, "header": "tr|A0A7P0Z444-1|OAS1_HUMAN Computationally mapped isoform of 2'-5'-oligoadenylate synthase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=1 CANONICAL=P00973-1" }, "locus": { "chromosome": "12", "start_pos": 112919550, "end_pos": 112907040, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000680934.1", "url": "https://www.ensembl.org/id/ENST00000680934.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000505028.1", "url": "https://www.ensembl.org/id/ENSP00000505028.1" } ] } }, { "isoform_ac": "A0A7P0Z4B6-1", "url": "", "sequence": { "sequence": "MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL", "length": 371, "header": "tr|A0A7P0Z4B6-1|OAS1_HUMAN Computationally mapped isoform of 2'-5'-oligoadenylate synthase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=1 CANONICAL=P00973-1" }, "locus": { "chromosome": "12", "start_pos": 112919550, "end_pos": 112907040, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000681228.1", "url": "https://www.ensembl.org/id/ENST00000681228.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000505703.1", "url": "https://www.ensembl.org/id/ENSP00000505703.1" } ] } }, { "isoform_ac": "A0A7P0Z4N8-1", "url": "", "sequence": { "sequence": "MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALAHRGVHRPAERGRVLHLLHRTTERLPEAAPHQAQEPHPPSQALVPKCMALPPGLCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL", "length": 392, "header": "tr|A0A7P0Z4N8-1|OAS1_HUMAN Computationally mapped isoform of 2'-5'-oligoadenylate synthase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=1 CANONICAL=P00973-1" }, "locus": { "chromosome": "12", "start_pos": 112919550, "end_pos": 112907040, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000681700.1", "url": "https://www.ensembl.org/id/ENST00000681700.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000506580.1", "url": "https://www.ensembl.org/id/ENSP00000506580.1" } ] } }, { "isoform_ac": "B4DWE7-1", "url": "", "sequence": { "sequence": "MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALAHRGVHRPAERGRVLHLLHRTTERLPEAAPHQAQEPHPPSQALVPKL", "length": 203, "header": "tr|B4DWE7-1|OAS1_HUMAN Computationally mapped isoform of 2'-5'-oligoadenylate synthase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=1 CANONICAL=P00973-1" }, "locus": { "chromosome": "12", "start_pos": 112916510, "end_pos": 112907040, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000681505.1", "url": "https://www.ensembl.org/id/ENST00000681505.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000505794.1", "url": "https://www.ensembl.org/id/ENSP00000505794.1" } ] } }, { "isoform_ac": "F8VPW7-1", "url": "", "sequence": { "sequence": "MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRYAIPTWLSSPM", "length": 306, "header": "tr|F8VPW7-1|OAS1_HUMAN Computationally mapped isoform of 2'-5'-oligoadenylate synthase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=2 CANONICAL=P00973-1" }, "locus": { "chromosome": "12", "start_pos": 112916772, "end_pos": 112907040, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000550883.2", "url": "https://www.ensembl.org/id/ENST00000550883.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000450286.2", "url": "https://www.ensembl.org/id/ENSP00000450286.2" } ] } }, { "isoform_ac": "F8VUC8-1", "url": "", "sequence": { "sequence": "MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGESSQLLFLPLPISEQKSPTV", "length": 177, "header": "tr|F8VUC8-1|OAS1_HUMAN Computationally mapped isoform of 2'-5'-oligoadenylate synthase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=1 CANONICAL=P00973-1" }, "locus": { "chromosome": "12", "start_pos": 112908886, "end_pos": 112907040, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000553185.2", "url": "https://www.ensembl.org/id/ENST00000553185.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000448001.1", "url": "https://www.ensembl.org/id/ENSP00000448001.1" } ] } }, { "isoform_ac": "H0YIB8-1", "url": "", "sequence": { "sequence": "MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLMRQRLREVRSLAQGHQLTSGGNGIQAQWTLKPVLMSLC", "length": 384, "header": "tr|H0YIB8-1|OAS1_HUMAN Computationally mapped isoform of 2'-5'-oligoadenylate synthase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=2 CANONICAL=P00973-1" }, "locus": { "chromosome": "12", "start_pos": 112918710, "end_pos": 112907040, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000553152.2", "url": "https://www.ensembl.org/id/ENST00000553152.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000449053.2", "url": "https://www.ensembl.org/id/ENSP00000449053.2" } ] } }, { "isoform_ac": "P00973-1", "url": "", "sequence": { "sequence": "MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL", "length": 400, "header": "sp|P00973-1|OAS1_HUMAN Isoform 1 of 2'-5'-oligoadenylate synthase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=4 CANONICAL=P00973-1" }, "locus": { "chromosome": "12", "start_pos": 112919550, "end_pos": 112907040, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000681934.1", "url": "https://www.ensembl.org/id/ENST00000681934.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000505482.1", "url": "https://www.ensembl.org/id/ENSP00000505482.1" } ] } }, { "isoform_ac": "P00973-2", "url": "", "sequence": { "sequence": "MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLVRPPASSLPFIPAPLHEA", "length": 364, "header": "sp|P00973-2|OAS1_HUMAN Isoform 2 of 2'-5'-oligoadenylate synthase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=4 CANONICAL=P00973-1" }, "locus": { "chromosome": "12", "start_pos": 112917754, "end_pos": 112907040, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000452357.7", "url": "https://www.ensembl.org/id/ENST00000452357.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000415721.2", "url": "https://www.ensembl.org/id/ENSP00000415721.2" } ] } }, { "isoform_ac": "P00973-3", "url": "", "sequence": { "sequence": "MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLTQHTPGSIHPTGRRGLDLHHPLNASASWGKGLQCYLDQFLHFQVGLLIQRGQSSSVSWCIIQDRTQVS", "length": 414, "header": "sp|P00973-3|OAS1_HUMAN Isoform 3 of 2'-5'-oligoadenylate synthase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=4 CANONICAL=P00973-1" }, "locus": { "chromosome": "12", "start_pos": 112919690, "end_pos": 112907040, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000445409.7", "url": "https://www.ensembl.org/id/ENST00000445409.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000388001.2", "url": "https://www.ensembl.org/id/ENSP00000388001.2" } ] } }, { "isoform_ac": "P00973-4", "url": "", "sequence": { "sequence": "MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLVNLTLVGRRNYTNN", "length": 360, "header": "sp|P00973-4|OAS1_HUMAN Isoform 4 of 2'-5'-oligoadenylate synthase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=4 CANONICAL=P00973-1" }, "locus": { "chromosome": "12", "start_pos": 112931919, "end_pos": 112907040, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000551241.6", "url": "https://www.ensembl.org/id/ENST00000551241.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000448790.1", "url": "https://www.ensembl.org/id/ENSP00000448790.1" } ] } }, { "isoform_ac": "S4R3A5-1", "url": "", "sequence": { "sequence": "MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLTQHTPGSIHPTGRRGLDLHHPLNASASWGKGLQCYLDQFLHFQVNLTLVGRRNYTNN", "length": 403, "header": "tr|S4R3A5-1|OAS1_HUMAN Computationally mapped isoform of 2'-5'-oligoadenylate synthase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=2 CANONICAL=P00973-1" }, "locus": { "chromosome": "12", "start_pos": 112931919, "end_pos": 112907040, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000540589.3", "url": "https://www.ensembl.org/id/ENST00000540589.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000474083.2", "url": "https://www.ensembl.org/id/ENSP00000474083.2" } ] } }, { "isoform_ac": "S4R467-1", "url": "", "sequence": { "sequence": "MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRR", "length": 361, "header": "tr|S4R467-1|OAS1_HUMAN Computationally mapped isoform of 2'-5'-oligoadenylate synthase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=1 CANONICAL=P00973-1" }, "locus": { "chromosome": "12", "start_pos": 112931878, "end_pos": 112907040, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000552526.2", "url": "https://www.ensembl.org/id/ENST00000552526.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000475139.2", "url": "https://www.ensembl.org/id/ENSP00000475139.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Inhibition of transforming growth factor-beta/SMAD signalling by the interferon-gamma/STAT pathway.", "journal": "Nature", "date": "1999", "authors": "Ulloa L, Doody J, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "10067896", "url": "https://glygen.org/publication/PubMed/10067896" } ] }, { "title": "Determination of residues involved in ligand binding and signal transmission in the human IFN-alpha receptor 2.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Chuntharapai A, Gibbs V, Lu J, Ow A, Marsters S, Ashkenazi A, De Vos A, Jin Kim K", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "10395669", "url": "https://glygen.org/publication/PubMed/10395669" } ] }, { "title": "The nature of the catalytic domain of 2'-5'-oligoadenylate synthetases.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Sarkar SN, Ghosh A, Wang HW, Sung SS, Sen GC", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" }, { "database": "Reactome", "id": "R-HSA-8983711", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8983711" } ], "reference": [ { "type": "PubMed", "id": "10464285", "url": "https://glygen.org/publication/PubMed/10464285" } ] }, { "title": "Catalytically active TYK2 is essential for interferon-beta-mediated phosphorylation of STAT3 and interferon-alpha receptor-1 (IFNAR-1) but not for activation of phosphoinositol 3-kinase.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Rani MR, Leaman DW, Han Y, Leung S, Croze E, Fish EN, Wolfman A, Ransohoff RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "10542297", "url": "https://glygen.org/publication/PubMed/10542297" } ] }, { "title": "Regulation of STAT1 nuclear export by Jak1.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Mowen K, David M", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "10982844", "url": "https://glygen.org/publication/PubMed/10982844" } ] }, { "title": "Observation of an unexpected third receptor molecule in the crystal structure of human interferon-gamma receptor complex.", "journal": "Structure (London, England : 1993)", "date": "2000", "authors": "Thiel DJ, le Du MH, Walter RL, D'Arcy A, Chene C, Fountoulakis M, Garotta G, Winkler FK, Ealick SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "10986460", "url": "https://glygen.org/publication/PubMed/10986460" } ] }, { "title": "Gene structure and function of the 2'-5'-oligoadenylate synthetase family.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2000", "authors": "Justesen J, Hartmann R, Kjeldgaard NO", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "11092454", "url": "https://glygen.org/publication/PubMed/11092454" } ] }, { "title": "The 2-5A/RNase L pathway and inhibition by RNase L inhibitor (RLI).", "journal": "Methods in molecular biology (Clifton, N.J.)", "date": "2001", "authors": "Bisbal C, Salehzada T, Silhol M, Martinand C, Le Roy F, Lebleu B", "evidence": [ { "database": "Reactome", "id": "R-HSA-8983711", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8983711" } ], "reference": [ { "type": "PubMed", "id": "11265282", "url": "https://glygen.org/publication/PubMed/11265282" } ] }, { "title": "Inositol hexakisphosphate kinase 2 mediates growth suppressive and apoptotic effects of interferon-beta in ovarian carcinoma cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Morrison BH, Bauer JA, Kalvakolanu DV, Lindner DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "11337497", "url": "https://glygen.org/publication/PubMed/11337497" } ] }, { "title": "Effect of early interferon treatment on conversion to definite multiple sclerosis: a randomised study.", "journal": "Lancet (London, England)", "date": "2001", "authors": "Comi G, Filippi M, Barkhof F, Durelli L, Edan G, Fernandez O, Hartung H, Seeldrayers P, Sorensen PS, Rovaris M, Martinelli V, Hommes OR", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "11377645", "url": "https://glygen.org/publication/PubMed/11377645" } ] }, { "title": "Functional classification of interferon-stimulated genes identified using microarrays.", "journal": "Journal of leukocyte biology", "date": "2001", "authors": "de Veer MJ, Holko M, Frevel M, Walker E, Der S, Paranjape JM, Silverman RH, Williams BR", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "11404376", "url": "https://glygen.org/publication/PubMed/11404376" } ] }, { "title": "The 2-5A/RNase L/RNase L inhibitor (RLI) [correction of (RNI)] pathway regulates mitochondrial mRNAs stability in interferon alpha-treated H9 cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Le Roy F, Bisbal C, Silhol M, Martinand C, Lebleu B, Salehzada T", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "11585831", "url": "https://glygen.org/publication/PubMed/11585831" } ] }, { "title": "Requirement of Ca2+ and CaMKII for Stat1 Ser-727 phosphorylation in response to IFN-gamma.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Nair JS, DaFonseca CJ, Tjernberg A, Sun W, Darnell JE Jr, Chait BT, Zhang JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "11972023", "url": "https://glygen.org/publication/PubMed/11972023" } ] }, { "title": "2'-5' Oligoadenylate synthetase plays a critical role in interferon-gamma inhibition of respiratory syncytial virus infection of human epithelial cells.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Behera AK, Kumar M, Lockey RF, Mohapatra SS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8983711", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8983711" } ], "reference": [ { "type": "PubMed", "id": "11980899", "url": "https://glygen.org/publication/PubMed/11980899" } ] }, { "title": "Identification of the substrate-binding sites of 2'-5'-oligoadenylate synthetase.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Sarkar SN, Miyagi M, Crabb JW, Sen GC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8983711", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8983711" } ], "reference": [ { "type": "PubMed", "id": "11986302", "url": "https://glygen.org/publication/PubMed/11986302" } ] }, { "title": "Identification of X-linked inhibitor of apoptosis-associated factor-1 as an interferon-stimulated gene that augments TRAIL Apo2L-induced apoptosis.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Leaman DW, Chawla-Sarkar M, Vyas K, Reheman M, Tamai K, Toji S, Borden EC", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "12029096", "url": "https://glygen.org/publication/PubMed/12029096" } ] }, { "title": "A road map for those who don't know JAK-STAT.", "journal": "Science (New York, N.Y.)", "date": "2002", "authors": "Aaronson DS, Horvath CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "12040185", "url": "https://glygen.org/publication/PubMed/12040185" } ] }, { "title": "The cleavage/polyadenylation activity triggered by a U-rich motif sequence is differently required depending on the poly(A) site location at either the first or last 3'-terminal exon of the 2'-5' oligo(A) synthetase gene.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Aissouni Y, Perez C, Calmels B, Benech PD", "evidence": [ { "database": "RefSeq", "id": "NP_001027581", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001027581" } ], "reference": [ { "type": "PubMed", "id": "12082089", "url": "https://glygen.org/publication/PubMed/12082089" } ] }, { "title": "Seeing the light: preassembly and ligand-induced changes of the interferon gamma receptor complex in cells.", "journal": "Molecular & cellular proteomics : MCP", "date": "2002", "authors": "Krause CD, Mei E, Xie J, Jia Y, Bopp MA, Hochstrasser RM, Pestka S", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "12438563", "url": "https://glygen.org/publication/PubMed/12438563" } ] }, { "title": "Y-box-binding protein YB-1 mediates transcriptional repression of human alpha 2(I) collagen gene expression by interferon-gamma.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Higashi K, Inagaki Y, Suzuki N, Mitsui S, Mauviel A, Kaneko H, Nakatsuka I", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "12446674", "url": "https://glygen.org/publication/PubMed/12446674" } ] }, { "title": "Apoptosis and interferons: role of interferon-stimulated genes as mediators of apoptosis.", "journal": "Apoptosis : an international journal on programmed cell death", "date": "2003", "authors": "Chawla-Sarkar M, Lindner DJ, Liu YF, Williams BR, Sen GC, Silverman RH, Borden EC", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "12766484", "url": "https://glygen.org/publication/PubMed/12766484" } ] }, { "title": "Characterization of the 2'-5'-oligoadenylate synthetase ubiquitin-like family.", "journal": "Nucleic acids research", "date": "2003", "authors": "Eskildsen S, Justesen J, Schierup MH, Hartmann R", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "reference": [ { "type": "PubMed", "id": "12799444", "url": "https://glygen.org/publication/PubMed/12799444" } ] }, { "title": "The human type I interferon receptor: NMR structure reveals the molecular basis of ligand binding.", "journal": "Structure (London, England : 1993)", "date": "2003", "authors": "Chill JH, Quadt SR, Levy R, Schreiber G, Anglister J", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "12842042", "url": "https://glygen.org/publication/PubMed/12842042" } ] }, { "title": "The ins and outs of STAT1 nuclear transport.", "journal": "Science's STKE : signal transduction knowledge environment", "date": "2003", "authors": "McBride KM, Reich NC", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "12915721", "url": "https://glygen.org/publication/PubMed/12915721" } ] }, { "title": "Stoichiometry of interaction between interferon gamma and its receptor.", "journal": "European journal of biochemistry", "date": "1992", "authors": "Fountoulakis M, Zulauf M, Lustig A, Garotta G", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "1396683", "url": "https://glygen.org/publication/PubMed/1396683" } ] }, { "title": "Interferon-gamma suppresses transforming growth factor-beta-induced invasion of gastric carcinoma cells through cross-talk of Smad pathway in a three-dimensional culture model.", "journal": "Oncogene", "date": "2003", "authors": "Kuga H, Morisaki T, Nakamura K, Onishi H, Noshiro H, Uchiyama A, Tanaka M, Katano M", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "14586410", "url": "https://glygen.org/publication/PubMed/14586410" } ] }, { "title": "Interferon-gamma inhibits transforming growth factor-beta production in human airway epithelial cells by targeting Smads.", "journal": "American journal of respiratory cell and molecular biology", "date": "2004", "authors": "Wen FQ, Liu X, Kobayashi T, Abe S, Fang Q, Kohyama T, Ertl R, Terasaki Y, Manouilova L, Rennard SI", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "14722222", "url": "https://glygen.org/publication/PubMed/14722222" } ] }, { "title": "Novel growth and death related interferon-stimulated genes (ISGs) in melanoma: greater potency of IFN-beta compared with IFN-alpha2.", "journal": "Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research", "date": "2003", "authors": "Leaman DW, Chawla-Sarkar M, Jacobs B, Vyas K, Sun Y, Ozdemir A, Yi T, Williams BR, Borden EC", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "14769151", "url": "https://glygen.org/publication/PubMed/14769151" } ] }, { "title": "Human MxA protein inhibits the replication of Crimean-Congo hemorrhagic fever virus.", "journal": "Journal of virology", "date": "2004", "authors": "Andersson I, Bladh L, Mousavi-Jazi M, Magnusson KE, Lundkvist A, Haller O, Mirazimi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "15047845", "url": "https://glygen.org/publication/PubMed/15047845" } ] }, { "title": "Transcriptional induction of IFN-gamma-responsive genes is modulated by DNA surrounding the interferon stimulation response element.", "journal": "Nucleic acids research", "date": "1992", "authors": "Strehlow I, Decker T", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "1508672", "url": "https://glygen.org/publication/PubMed/1508672" } ] }, { "title": "Autophosphorylation of JAK2 on tyrosines 221 and 570 regulates its activity.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Argetsinger LS, Kouadio JL, Steen H, Stensballe A, Jensen ON, Carter-Su C", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "15143187", "url": "https://glygen.org/publication/PubMed/15143187" } ] }, { "title": "Identification of 2'-phosphodiesterase, which plays a role in the 2-5A system regulated by interferon.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Kubota K, Nakahara K, Ohtsuka T, Yoshida S, Kawaguchi J, Fujita Y, Ozeki Y, Hara A, Yoshimura C, Furukawa H, Haruyama H, Ichikawa K, Yamashita M, Matsuoka T, Iijima Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8983711", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8983711" } ], "reference": [ { "type": "PubMed", "id": "15231837", "url": "https://glygen.org/publication/PubMed/15231837" } ] }, { "title": "Ligand-induced assembling of the type I interferon receptor on supported lipid bilayers.", "journal": "Journal of molecular biology", "date": "2004", "authors": "Lamken P, Lata S, Gavutis M, Piehler J", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "15312780", "url": "https://glygen.org/publication/PubMed/15312780" } ] }, { "title": "Protein kinase Cdelta regulates apoptosis via activation of STAT1.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "DeVries TA, Kalkofen RL, Matassa AA, Reyland ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "15322115", "url": "https://glygen.org/publication/PubMed/15322115" } ] }, { "title": "Three-dimensional structures of a humanized anti-IFN-gamma Fab (HuZAF) in two crystal forms.", "journal": "Acta crystallographica. Section D, Biological crystallography", "date": "2004", "authors": "Bourne PC, Terzyan SS, Cloud G, Landolfi NF, Vasquez M, Edmundson AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "15388922", "url": "https://glygen.org/publication/PubMed/15388922" } ] }, { "title": "Identification of residues of the IFNAR1 chain of the type I human interferon receptor critical for ligand binding and biological activity.", "journal": "Biochemistry", "date": "2004", "authors": "Cajean-Feroldi C, Nosal F, Nardeux PC, Gallet X, Guymarho J, Baychelier F, Sempe P, Tovey MG, Escary JL, Eid P", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "15449939", "url": "https://glygen.org/publication/PubMed/15449939" } ] }, { "title": "Determination of the transphosphorylation sites of Jak2 kinase.", "journal": "Biochemical and biophysical research communications", "date": "2004", "authors": "Matsuda T, Feng J, Witthuhn BA, Sekine Y, Ihle JN", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "15530433", "url": "https://glygen.org/publication/PubMed/15530433" } ] }, { "title": "Variation in antiviral 2',5'-oligoadenylate synthetase (2'5'AS) enzyme activity is controlled by a single-nucleotide polymorphism at a splice-acceptor site in the OAS1 gene.", "journal": "American journal of human genetics", "date": "2005", "authors": "Bonnevie-Nielsen V, Field LL, Lu S, Zheng DJ, Li M, Martensen PM, Nielsen TB, Beck-Nielsen H, Lau YL, Pociot F", "evidence": [ { "database": "RefSeq", "id": "NP_001027581", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001027581" } ], "reference": [ { "type": "PubMed", "id": "15732009", "url": "https://glygen.org/publication/PubMed/15732009" } ] }, { "title": "Lateral ligand-receptor interactions on membranes probed by simultaneous fluorescence-interference detection.", "journal": "Biophysical journal", "date": "2005", "authors": "Gavutis M, Lata S, Lamken P, Muller P, Piehler J", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "15778442", "url": "https://glygen.org/publication/PubMed/15778442" } ] }, { "title": "Human ISG15 conjugation targets both IFN-induced and constitutively expressed proteins functioning in diverse cellular pathways.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Zhao C, Denison C, Huibregtse JM, Gygi S, Krug RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "16009940", "url": "https://glygen.org/publication/PubMed/16009940" } ] }, { "title": "Mutational analysis of the IFNAR1 binding site on IFNalpha2 reveals the architecture of a weak ligand-receptor binding-site.", "journal": "Journal of molecular biology", "date": "2005", "authors": "Roisman LC, Jaitin DA, Baker DP, Schreiber G", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "16171819", "url": "https://glygen.org/publication/PubMed/16171819" } ] }, { "title": "Signaling through a mutant IFN-gamma receptor.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2005", "authors": "Costa-Pereira AP, Hermanns HM, Is'harc H, Williams TM, Watling D, Arulampalam V, Newman SJ, Heinrich PC, Kerr IM", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "16237089", "url": "https://glygen.org/publication/PubMed/16237089" } ] }, { "title": "Preassembly and ligand-induced restructuring of the chains of the IFN-gamma receptor complex: the roles of Jak kinases, Stat1 and the receptor chains.", "journal": "Cell research", "date": "2006", "authors": "Krause CD, Lavnikova N, Xie J, Mei E, Mirochnitchenko OV, Jia Y, Hochstrasser RM, Pestka S", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "16467876", "url": "https://glygen.org/publication/PubMed/16467876" } ] }, { "title": "Cloning, sequencing, and expression of two murine 2'-5'-oligoadenylate synthetases. Structure-function relationships.", "journal": "J. Biol. Chem.", "date": "1991", "authors": "Ghosh SK, Kusari J, Bandyopadhyay SK, Samanta H, Kumar R, Sen GC", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "reference": [ { "type": "PubMed", "id": "1651324", "url": "https://glygen.org/publication/PubMed/1651324" } ] }, { "title": "The Epstein-Barr virus-encoded LMP-1 oncoprotein negatively affects Tyk2 phosphorylation and interferon signaling in human B cells.", "journal": "Journal of virology", "date": "2006", "authors": "Geiger TR, Martin JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "16987978", "url": "https://glygen.org/publication/PubMed/16987978" } ] }, { "title": "The mammalian 2'-5' oligoadenylate synthetase gene family: evidence for concerted evolution of paralogous Oas1 genes in Rodentia and Artiodactyla.", "journal": "J. Mol. Evol.", "date": "2006", "authors": "Perelygin AA, Zharkikh AA, Scherbik SV, Brinton MA", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "reference": [ { "type": "PubMed", "id": "17024523", "url": "https://glygen.org/publication/PubMed/17024523" } ] }, { "title": "IFN-gamma abrogates profibrogenic TGF-beta signaling in liver by targeting expression of inhibitory and receptor Smads.", "journal": "Journal of hepatology", "date": "2007", "authors": "Weng H, Mertens PR, Gressner AM, Dooley S", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "17125875", "url": "https://glygen.org/publication/PubMed/17125875" } ] }, { "title": "Respiratory syncytial virus NS1 protein degrades STAT2 by using the Elongin-Cullin E3 ligase.", "journal": "Journal of virology", "date": "2007-04", "authors": "Elliott Joanne, Lynch Oonagh T, Suessmuth Yvonne, Qian Ping, Boyd Caroline R, Burrows James F, Buick Richard, Stevenson Nigel J, Touzelet Olivier, Gadina Massimo, Power Ultan F, Johnston James A", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "17251292", "url": "https://glygen.org/publication/PubMed/17251292" } ] }, { "title": "Regulation of the Egr-1 gene by tumor necrosis factor and interferons in primary human fibroblasts.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Cao XM, Guy GR, Sukhatme VP, Tan YH", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "1730654", "url": "https://glygen.org/publication/PubMed/1730654" } ] }, { "title": "STAT activation and differential complex formation dictate selectivity of interferon responses.", "journal": "Acta biochimica Polonica", "date": "2007", "authors": "Wesoly J, Szweykowska-Kulinska Z, Bluyssen HA", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "17351669", "url": "https://glygen.org/publication/PubMed/17351669" } ] }, { "title": "The human 2'-5'oligoadenylate synthetase family: unique interferon-inducible enzymes catalyzing 2'-5' instead of 3'-5' phosphodiester bond formation.", "journal": "Biochimie", "date": "2007", "authors": "Hovanessian Ara G, Justesen Just", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "reference": [ { "type": "PubMed", "id": "17408844", "url": "https://glygen.org/publication/PubMed/17408844" } ] }, { "title": "The receptor of the type I interferon family.", "journal": "Current topics in microbiology and immunology", "date": "2007", "authors": "Uze G, Schreiber G, Piehler J, Pellegrini S", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "17969444", "url": "https://glygen.org/publication/PubMed/17969444" } ] }, { "title": "Full results of the Evidence of Interferon Dose-Response-European North American Comparative Efficacy (EVIDENCE) study: a multicenter, randomized, assessor-blinded comparison of low-dose weekly versus high-dose, high-frequency interferon beta-1a for relapsing multiple sclerosis.", "journal": "Clinical therapeutics", "date": "2007", "authors": "Schwid SR, Panitch HS", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "18035202", "url": "https://glygen.org/publication/PubMed/18035202" } ] }, { "title": "Induction of guanylate binding protein 5 by gamma interferon increases susceptibility to Salmonella enterica serovar Typhimurium-induced pyroptosis in RAW 264.7 cells.", "journal": "Infection and immunity", "date": "2008", "authors": "Rupper AC, Cardelli JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "18362138", "url": "https://glygen.org/publication/PubMed/18362138" } ] }, { "title": "Interferon-inducible antiviral effectors.", "journal": "Nature reviews. Immunology", "date": "2008", "authors": "Sadler AJ, Williams BR", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "18575461", "url": "https://glygen.org/publication/PubMed/18575461" } ] }, { "title": "Tyrosine phosphorylation regulates the partitioning of STAT1 between different dimer conformations.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Wenta N, Strauss H, Meyer S, Vinkemeier U", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "18591661", "url": "https://glygen.org/publication/PubMed/18591661" } ] }, { "title": "The p59 oligoadenylate synthetase-like protein possesses antiviral activity that requires the C-terminal ubiquitin-like domain.", "journal": "The Journal of general virology", "date": "2008", "authors": "Marques J, Anwar J, Eskildsen-Larsen S, Rebouillat D, Paludan SR, Sen G, Williams BRG, Hartmann R", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "reference": [ { "type": "PubMed", "id": "18931074", "url": "https://glygen.org/publication/PubMed/18931074" } ] }, { "title": "Differential regulation of the OASL and OAS1 genes in response to viral infections.", "journal": "J. Interferon Cytokine Res.", "date": "2009", "authors": "Melchjorsen Jesper, Kristiansen Helle, Christiansen Rune, Rintahaka Johanna, Matikainen Sampsa, Paludan S\u00f8ren R, Hartmann Rune", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "reference": [ { "type": "PubMed", "id": "19203244", "url": "https://glygen.org/publication/PubMed/19203244" } ] }, { "title": "Evolution of the 2'-5'-oligoadenylate synthetase family in eukaryotes and bacteria.", "journal": "J. Mol. Evol.", "date": "2009", "authors": "Kjaer Karina Hansen, Poulsen Jesper Buchhave, Reintamm T\u00f5nu, Saby Emilie, Martensen Pia Moeller, Kelve Merike, Justesen Just", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "reference": [ { "type": "PubMed", "id": "19904482", "url": "https://glygen.org/publication/PubMed/19904482" } ] }, { "title": "Distinct antiviral roles for human 2',5'-oligoadenylate synthetase family members against dengue virus infection.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2009", "authors": "Lin RJ, Yu HP, Chang BL, Tang WC, Liao CL, Lin YL", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "reference": [ { "type": "PubMed", "id": "19923450", "url": "https://glygen.org/publication/PubMed/19923450" } ] }, { "title": "Neutralization of IFNgamma defeats haemophagocytosis in LCMV-infected perforin- and Rab27a-deficient mice.", "journal": "EMBO molecular medicine", "date": "2009", "authors": "Pachlopnik Schmid J, Ho CH, Chretien F, Lefebvre JM, Pivert G, Kosco-Vilbois M, Ferlin W, Geissmann F, Fischer A, de Saint Basile G", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "20049711", "url": "https://glygen.org/publication/PubMed/20049711" } ] }, { "title": "Preclinical characterization of the selective JAK1/2 inhibitor INCB018424: therapeutic implications for the treatment of myeloproliferative neoplasms.", "journal": "Blood", "date": "2010", "authors": "Quintas-Cardama A, Vaddi K, Liu P, Manshouri T, Li J, Scherle PA, Caulder E, Wen X, Li Y, Waeltz P, Rupar M, Burn T, Lo Y, Kelley J, Covington M, Shepard S, Rodgers JD, Haley P, Kantarjian H, Fridman JS, Verstovsek S", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "20130243", "url": "https://glygen.org/publication/PubMed/20130243" } ] }, { "title": "Tyrosines 868, 966, and 972 in the kinase domain of JAK2 are autophosphorylated and required for maximal JAK2 kinase activity.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2010", "authors": "Argetsinger LS, Stuckey JA, Robertson SA, Koleva RI, Cline JM, Marto JA, Myers MG Jr, Carter-Su C", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "20304997", "url": "https://glygen.org/publication/PubMed/20304997" } ] }, { "title": "Selective inhibition of JAK1 and JAK2 is efficacious in rodent models of arthritis: preclinical characterization of INCB028050.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2010", "authors": "Fridman JS, Scherle PA, Collins R, Burn TC, Li Y, Li J, Covington MB, Thomas B, Collier P, Favata MF, Wen X, Shi J, McGee R, Haley PJ, Shepard S, Rodgers JD, Yeleswaram S, Hollis G, Newton RC, Metcalf B, Friedman SM, Vaddi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "20363976", "url": "https://glygen.org/publication/PubMed/20363976" } ] }, { "title": "Molecular basis for the recognition of phosphorylated STAT1 by importin alpha5.", "journal": "Journal of molecular biology", "date": "2010", "authors": "Nardozzi J, Wenta N, Yasuhara N, Vinkemeier U, Cingolani G", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "20643137", "url": "https://glygen.org/publication/PubMed/20643137" } ] }, { "title": "The oligoadenylate synthetase family: an ancient protein family with multiple antiviral activities.", "journal": "J. Interferon Cytokine Res.", "date": "2011", "authors": "Kristiansen H, Gad HH, Eskildsen-Larsen S, Despres P, Hartmann R", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "reference": [ { "type": "PubMed", "id": "21142819", "url": "https://glygen.org/publication/PubMed/21142819" } ] }, { "title": "Differential expression and distinct structure of 69- and 100-kDa forms of 2-5A synthetase in human cells treated with interferon.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Marie I, Svab J, Robert N, Galabru J, Hovanessian AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "2211721", "url": "https://glygen.org/publication/PubMed/2211721" } ] }, { "title": "Discovery of potent and selective pyrazolopyrimidine janus kinase 2 inhibitors.", "journal": "Journal of medicinal chemistry", "date": "2012", "authors": "Hanan EJ, van Abbema A, Barrett K, Blair WS, Blaney J, Chang C, Eigenbrot C, Flynn S, Gibbons P, Hurley CA, Kenny JR, Kulagowski J, Lee L, Magnuson SR, Morris C, Murray J, Pastor RM, Rawson T, Siu M, Ultsch M, Zhou A, Sampath D, Lyssikatos JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "23061660", "url": "https://glygen.org/publication/PubMed/23061660" } ] }, { "title": "Innate immune messenger 2-5A tethers human RNase L into active high-order complexes.", "journal": "Cell reports", "date": "2012", "authors": "Han Y, Whitney G, Donovan J, Korennykh A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8983711", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8983711" } ], "reference": [ { "type": "PubMed", "id": "23084743", "url": "https://glygen.org/publication/PubMed/23084743" } ] }, { "title": "Distinct and overlapping genomic profiles and antiviral effects of Interferon-lambda and -alpha on HCV-infected and noninfected hepatoma cells.", "journal": "Journal of viral hepatitis", "date": "2012", "authors": "Kohli A, Zhang X, Yang J, Russell RS, Donnelly RP, Sheikh F, Sherman A, Young H, Imamichi T, Lempicki RA, Masur H, Kottilil S", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "23121362", "url": "https://glygen.org/publication/PubMed/23121362" } ] }, { "title": "Differential effects of a common splice site polymorphism on the generation of OAS1 variants in human bronchial epithelial cells.", "journal": "Human immunology", "date": "2013", "authors": "Noguchi S, Hamano E, Matsushita I, Hijikata M, Ito H, Nagase T, Keicho N", "evidence": [ { "database": "RefSeq", "id": "NP_001027581", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001027581" } ], "reference": [ { "type": "PubMed", "id": "23220500", "url": "https://glygen.org/publication/PubMed/23220500" } ] }, { "title": "Structural basis for cytosolic double-stranded RNA surveillance by human oligoadenylate synthetase 1.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Donovan J, Dufner M, Korennykh A", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" }, { "database": "Reactome", "id": "R-HSA-8983711", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8983711" } ], "reference": [ { "type": "PubMed", "id": "23319625", "url": "https://glygen.org/publication/PubMed/23319625" } ] }, { "title": "Human 2-5A synthetase: characterization of a novel cDNA and corresponding gene structure.", "journal": "EMBO J.", "date": "1985", "authors": "Saunders M E, Gewert D R, Tugwell M E, McMahon M, Williams B R", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "reference": [ { "type": "PubMed", "id": "2411547", "url": "https://glygen.org/publication/PubMed/2411547" } ] }, { "title": "Structure of two forms of the interferon-induced (2'-5') oligo A synthetase of human cells based on cDNAs and gene sequences.", "journal": "EMBO J.", "date": "1985", "authors": "Benech P, Mory Y, Revel M, Chebath J", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "reference": [ { "type": "PubMed", "id": "2416561", "url": "https://glygen.org/publication/PubMed/2416561" } ] }, { "title": "Discovery and development of Janus kinase (JAK) inhibitors for inflammatory diseases.", "journal": "Journal of medicinal chemistry", "date": "2014", "authors": "Clark JD, Flanagan ME, Telliez JB", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "24417533", "url": "https://glygen.org/publication/PubMed/24417533" } ] }, { "title": "Ribonuclease L and metal-ion-independent endoribonuclease cleavage sites in host and viral RNAs.", "journal": "Nucleic acids research", "date": "2014", "authors": "Cooper DA, Jha BK, Silverman RH, Hesselberth JR, Barton DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8983711", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8983711" } ], "reference": [ { "type": "PubMed", "id": "24500209", "url": "https://glygen.org/publication/PubMed/24500209" } ] }, { "title": "Interferon-induced binding of nuclear factors to promoter elements of the 2-5A synthetase gene.", "journal": "EMBO J.", "date": "1988", "authors": "Rutherford M N, Hannigan G E, Williams B R", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "reference": [ { "type": "PubMed", "id": "2456211", "url": "https://glygen.org/publication/PubMed/2456211" } ] }, { "title": "Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.", "journal": "Science (New York, N.Y.)", "date": "2014", "authors": "Han Y, Donovan J, Rath S, Whitney G, Chitrakar A, Korennykh A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8983711", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8983711" } ], "reference": [ { "type": "PubMed", "id": "24578532", "url": "https://glygen.org/publication/PubMed/24578532" } ] }, { "title": "Antiviral activity of human OASL protein is mediated by enhancing signaling of the RIG-I RNA sensor.", "journal": "Immunity", "date": "2014", "authors": "Zhu J, Zhang Y, Ghosh A, Cuevas RA, Forero A, Dhar J, Ibsen MS, Schmid-Burgk JL, Schmidt T, Ganapathiraju MK, Fujita T, Hartmann R, Barik S, Hornung V, Coyne CB, Sarkar SN", "evidence": [ { "database": "Reactome", "id": "R-HSA-8983711", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8983711" } ], "reference": [ { "type": "PubMed", "id": "24931123", "url": "https://glygen.org/publication/PubMed/24931123" } ] }, { "title": "Mitochondrial localization of the OAS1 p46 isoform associated with a common single nucleotide polymorphism.", "journal": "BMC cell biology", "date": "2014", "authors": "Kjaer KH, Pahus J, Hansen MF, Poulsen JB, Christensen EI, Justesen J, Martensen PM", "evidence": [ { "database": "RefSeq", "id": "NP_001027581", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001027581" } ], "reference": [ { "type": "PubMed", "id": "25205466", "url": "https://glygen.org/publication/PubMed/25205466" } ] }, { "title": "The 2'-5'-oligoadenylate synthetase 3 enzyme potently synthesizes the 2'-5'-oligoadenylates required for RNase L activation.", "journal": "Journal of virology", "date": "2014", "authors": "Ibsen MS, Gad HH, Thavachelvam K, Boesen T, Despres P, Hartmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-8983711", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8983711" } ], "reference": [ { "type": "PubMed", "id": "25275129", "url": "https://glygen.org/publication/PubMed/25275129" } ] }, { "title": "RNase L interacts with Filamin A to regulate actin dynamics and barrier function for viral entry.", "journal": "mBio", "date": "2014", "authors": "Malathi K, Siddiqui MA, Dayal S, Naji M, Ezelle HJ, Zeng C, Zhou A, Hassel BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8983711", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8983711" } ], "reference": [ { "type": "PubMed", "id": "25352621", "url": "https://glygen.org/publication/PubMed/25352621" } ] }, { "title": "Evidence for the efficacy of interferon beta-1b in delaying the onset of clinically definite multiple sclerosis in individuals with clinically isolated syndrome.", "journal": "Therapeutic advances in neurological disorders", "date": "2014", "authors": "Freedman MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "25371710", "url": "https://glygen.org/publication/PubMed/25371710" } ] }, { "title": "RNase L targets distinct sites in influenza A virus RNAs.", "journal": "Journal of virology", "date": "2015", "authors": "Cooper DA, Banerjee S, Chakrabarti A, Garcia-Sastre A, Hesselberth JR, Silverman RH, Barton DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8983711", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8983711" } ], "reference": [ { "type": "PubMed", "id": "25540362", "url": "https://glygen.org/publication/PubMed/25540362" } ] }, { "title": "Structural mechanism of sensing long dsRNA via a noncatalytic domain in human oligoadenylate synthetase 3.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2015", "authors": "Donovan J, Whitney G, Rath S, Korennykh A", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" }, { "database": "Reactome", "id": "R-HSA-8983711", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8983711" } ], "reference": [ { "type": "PubMed", "id": "25775560", "url": "https://glygen.org/publication/PubMed/25775560" } ] }, { "title": "The Activation Mechanism of 2'-5'-Oligoadenylate Synthetase Gives New Insights Into OAS/cGAS Triggers of Innate Immunity.", "journal": "Structure (London, England : 1993)", "date": "2015", "authors": "Lohofener J, Steinke N, Kay-Fedorov P, Baruch P, Nikulin A, Tishchenko S, Manstein DJ, Fedorov R", "evidence": [ { "database": "Reactome", "id": "R-HSA-8983711", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8983711" } ], "reference": [ { "type": "PubMed", "id": "25892109", "url": "https://glygen.org/publication/PubMed/25892109" } ] }, { "title": "The Role of Phosphodiesterase 12 (PDE12) as a Negative Regulator of the Innate Immune Response and the Discovery of Antiviral Inhibitors.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Wood ER, Bledsoe R, Chai J, Daka P, Deng H, Ding Y, Harris-Gurley S, Kryn LH, Nartey E, Nichols J, Nolte RT, Prabhu N, Rise C, Sheahan T, Shotwell JB, Smith D, Tai V, Taylor JD, Tomberlin G, Wang L, Wisely B, You S, Xia B, Dickson H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8983711", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8983711" } ], "reference": [ { "type": "PubMed", "id": "26055709", "url": "https://glygen.org/publication/PubMed/26055709" } ] }, { "title": "The Roles of RNase-L in Antimicrobial Immunity and the Cytoskeleton-Associated Innate Response.", "journal": "International journal of molecular sciences", "date": "2016", "authors": "Ezelle HJ, Malathi K, Hassel BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8983711", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8983711" } ], "reference": [ { "type": "PubMed", "id": "26760998", "url": "https://glygen.org/publication/PubMed/26760998" } ] }, { "title": "Activation of RNase L is dependent on OAS3 expression during infection with diverse human viruses.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2016", "authors": "Li Y, Banerjee S, Wang Y, Goldstein SA, Dong B, Gaughan C, Silverman RH, Weiss SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8983711", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8983711" } ], "reference": [ { "type": "PubMed", "id": "26858407", "url": "https://glygen.org/publication/PubMed/26858407" } ] }, { "title": "Interferon-responsive regulatory elements in the promoter of the human 2',5'-oligo(A) synthetase gene.", "journal": "Mol. Cell. Biol.", "date": "1987", "authors": "Benech P, Vigneron M, Peretz D, Revel M, Chebath J", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "reference": [ { "type": "PubMed", "id": "2830497", "url": "https://glygen.org/publication/PubMed/2830497" } ] }, { "title": "Heterozygous Mutations in OAS1 Cause Infantile-Onset Pulmonary Alveolar Proteinosis with Hypogammaglobulinemia.", "journal": "American journal of human genetics", "date": "2018", "authors": "Cho K, Yamada M, Agematsu K, Kanegane H, Miyake N, Ueki M, Akimoto T, Kobayashi N, Ikemoto S, Tanino M, Fujita A, Hayasaka I, Miyamoto S, Tanaka-Kubota M, Nakata K, Shiina M, Ogata K, Minakami H, Matsumoto N, Ariga T", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "reference": [ { "type": "PubMed", "id": "29455859", "url": "https://glygen.org/publication/PubMed/29455859" } ] }, { "title": "Differential induction of interferon stimulated genes between type I and type III interferons is independent of interferon receptor abundance.", "journal": "PLoS pathogens", "date": "2018", "authors": "Pervolaraki K, Rastgou Talemi S, Albrecht D, Bormann F, Bamford C, Mendoza JL, Garcia KC, McLauchlan J, Hofer T, Stanifer ML, Boulant S", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "30485383", "url": "https://glygen.org/publication/PubMed/30485383" } ] }, { "title": "New inducers revealed by the promoter sequence analysis of two interferon-activated human genes.", "journal": "Eur. J. Biochem.", "date": "1987", "authors": "Wathelet MG, Clauss IM, Nols CB, Content J, Huez GA", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "reference": [ { "type": "PubMed", "id": "3121313", "url": "https://glygen.org/publication/PubMed/3121313" } ] }, { "title": "Baricitinib as potential treatment for 2019-nCoV acute respiratory disease.", "journal": "Lancet (London, England)", "date": "2020", "authors": "Richardson P, Griffin I, Tucker C, Smith D, Oechsle O, Phelan A, Rawling M, Savory E, Stebbing J", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "32032529", "url": "https://glygen.org/publication/PubMed/32032529" } ] }, { "title": "COVID-19: combining antiviral and anti-inflammatory treatments.", "journal": "The Lancet. Infectious diseases", "date": "2020", "authors": "Stebbing J, Phelan A, Griffin I, Tucker C, Oechsle O, Smith D, Richardson P", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "32113509", "url": "https://glygen.org/publication/PubMed/32113509" } ] }, { "title": "Discovery of a Janus Kinase Inhibitor Bearing a Highly Three-Dimensional Spiro Scaffold: JTE-052 (Delgocitinib) as a New Dermatological Agent to Treat Inflammatory Skin Disorders.", "journal": "Journal of medicinal chemistry", "date": "2020", "authors": "Noji S, Hara Y, Miura T, Yamanaka H, Maeda K, Hori A, Yamamoto H, Obika S, Inoue M, Hase Y, Orita T, Doi S, Adachi T, Tanimoto A, Oki C, Kimoto Y, Ogawa Y, Negoro T, Hashimoto H, Shiozaki M", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "32511913", "url": "https://glygen.org/publication/PubMed/32511913" } ] }, { "title": "Interferon-alpha2b Treatment for COVID-19.", "journal": "Frontiers in immunology", "date": "2020", "authors": "Zhou Q, Chen V, Shannon CP, Wei XS, Xiang X, Wang X, Wang ZH, Tebbutt SJ, Kollmann TR, Fish EN", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "32574262", "url": "https://glygen.org/publication/PubMed/32574262" } ] }, { "title": "A Randomized Clinical Trial of the Efficacy and Safety of Interferon beta-1a in Treatment of Severe COVID-19.", "journal": "Antimicrobial agents and chemotherapy", "date": "2020", "authors": "Davoudi-Monfared E, Rahmani H, Khalili H, Hajiabdolbaghi M, Salehi M, Abbasian L, Kazemzadeh H, Yekaninejad MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "32661006", "url": "https://glygen.org/publication/PubMed/32661006" } ] }, { "title": "SARS-CoV-2 clearance in COVID-19 patients with Novaferon treatment: A randomized, open-label, parallel-group trial.", "journal": "International journal of infectious diseases : IJID : official publication of the International Society for Infectious Diseases", "date": "2020", "authors": "Zheng F, Zhou Y, Zhou Z, Ye F, Huang B, Huang Y, Ma J, Zuo Q, Tan X, Xie J, Niu P, Wang W, Xu Y, Peng F, Zhou N, Cai C, Tang W, Xiao X, Li Y, Zhou Z, Jiang Y, Xie Y, Tan W, Gong G", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "32758689", "url": "https://glygen.org/publication/PubMed/32758689" } ] }, { "title": "Interferon beta-1b in treatment of severe COVID-19: A randomized clinical trial.", "journal": "International immunopharmacology", "date": "2020", "authors": "Rahmani H, Davoudi-Monfared E, Nourian A, Khalili H, Hajizadeh N, Jalalabadi NZ, Fazeli MR, Ghazaeian M, Yekaninejad MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "32862111", "url": "https://glygen.org/publication/PubMed/32862111" } ] }, { "title": "The Role of Type I Interferons in the Pathogenesis and Treatment of COVID-19.", "journal": "Frontiers in immunology", "date": "2020", "authors": "Schreiber G", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "33117408", "url": "https://glygen.org/publication/PubMed/33117408" } ] }, { "title": "Safety and efficacy of inhaled nebulised interferon beta-1a (SNG001) for treatment of SARS-CoV-2 infection: a randomised, double-blind, placebo-controlled, phase 2 trial.", "journal": "The Lancet. Respiratory medicine", "date": "2021", "authors": "Monk PD, Marsden RJ, Tear VJ, Brookes J, Batten TN, Mankowski M, Gabbay FJ, Davies DE, Holgate ST, Ho LP, Clark T, Djukanovic R, Wilkinson TMA", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "33189161", "url": "https://glygen.org/publication/PubMed/33189161" } ] }, { "title": "Corrigendum: Interferon-alpha2b Treatment for COVID-19.", "journal": "Frontiers in immunology", "date": "2020", "authors": "Zhou Q, Chen V, Shannon CP, Wei XS, Xiang X, Wang X, Wang ZH, Tebbutt SJ, Kollmann TR, Fish EN", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "33193462", "url": "https://glygen.org/publication/PubMed/33193462" } ] }, { "title": "Splicing factor YBX1 mediates persistence of JAK2-mutated neoplasms.", "journal": "Nature", "date": "2020-12", "authors": "Jayavelu Ashok Kumar, Schn\u00f6der Tina M, Perner Florian, Herzog Carolin, Meiler Arno, Krishnamoorthy Gurumoorthy, Huber Nicolas, Mohr Juliane, Edelmann-Stephan B\u00e4rbel, Austin Rebecca, Brandt Sabine, Palandri Francesca, Schr\u00f6der Nicolas, Isermann Berend, Edlich Frank, Sinha Amit U, Ungelenk Martin, H\u00fcbner Christian A, Zeiser Robert, Rahmig Susann, Waskow Claudia, Coldham Iain, Ernst Thomas, Hochhaus Andreas, Jilg Stefanie, Jost Philipp J, Mullally Ann, Bullinger Lars, Mertens Peter R, Lane Steven W, Mann Matthias, Heidel Florian H", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "33239784", "url": "https://glygen.org/publication/PubMed/33239784" } ] }, { "title": "Interferon-alpha2b Treatment for COVID-19 Is Associated with Improvements in Lung Abnormalities.", "journal": "Viruses", "date": "2020", "authors": "Zhou Q, MacArthur MR, He X, Wei X, Zarin P, Hanna BS, Wang ZH, Xiang X, Fish EN", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "33396578", "url": "https://glygen.org/publication/PubMed/33396578" } ] }, { "title": "Characterization of 69- and 100-kDa forms of 2-5A-synthetase from interferon-treated human cells.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Hovanessian AG, Svab J, Marie I, Robert N, Chamaret S, Laurent AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8983711", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8983711" } ], "reference": [ { "type": "PubMed", "id": "3350819", "url": "https://glygen.org/publication/PubMed/3350819" } ] }, { "title": "A Neanderthal OAS1 isoform protects individuals of European ancestry against COVID-19 susceptibility and severity.", "journal": "Nat. Med.", "date": "2021", "authors": "Zhou Sirui, Butler-Laporte Guillaume, Nakanishi Tomoko, Morrison David R, Afilalo Jonathan, Afilalo Marc, Laurent Laetitia, Pietzner Maik, Kerrison Nicola, Zhao Kaiqiong, Brunet-Ratnasingham Elsa, Henry Danielle, Kimchi Nofar, Afrasiabi Zaman, Rezk Nardin, Bouab Meriem, Petitjean Louis, Guzman Charlotte, Xue Xiaoqing, Tselios Chris, Vulesevic Branka, Adeleye Olumide, Abdullah Tala, Almamlouk Noor, Chen Yiheng, Chass\u00e9 Micha\u00ebl, Durand Madeleine, Paterson Clare, Normark Johan, Frithiof Robert, Lipcsey Mikl\u00f3s, Hultstr\u00f6m Michael, Greenwood Celia M T, Zeberg Hugo, Langenberg Claudia, Thysell Elin, Pollak Michael, Mooser Vincent, Forgetta Vincenzo, Kaufmann Daniel E, Richards J Brent", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "reference": [ { "type": "PubMed", "id": "33633408", "url": "https://glygen.org/publication/PubMed/33633408" } ] }, { "title": "Heterozygous OAS1 gain-of-function variants cause an autoinflammatory immunodeficiency.", "journal": "Science immunology", "date": "2021", "authors": "Magg T, Okano T, Koenig LM, Boehmer DFR, Schwartz SL, Inoue K, Heimall J, Licciardi F, Ley-Zaporozhan J, Ferdman RM, Caballero-Oteyza A, Park EN, Calderon BM, Dey D, Kanegane H, Cho K, Montin D, Reiter K, Griese M, Albert MH, Rohlfs M, Gray P, Walz C, Conn GL, Sullivan KE, Klein C, Morio T, Hauck F", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "reference": [ { "type": "PubMed", "id": "34145065", "url": "https://glygen.org/publication/PubMed/34145065" } ] }, { "title": "A prenylated dsRNA sensor protects against severe COVID-19.", "journal": "Science (New York, N.Y.)", "date": "2021", "authors": "Wickenhagen A, Sugrue E, Lytras S, Kuchi S, Noerenberg M, Turnbull ML, Loney C, Herder V, Allan J, Jarmson I, Cameron-Ruiz N, Varjak M, Pinto RM, Lee JY, Iselin L, Palmalux N, Stewart DG, Swingler S, Greenwood EJD, Crozier TWM, Gu Q, Davies EL, Clohisey S, Wang B, Trindade Maranhao Costa F, Freire Santana M, de Lima Ferreira LC, Murphy L, Fawkes A, Meynert A, Grimes G, Da Silva Filho JL, Marti M, Hughes J, Stanton RJ, Wang ECY, Ho A, Davis I, Jarrett RF, Castello A, Robertson DL, Semple MG, Openshaw PJM, Palmarini M, Lehner PJ, Baillie JK, Rihn SJ, Wilson SJ", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "reference": [ { "type": "PubMed", "id": "34581622", "url": "https://glygen.org/publication/PubMed/34581622" } ] }, { "title": "Full-length sequence and expression of the 42 kDa 2-5A synthetase induced by human interferon.", "journal": "FEBS Lett.", "date": "1986", "authors": "Wathelet M, Moutschen S, Cravador A, DeWit L, Defilippi P, Huez G, Content J", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "reference": [ { "type": "PubMed", "id": "3753689", "url": "https://glygen.org/publication/PubMed/3753689" } ] }, { "title": "Structure and expression of a cloned cDNA for human (2'-5')oligoadenylate synthetase.", "journal": "J. Biochem.", "date": "1986", "authors": "Shiojiri S, Fukunaga R, Ichii Y, Sokawa Y", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "reference": [ { "type": "PubMed", "id": "3754863", "url": "https://glygen.org/publication/PubMed/3754863" } ] }, { "title": "Elevation of H3K27me3 level contributes to the radioresistance of nasopharyngeal carcinoma by inhibiting OAS1 expression.", "journal": "American journal of physiology. Cell physiology", "date": "2024-01-01", "authors": "Zhou Yuchuan, Xiao Yuqi, Liu Hongxia, Chen Qianping, Zhu Lin, Zeng Liang, Liu Xinglong, Pan Yan, Zhang Jianghong, Fu Jiamei, Shao Chunlin", "evidence": [ { "database": "RefSeq", "id": "NP_001027581", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001027581" } ], "reference": [ { "type": "PubMed", "id": "38009194", "url": "https://glygen.org/publication/PubMed/38009194" } ] }, { "title": "Features of Distribution of the Allelic Variant of the OAS1 Gene Associated with Severe Form of the Coronavirus Infection in the Russian and Global Populations.", "journal": "Bulletin of experimental biology and medicine", "date": "2023-12", "authors": "Olkova M V, Koshel S M, Petrushenko V S, Alimov A A", "evidence": [ { "database": "RefSeq", "id": "NP_001027581", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001027581" } ], "reference": [ { "type": "PubMed", "id": "38191878", "url": "https://glygen.org/publication/PubMed/38191878" } ] }, { "title": "Interferon action--sequence specificity of the ppp(A2'p)nA-dependent ribonuclease.", "journal": "Nature", "date": "1981", "authors": "Wreschner DH, McCauley JW, Skehel JJ, Kerr IM", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "6162102", "url": "https://glygen.org/publication/PubMed/6162102" } ] }, { "title": "rRNA cleavage as an index of ppp(A2'p)nA activity in interferon-treated encephalomyocarditis virus-infected cells.", "journal": "Journal of virology", "date": "1983", "authors": "Silverman RH, Skehel JJ, James TC, Wreschner DH, Kerr IM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8983711", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8983711" } ], "reference": [ { "type": "PubMed", "id": "6190010", "url": "https://glygen.org/publication/PubMed/6190010" } ] }, { "title": "Molecular cloning and sequence of partial cDNA for interferon-induced (2'-5')oligo(A) synthetase mRNA from human cells.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1983", "authors": "Merlin G, Chebath J, Benech P, Metz R, Revel M", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "reference": [ { "type": "PubMed", "id": "6348777", "url": "https://glygen.org/publication/PubMed/6348777" } ] }, { "title": "Transcriptional and posttranscriptional regulation of interferon-induced gene expression in human cells.", "journal": "Cell", "date": "1984", "authors": "Friedman RL, Manly SP, McMahon M, Kerr IM, Stark GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "6548414", "url": "https://glygen.org/publication/PubMed/6548414" } ] }, { "title": "Interferon-associated, dsRNA-dependent enzyme activities in a mutant 3T6 cell engaged in the semiconstitutive synthesis of interferon.", "journal": "Cell", "date": "1978-08", "authors": "Jarvis A P, White C, Ball A, Gupta S L, Ratner L, Sen G C, Colby C", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "688397", "url": "https://glygen.org/publication/PubMed/688397" } ] }, { "title": "Interferon activation of the transcription factor Stat91 involves dimerization through SH2-phosphotyrosyl peptide interactions.", "journal": "Cell", "date": "1994", "authors": "Shuai K, Horvath CM, Huang LH, Qureshi SA, Cowburn D, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7510216", "url": "https://glygen.org/publication/PubMed/7510216" } ] }, { "title": "Interferon-gamma induces tyrosine phosphorylation of interferon-gamma receptor and regulated association of protein tyrosine kinases, Jak1 and Jak2, with its receptor.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Igarashi K, Garotta G, Ozmen L, Ziemiecki A, Wilks AF, Harpur AG, Larner AC, Finbloom DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7514165", "url": "https://glygen.org/publication/PubMed/7514165" } ] }, { "title": "Direct binding to and tyrosine phosphorylation of the alpha subunit of the type I interferon receptor by p135tyk2 tyrosine kinase.", "journal": "Molecular and cellular biology", "date": "1994", "authors": "Colamonici O, Yan H, Domanski P, Handa R, Smalley D, Mullersman J, Witte M, Krishnan K, Krolewski J", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "7526154", "url": "https://glygen.org/publication/PubMed/7526154" } ] }, { "title": "Cytokine-induced expression of vascular cell adhesion molecule-1 (VCAM-1) by astrocytes and astrocytoma cell lines.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1995", "authors": "Rosenman SJ, Shrikant P, Dubb L, Benveniste EN, Ransohoff RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7530745", "url": "https://glygen.org/publication/PubMed/7530745" } ] }, { "title": "Tyrosine-phosphorylated Stat1 and Stat2 plus a 48-kDa protein all contact DNA in forming interferon-stimulated-gene factor 3.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Qureshi SA, Salditt-Georgieff M, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "7537377", "url": "https://glygen.org/publication/PubMed/7537377" } ] }, { "title": "Cloning and characterization of a RNAse L inhibitor. A new component of the interferon-regulated 2-5A pathway.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Bisbal C, Martinand C, Silhol M, Lebleu B, Salehzada T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8983711", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8983711" } ], "reference": [ { "type": "PubMed", "id": "7539425", "url": "https://glygen.org/publication/PubMed/7539425" } ] }, { "title": "Transcription factors in interferon signaling.", "journal": "Pharmacology & therapeutics", "date": "1995", "authors": "David M", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "7540766", "url": "https://glygen.org/publication/PubMed/7540766" } ] }, { "title": "The Jak kinases differentially associate with the alpha and beta (accessory factor) chains of the interferon gamma receptor to form a functional receptor unit capable of activating STAT transcription factors.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Sakatsume M, Igarashi K, Winestock KD, Garotta G, Larner AC, Finbloom DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7615558", "url": "https://glygen.org/publication/PubMed/7615558" } ] }, { "title": "Crystal structure of a complex between interferon-gamma and its soluble high-affinity receptor.", "journal": "Nature", "date": "1995", "authors": "Walter MR, Windsor WT, Nagabhushan TL, Lundell DJ, Lunn CA, Zauodny PJ, Narula SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7617032", "url": "https://glygen.org/publication/PubMed/7617032" } ] }, { "title": "Phosphorylation and activation of the DNA binding activity of purified Stat1 by the Janus protein-tyrosine kinases and the epidermal growth factor receptor.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Quelle FW, Thierfelder W, Witthuhn BA, Tang B, Cohen S, Ihle JN", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7657660", "url": "https://glygen.org/publication/PubMed/7657660" } ] }, { "title": "Interaction between the components of the interferon gamma receptor complex.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Kotenko SV, Izotova LS, Pollack BP, Mariano TM, Donnelly RJ, Muthukumaran G, Cook JR, Garotta G, Silvennoinen O, Ihle JN, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7673114", "url": "https://glygen.org/publication/PubMed/7673114" } ] }, { "title": "A single phosphotyrosine residue of Stat91 required for gene activation by interferon-gamma.", "journal": "Science (New York, N.Y.)", "date": "1993", "authors": "Shuai K, Stark GR, Kerr IM, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7690989", "url": "https://glygen.org/publication/PubMed/7690989" } ] }, { "title": "Stat recruitment by tyrosine-phosphorylated cytokine receptors: an ordered reversible affinity-driven process.", "journal": "Immunity", "date": "1995", "authors": "Greenlund AC, Morales MO, Viviano BL, Yan H, Krolewski J, Schreiber RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7796299", "url": "https://glygen.org/publication/PubMed/7796299" } ] }, { "title": "Ligand-induced IFN gamma receptor tyrosine phosphorylation couples the receptor to its signal transduction system (p91).", "journal": "The EMBO journal", "date": "1994", "authors": "Greenlund AC, Farrar MA, Viviano BL, Schreiber RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "8156998", "url": "https://glygen.org/publication/PubMed/8156998" } ] }, { "title": "IFN-gamma up-regulates platelet-activating factor receptor gene expression in human monocytes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1994", "authors": "Ouellet S, Muller E, Rola-Pleszczynski M", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "8176225", "url": "https://glygen.org/publication/PubMed/8176225" } ] }, { "title": "Transcription factor ISGF-3 formation requires phosphorylated Stat91 protein, but Stat113 protein is phosphorylated independently of Stat91 protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Improta T, Schindler C, Horvath CM, Kerr IM, Stark GR, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "8197134", "url": "https://glygen.org/publication/PubMed/8197134" } ] }, { "title": "The protein tyrosine kinase JAK1 complements defects in interferon-alpha/beta and -gamma signal transduction.", "journal": "Nature", "date": "1993", "authors": "Muller M, Briscoe J, Laxton C, Guschin D, Ziemiecki A, Silvennoinen O, Harpur AG, Barbieri G, Witthuhn BA, Schindler C, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "8232552", "url": "https://glygen.org/publication/PubMed/8232552" } ] }, { "title": "Interferon gamma-induced transcription of the high-affinity Fc receptor for IgG requires assembly of a complex that includes the 91-kDa subunit of transcription factor ISGF3.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Pearse RN, Feinman R, Shuai K, Darnell JE Jr, Ravetch JV", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "8483949", "url": "https://glygen.org/publication/PubMed/8483949" } ] }, { "title": "Transcriptional regulation of the human intercellular adhesion molecule-1 gene: a short overview.", "journal": "Immunobiology", "date": "1995", "authors": "Stratowa C, Audette M", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "8530158", "url": "https://glygen.org/publication/PubMed/8530158" } ] }, { "title": "Identification of an interferon-gamma receptor alpha chain sequence required for JAK-1 binding.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Kaplan DH, Greenlund AC, Tanner JW, Shaw AS, Schreiber RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "8550631", "url": "https://glygen.org/publication/PubMed/8550631" } ] }, { "title": "Phosphorylated interferon-alpha receptor 1 subunit (IFNaR1) acts as a docking site for the latent form of the 113 kDa STAT2 protein.", "journal": "The EMBO journal", "date": "1996", "authors": "Yan H, Krishnan K, Greenlund AC, Gupta S, Lim JT, Schreiber RD, Schindler CW, Krolewski JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "8605876", "url": "https://glygen.org/publication/PubMed/8605876" } ] }, { "title": "Formation of STAT1-STAT2 heterodimers and their role in the activation of IRF-1 gene transcription by interferon-alpha.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Li X, Leung S, Qureshi S, Darnell JE Jr, Stark GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "8621447", "url": "https://glygen.org/publication/PubMed/8621447" } ] }, { "title": "Kinase-negative mutants of JAK1 can sustain interferon-gamma-inducible gene expression but not an antiviral state.", "journal": "The EMBO journal", "date": "1996", "authors": "Briscoe J, Rogers NC, Witthuhn BA, Watling D, Harpur AG, Wilks AF, Stark GR, Ihle JN, Kerr IM", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "8631301", "url": "https://glygen.org/publication/PubMed/8631301" } ] }, { "title": "Interferon-alpha-dependent activation of Tyk2 requires phosphorylation of positive regulatory tyrosines by another kinase.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Gauzzi MC, Velazquez L, McKendry R, Mogensen KE, Fellous M, Pellegrini S", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "8702790", "url": "https://glygen.org/publication/PubMed/8702790" } ] }, { "title": "A double-stranded RNA-activated protein kinase-dependent pathway mediating stress-induced apoptosis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Der SD, Yang YL, Weissmann C, Williams BR", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "9096384", "url": "https://glygen.org/publication/PubMed/9096384" } ] }, { "title": "Activation of Jak2 catalytic activity requires phosphorylation of Y1007 in the kinase activation loop.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Feng J, Witthuhn BA, Matsuda T, Kohlhuber F, Kerr IM, Ihle JN", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "9111318", "url": "https://glygen.org/publication/PubMed/9111318" } ] }, { "title": "Functional subdomains of STAT2 required for preassociation with the alpha interferon receptor and for signaling.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Li X, Leung S, Kerr IM, Stark GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "9121453", "url": "https://glygen.org/publication/PubMed/9121453" } ] }, { "title": "Cellular responses to interferon-gamma.", "journal": "Annual review of immunology", "date": "1997", "authors": "Boehm U, Klamp T, Groot M, Howard JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "9143706", "url": "https://glygen.org/publication/PubMed/9143706" } ] }, { "title": "Distinct STAT structure promotes interaction of STAT2 with the p48 subunit of the interferon-alpha-stimulated transcription factor ISGF3.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Martinez-Moczygemba M, Gutch MJ, French DL, Reich NC", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "9242679", "url": "https://glygen.org/publication/PubMed/9242679" } ] }, { "title": "A region of the beta subunit of the interferon alpha receptor different from box 1 interacts with Jak1 and is sufficient to activate the Jak-Stat pathway and induce an antiviral state.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Domanski P, Fish E, Nadeau OW, Witte M, Platanias LC, Yan H, Krolewski J, Pitha P, Colamonici OR", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "9334213", "url": "https://glygen.org/publication/PubMed/9334213" } ] }, { "title": "Enzymatic activity of 2'-5'-oligoadenylate synthetase is impaired by specific mutations that affect oligomerization of the protein.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Ghosh A, Sarkar SN, Guo W, Bandyopadhyay S, Sen GC", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" }, { "database": "Reactome", "id": "R-HSA-8983711", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8983711" } ], "reference": [ { "type": "PubMed", "id": "9407111", "url": "https://glygen.org/publication/PubMed/9407111" } ] }, { "title": "RNase L inhibitor (RLI) antisense constructions block partially the down regulation of the 2-5A/RNase L pathway in encephalomyocarditis-virus-(EMCV)-infected cells.", "journal": "European journal of biochemistry", "date": "1998", "authors": "Martinand C, Salehzada T, Silhol M, Lebleu B, Bisbal C", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "9660177", "url": "https://glygen.org/publication/PubMed/9660177" } ] }, { "title": "RNase L inhibitor is induced during human immunodeficiency virus type 1 infection and down regulates the 2-5A/RNase L pathway in human T cells.", "journal": "Journal of virology", "date": "1999", "authors": "Martinand C, Montavon C, Salehzada T, Silhol M, Lebleu B, Bisbal C", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "9847332", "url": "https://glygen.org/publication/PubMed/9847332" } ] }, { "title": "Identification of genes differentially regulated by interferon alpha, beta, or gamma using oligonucleotide arrays.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Der SD, Zhou A, Williams BR, Silverman RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "9861020", "url": "https://glygen.org/publication/PubMed/9861020" } ] }, { "title": "Enzymatic characteristics of recombinant medium isozyme of 2'-5' oligoadenylate synthetase.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Sarkar SN, Bandyopadhyay S, Ghosh A, Sen GC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8983711", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8983711" } ], "reference": [ { "type": "PubMed", "id": "9880569", "url": "https://glygen.org/publication/PubMed/9880569" } ] } ], "pathway": [ { "id": "hsa:4938", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:4938", "resource": "KEGG Pathway" }, { "id": "R-HSA-877300", "name": "Interferon gamma signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300", "resource": "Reactome", "description": "Interferon gamma signaling" }, { "id": "R-HSA-8983711", "name": "OAS antiviral response", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8983711", "resource": "Reactome", "description": "OAS antiviral response" }, { "id": "R-HSA-909733", "name": "Interferon alpha/beta signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733", "resource": "Reactome", "description": "Interferon alpha/beta signaling" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A0J9YV76-1", "protein_name": "2'-5' oligoadenylate synthetase 1E", "gene_name": "Oas1e", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MARELFRTPIWRLDNFIEDQLLPDTTFLTELRADIDSISAFLKERCFQGATHPMRVARVVMGGSYDEHNALKGRSEANMVVFFNDLTSFEDQLKWQQVFIEEIRKHLLQLQQEKPCKLKFEVQSSEEPNTRSLTFKLCSPERQQEVEFDVQPAYDALYEGGYCKSFESINYNKVYAQLIHECTTLEKEGEFSICFTDLHQSFLRYRAPKLWNLIRLVKHWYQLCKEKLRGPLPPQYALELLTVYVWEFGVQDSFGLHAAQCFRTVLELVTKYKCLLIYWTWFYDFRPEISDYLHGQIKKARPLILDPADPTRNVAGSDLQAWDLLAKEAQTWIHSNFFRNCDMSLVNGWEVSLPTVFSGSQAVMDREERKLDFHLSTCWEVLSNSG", "length": 386 }, "evidence": [ { "id": "45935149", "url": "http://www.informatics.jax.org/homology/45935149", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P11928-1", "protein_name": "2'-5'-oligoadenylate synthase 1A", "gene_name": "Oas1a", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MEHGLRSIPAWTLDKFIEDYLLPDTTFGADVKSAVNVVCDFLKERCFQGAAHPVRVSKVVKGGSSGKGTTLKGKSDADLVVFLNNLTSFEDQLNRRGEFIKEIKKQLYEVQHERRFRVKFEVQSSWWPNARSLSFKLSAPHLHQEVEFDVLPAFDVLGHVNTSSKPDPRIYAILIEECTSLGKDGEFSTCFTELQRNFLKQRPTKLKSLIRLVKHWYQLCKEKLGKPLPPQYALELLTVFAWEQGNGCYEFNTAQGFRTVLELVINYQHLRIYWTKYYDFQHQEVSKYLHRQLRKARPVILDPADPTGNVAGGNPEGWRRLAEEADVWLWYPCFIKKDGSRVSSWDVPTVVPVPFEQVEENWTCILL", "length": 367 }, "evidence": [ { "id": "45935146", "url": "http://www.informatics.jax.org/homology/45935146", "database": "MGI" }, { "id": "P00973", "url": "https://omabrowser.org/oma/group/P00973/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q05961-1", "protein_name": "2'-5'-oligoadenylate synthase 1A", "gene_name": "Oas1a", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MEQELRSTPSWKLDKFIEVYLLPNTSFRDDVKSAINVLCDFLKERCFRDTVHPVRVSKVVKGGSSGKGTTLKGKSDADLVVFLNNFTSFEDQLNRRGEFIKEIKKQLYEVQREKHFRVKFEVQSSWWPNPRALSFKLSAPHLQQEVEFDVLPAYDVLGHVSLYSNPDPKIYTILISECISLGKDGEFSTCFTELQRNFLKQRPTKLKSLIRLVKHWYQLCKEKLGKPLPPQYALELLTVYAWERGNGITEFNTAQGFRTILELVTKYQQLRIYWTKYYDFQHPDVSKYLHRQLRKSRPVILDPADPTGNVAGGNQEGWRRLASEARLWLQYPCFMNRGGSPVSSWEVPVDEAWSCILL", "length": 358 }, "evidence": [ { "id": "45935146", "url": "http://www.informatics.jax.org/homology/45935146", "database": "MGI" }, { "id": "45935151", "url": "http://www.informatics.jax.org/homology/45935151", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q14AZ4-1", "protein_name": "2'-5' oligoadenylate synthetase 1F", "gene_name": "Oas1f", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MVKDLSSTPACELDKFIRDHLLPDSSFHAEARADVDFIGAFLKERCFQGATHPVRVSRVVMGGSYDEHTALKSKSEAKMVVFLNNLTSFEEQLKRRGEFIEEIRKHLCQLQDEKPFKVKFEVQSSEEPNSRSLSFKLSSPELQQEVEFDVQPAYDVLYELRNNKYAELYLYNKIYAQLIHECTTLKKEGEFSICFTDLHQSFLEDRAPKLKNLIRLVKHWYQLCKEKLGKPLPPQYALELLTVYAWESGSRDCEFNTAQGFRTVLELVTKYKWLRIYWTVYYDFRKTKVSEYLHKMLQKVRPVILDPADPTRNVAGTNLLGWGLLAKEAAIWLQSSCFRNCDTCLVGPWGVPMKVEIPQDCVLL", "length": 364 }, "evidence": [ { "id": "45935145", "url": "http://www.informatics.jax.org/homology/45935145", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q5BKD0-1", "protein_name": "Inactive 2'-5'-oligoadenylate synthase 1B", "gene_name": "Oas1b", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MEQELRSIPASKLDQFIEVHLPDISFRDELREVIDVLCILLKNRCCRESSHPVRTSKVGKGGSSRKGTTLKGWSDADLVVFLDSFTCFGDQLNRRGEFTKEIKKLLFEVQRDRHIGVKIEVHSSWSPNHRALSFKLSAPDQQKEVKFDVLPAYDLLGHVCIPRKPNPQFYANLISERTSLGKEDEFSTCFTELQLYFLNWRPTKLKSLIRLVKHWYQLCKEKLGDPLPPQYALELLTIYAWERGGRLTKFNTAQGFRTVLELITKYKQLLIYWTVCYDFQHPEVSKYLRRQLKKPRPVILDPANPTGNIAGSNPKGWRRLAGEAAAWLRYPCFKYKDGFPVCPWDVPTEVDIPSQNYFFHIICLIFWLLLRLIFGKHSV", "length": 379 }, "evidence": [ { "id": "45935144", "url": "http://www.informatics.jax.org/homology/45935144", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q5MYW7-1", "protein_name": "2 ' -5 ' oligoadenylate synthetase 1H", "gene_name": "Oas1h", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MEKDLKSTPAWKLDKFIQNHLLADTTFVTEAKADIEFLCDFLTERCFQDASHPVRVSRIVMGGCYDEYSMLKGRSEATLVVFFNNLTRFEDQLKRREELIEEIWKHLCQLQHEKQFKLKFEVQSSEQDNYSSLSIKLSSPQLQQEVEFDVQPAYDVLYELKEKLELDCEFYNKIYARLIRECITLRKEGEFSVCFMELQQKFLWNRPEDLRNLLVLVKHWYQLCKEKLGDSLPPQYALELLTVHAWENEIPAKYGAQTARGFQSVLELIIKYTCLRVYWTFYYDILHQDVSSYLHKQLRKERPVILDPADPTRNVAGLNIDGWCELAKEAEAWLKYPCFRHIDETFVGSWEVPPEKQGGVFL", "length": 362 }, "evidence": [ { "id": "45935147", "url": "http://www.informatics.jax.org/homology/45935147", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q5MYX0-1", "protein_name": "2'-5' oligoadenylate synthetase 1E", "gene_name": "Oas1e", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSRRLARTPIWRLDRFIEDHLLPDTTFLTEVRADIDSICAFLTERCFQGATHPVRVSRIVKGGWFNKYTMLKGRSEATLVVFLNNLTCFEDQLKRREEFTEEIWKHLCQLQQEKQFKLNFEVQSTEQPDSRTLSIKLSSPQLQQEVEFDVQPAYDVLYELRDKDDFNPDNYREIYARLIRESTTLEMEGEFSVCFTDLHQNFLKYRAPKLWNIIRLVKHWYQLCKKRLKYPLPPQYALELLTVYAWERGLEDRPALHTGHCFRSVLDLITEYKKLRIYWTWCYEFKKETFDYLSRQIKKDRPVILDPADPTRNVAGSNIQSWHVLAKEAAVWARSSFFRNSDMTFVNGWKVSAQKQECVYQ", "length": 361 }, "evidence": [ { "id": "45935149", "url": "http://www.informatics.jax.org/homology/45935149", "database": "MGI" }, { "id": "45935148", "url": "http://www.informatics.jax.org/homology/45935148", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q5MYX1-1", "protein_name": "2'-5' oligoadenylate synthase", "gene_name": "Oas1i", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGHGLSSISASELDKFIEVYLLPNTSFGADVKLAINVVCDFLKERCFRGAAHPVRVSKVVKGGSSGKGTTLKGKSDADLVVFLNNLTSFEDQLNRRGEFIKEIKKQLYEVQRERHFGVKFEVQSSWWPNPRALSFKLSAPHLQQEVEFDVLPAYDVLGHVSIYSMPDPQIYASLIRKCMYLGKEGEFSTCFTELQRNFLKRRPTKLKSLIRLVKYWYHLCKEKLGKPLPPQYALELLTVYAWERGNGFVDFETAQGFRAVLELIIKYQELRIYWTTYYNFQHQEVSNYLHTQLTRIRPVILDPADPTGNIAGSNPEGWRRLAGEAAAWLRYPCFKYKDGSPVCPWDVPMEVDVPYQEDHFFRNFCLFFLFLFLFIFWRVSCV", "length": 382 }, "evidence": [ { "id": "45935146", "url": "http://www.informatics.jax.org/homology/45935146", "database": "MGI" }, { "id": "45935151", "url": "http://www.informatics.jax.org/homology/45935151", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q60856-1", "protein_name": "Inactive 2'-5'-oligoadenylate synthase 1B", "gene_name": "Oas1b", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MEQDLRSIPASKLDKFIENHLPDTSFCADLREVIDALCALLKDRSFRGPVRRMRASKGVKGKGTTLKGRSDADLVVFLNNLTSFEDQLNQQGVLIKEIKKQLCEVQHERRCGVKFEVHSLRSPNSRALSFKLSAPDLLKEVKFDVLPAYDLLDHLNILKKPNQQFYANLISGRTPPGKEGKLSICFMGLRKYFLNCRPTKLKRLIRLVTHWYQLCKEKLGDPLPPQYALELLTVYAWEYGSRVTKFNTAQGFRTVLELVTKYKQLQIYWTVYYDFRHQEVSEYLHQQLKKDRPVILDPADPTRNIAGLNPKDWRRLAGEAAAWLQYPCFKYRDGSSVCSWEVPTEVGVPMKYLLCRIFWLLFWSLFHFIFGKTSSG", "length": 376 }, "evidence": [ { "id": "45935144", "url": "http://www.informatics.jax.org/homology/45935144", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q8K469-1", "protein_name": "2'-5' oligoadenylate synthase", "gene_name": "Oas1g", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MEHGLRSIPAWTLDKFIEDYLLPDTTFGADVKSAVNVVCDFLKERCFQGAAHPVRVSKVVKGGSSGKGTTLKGRSDADLVVFLNNLTSFEDQLNRRGEFIKEIKKQLYEVQHERRFRVKFEVQSSWWPNARSLSFKLSAPHLHQEVEFDVLPAFDVLGHGSINKKPNPLIYTILIWECTSLGKDGEFSTCFTELQRNFLKQRPTKLKSLIRLVKHWYQLCKEKLGKPLPPQYALELLTVYAWEQGNGCNEFNTAQGFRTVLELVINYQHLRIYWTKYYDFQHKEVSKYLHRQLRKARPVILDPADPTGNVAGGNPEGWRRLAEEADVWLWYPCFMKNDGSRVSSWDVPTVVPVPFEQVEENWTCILL", "length": 367 }, "evidence": [ { "id": "45935151", "url": "http://www.informatics.jax.org/homology/45935151", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q8VI95-1", "protein_name": "Inactive 2'-5'-oligoadenylate synthase 1D", "gene_name": "Oas1d", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MARELFRTPIWRLDKFIEDQLLPDTTFLTELRADIDSISAFLMERCFQGAAHPVRVSRVVMGGCYNEYTVLKGRSEANMVVFLINLTSFEDQFNGQVVFIEEIWRHLLQLQQEKLCKLKFEVQSPKEPNSRFLSFKLSCPERQHELEFDVQPAYDALYEVRHFKPFDSSNYNKVYAQLTHECTTLEKEGEFSICFTDLHQSFLRYRAPKLWNLIRLVKHWYQLCKEKLRGPLPPQYALELLTVYVWEYGIHENPGLHTAQCFRTVLELVTKYKRLRIYWTWCYDFQHEISDYLQGQIKKARPLILDPADPTRNVAGSDLQAWDLLAKEAQIWIDSTFFTNHDMSIVEAWEVMPERQECVFL", "length": 361 }, "evidence": [ { "id": "45935148", "url": "http://www.informatics.jax.org/homology/45935148", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q8VI97-1", "protein_name": "2',5'-oligoadenylate synthetase-like 6", "gene_name": "Oas1h", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAKNLSSTRIALCSTPAWRLDKFIEGHLLGDITFLTELRTDVNSISAFLKERCFQGAAHPMRVSRVVMGGSYNRYTVLKGRSEVDLLVFFNNLTCFDDQFKLQKEVIEEIQKHLCQFQQEKRLREKFKVQSSDQPNFRSVSFKLSYPKFQQEVEFHMQTAYDALYEVRRKENHNCEIYNKVYARLIRECTMLGKEGEFNICFMELQQDFLWKRPCELKNLICLVKHWYQLCKEKLREPLPPQYALELLTVYAWEHELPDKHETQTARGFRTVLELITKYLCLRIYWTLYYDVLHEQVNAYLYSQVKRVSPLILDPADPTWNVAGLNLQGWCILAEEAKAWLDYPCFKNRDGSRVSSWDVPPDKKGFVFL", "length": 369 }, "evidence": [ { "id": "45935147", "url": "http://www.informatics.jax.org/homology/45935147", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q924S2-1", "protein_name": "Inactive 2'-5' oligoadenylate synthetase 1C", "gene_name": "Oas1c", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MENGLCSIQARELDEFICDYLFPDTTFLTELRADIDSISAFLKERCFQGAAHPVRVSRVVMGGSYDEHTALKGKSEAKMVLFFNNLTSFEEQLKRRGEFVEEIQKHLCQLQQEKPFKVKFEVQSSEEPNSRSLSFKLSSPELQQEVEFDVQPAYDVLYELRNNTYAEPQFYNKVYAQLIHECTTLEKEGDFSICFTDLHQNFMRYRAPKLWNLIRLVKHWYQLCKEKLREPLPPQYALELLTVYVWEHSNKNQEKVTTAKNFRTFLELVAYYKNLRIYWTWYYDFRHQEVCAYLCRQLKKARPLILDPADPTRNVAGSDLQAWDLLAKEAQTWMQSSCFRNCDMSFVPTWDLSPERQECAFQ", "length": 362 }, "evidence": [ { "id": "45935150", "url": "http://www.informatics.jax.org/homology/45935150", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "nucleotidyltransferase activity", "id": "GO:0016779", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016779", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "2'-5'-oligoadenylate synthetase activity", "id": "GO:0001730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001730", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "double-stranded RNA binding", "id": "GO:0003725", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003725", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 9, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "ribosome", "id": "GO:0005840", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005840", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 25, "go_terms": [ { "name": "innate immune response", "id": "GO:0045087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "defense response to virus", "id": "GO:0051607", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051607", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "interleukin-27-mediated signaling pathway", "id": "GO:0070106", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070106", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "negative regulation of chemokine (C-X-C motif) ligand 2 production", "id": "GO:2000342", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000342", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "cellular response to interferon-alpha", "id": "GO:0035457", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035457", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "surfactant homeostasis", "id": "GO:0043129", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043129", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "protein complex oligomerization", "id": "GO:0051259", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051259", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "negative regulation of viral genome replication", "id": "GO:0045071", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045071", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "type I interferon-mediated signaling pathway", "id": "GO:0060337", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060337", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "response to virus", "id": "GO:0009615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009615", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "glucose homeostasis", "id": "GO:0042593", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042593", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "glucose metabolic process", "id": "GO:0006006", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006006", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "positive regulation of tumor necrosis factor production", "id": "GO:0032760", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032760", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "defense response to bacterium", "id": "GO:0042742", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042742", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "positive regulation of monocyte chemotactic protein-1 production", "id": "GO:0071639", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071639", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "cellular response to interferon-beta", "id": "GO:0035458", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035458", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "cellular response to virus", "id": "GO:0098586", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098586", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "positive regulation of cellular respiration", "id": "GO:1901857", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901857", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "toll-like receptor 4 signaling pathway", "id": "GO:0034142", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034142", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "positive regulation of interferon-beta production", "id": "GO:0032728", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032728", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "toll-like receptor 3 signaling pathway", "id": "GO:0034138", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034138", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "negative regulation of type I interferon-mediated signaling pathway", "id": "GO:0060339", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060339", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "regulation of ribonuclease activity", "id": "GO:0060700", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060700", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "antiviral innate immune response", "id": "GO:0140374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140374", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" }, { "name": "negative regulation of IP-10 production", "id": "GO:0071659", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071659", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "Not prenylated at C-terminal. The non-prenylated form is diffusely localized and unable to initiate a detectable block to SARS-CoV-2 replication.", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" }, { "database": "PubMed", "id": "34581622", "url": "https://glygen.org/publication/PubMed/34581622" } ] }, { "annotation": "Prenylated at C-terminal. C-terminal prenylation is necessary to initiate a block to SARS-CoV-2 and is associated with protection from severe COVID-1. The prenylated form is targeted to perinuclear structures rich in viral dsRNA, whereas the non-prenylated form is diffusely localized and unable to initiate a detectable block to SARS-CoV-2 replication (Probable). C-terminal prenylation is also necessary to initiate a block to cardiovirus EMCV (Probable).", "evidence": [ { "database": "UniProtKB", "id": "P00973", "url": "https://www.uniprot.org/uniprot/P00973" }, { "database": "PubMed", "id": "34581622", "url": "https://glygen.org/publication/PubMed/34581622" } ] } ], "interactions": [], "reactions": [ { "id": "34407", "name": "", "equation": "3 ATP = 5'-triphosphoadenylyl-(2'->5')-adenylyl-(2'->5')-adenosine + 2 diphosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q5MYT7-1", "Q5MYT9-1", "Q05961-1", "Q5MYU0-1", "Q5BKD0-1", "Q5MYX1-1", "P00973-1", "P29728-1", "Q9Y6K5-1", "Q8VI93-1", "E9Q9A9-1", "Q9Z2F2-1", "P11928-1", "Q8K469-1" ], "evidence": [ { "id": "34407", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/34407" } ] }, { "id": "R-HSA-1015702", "name": "Expression of IFN-induced genes", "equation": "", "summary": "Around 300 IFN-induced genes have been identified from different oligonucleotide microarray studies in melanoma (WM9) and fibrosarcoma (HT1080) cell lines as well as from human dendritic cells treated with IFN. Only the proteins which are well studied and their function characterized are represented here.", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9UHH9-1", "Q8WXG1-1", "Q9Y3Z3-1", "P32456-1", "Q9Y6K5-1", "Q96AZ6-1", "P00973-1", "P55265-1", "P19525-1", "Q05823-1", "P29728-1", "P28062-1" ], "evidence": [ { "id": "R-HSA-1015702", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1015702" } ] }, { "id": "R-HSA-1031716", "name": "Expression of IFNG-stimulated genes", "equation": "", "summary": "IFN-gamma stimulates gene expression of about 200 genes which include the primary response genes like IRFs, Fc-gamma receptor (FCGR), GBPs (guanylate-binding proteins) and also major histocompatibility complex (MHC) class I and class II molecules, proteins involved in antigen presentation, antiviral proteins like PKR, OAS proteins etc. A wonderful list of most of the IFN-gamma inducible proteins with corresponding literature are mentioned in the review article and the supplementary document by Boehm et al 1997.", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P29590-1", "P13284-1", "P32456-1", "Q9BVG3-1", "Q9C035-1", "Q9Y6K5-1", "Q9BYJ4-1", "Q9BZR9-1", "Q9H8W5-1", "Q9UPQ4-1", "Q9Y577-1", "P00973-1", "Q12899-1", "Q9C040-1", "Q8N8V2-1", "Q9H0R5-1", "O00635-1", "Q6ZN66-1", "O75382-1", "O15344-1", "Q14258-1", "P33076-1", "P19474-1", "Q9BZY9-1", "P29728-1", "P32455-1", "Q96PP8-1", "Q96PP9-1", "Q9C030-1", "Q6AZZ1-1", "Q8IWZ4-1", "Q8IYM9-1" ], "evidence": [ { "id": "R-HSA-1031716", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1031716" } ] }, { "id": "R-HSA-8983671", "name": "OAS1 binds viral dsRNA", "equation": "", "summary": "Human oligoadenylate synthetase 1 (OAS1) recognizes double-stranded RNA (dsRNA) typically produced by viral infections. The X-ray crystal structure of human OAS1 bound to a model 18-bp dsRNA duplex revealed that dsRNA binding allosterically drives a functionally essential structural reorganization within human OAS1 that narrows the adenosine triphosphate (ATP)-binding cleft and repositions a catalytic residue to complete its active site (Donovan J et al. 2013). Once stimulated by dsRNA, OAS1 uses ATP to synthesize a series of 5'-triphosphorylated 2'-5'-linked oligoadenylates containing 2 to greater than 5 adenylyl residues. The 5'-triphosphorylated 2'-5\u2019-linked triadenylate (i.e., ppp5\u2019A2\u2019p5\u2019A2\u2019p5\u2019A) is typically the most abundant active species (Kerr IM & Brown RE 1978).", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P00973-1" ], "evidence": [ { "id": "R-HSA-8983671", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8983671" } ] }, { "id": "R-HSA-8983680", "name": "OAS1 produces oligoadenylates", "equation": "", "summary": "Oligoadenylate synthetase 1 (OAS1) produces the second messenger 5\u2019-triphosphorylated 2'-5'-oligoadenylate (2-5A), which limits viral propagation through the activation of the enzyme RNase L (reviewed by Silverman RH 2007; Hornung V et al. 2014). OAS1 produces 2-5A from ATP by transferring an AMP unit from the AMP donor substrate (ATP) to the 2\u2032-hydroxyl group of an AMP acceptor substrate, ATP or a preformed 2-5A oligomer (Lohofener J et al. 2015). This produces a 2-5A dimer (ppp5'A(2'-5')A) or an elongated 2-5A oligomer (ppp5'A((2'-5')A)n), as well as one molecule of pyrophosphate (PPi) for each AMP residue added (Lohofener J et al. 2015). Structural studies showed that RNA-induced conformational rearrangement in OAS1 positions the active site residues D75, D77, and D148 compactly for coordination of two Mg2+ ions and for binding of ATP (Donovan J et al. 2013). The assembly of this critical active-site structure of OAS1 provides the gate that couples binding of dsRNA to the production and downstream functions of 2-5A, enabling OAS1 to function as a sensor of double-stranded RNA (dsRNA) (Donovan J et al. 2013).", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P00973-1" ], "evidence": [ { "id": "R-HSA-8983680", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8983680" } ] }, { "id": "R-HSA-8983688", "name": "OAS1 oligomerizes", "equation": "", "summary": "The tetramerization of 2'-5'-oligoadenylate synthetase OAS1 is required for enzymatic activity (Ghosh A et al. 1997).", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P00973-1" ], "evidence": [ { "id": "R-HSA-8983688", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8983688" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "E9Q9A9", "gene_name": "Oas2", "activity": [ { "ec_number": "2.7.7.84", "activity": "3 ATP = 5'-triphosphoadenylyl-(2'->5')-adenylyl-(2'->5')-adenosine + 2 diphosphate.", "evidence": [ { "id": "E9Q9A9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q9A9" } ] }, { "ec_number": "2.7.7.84", "activity": "", "evidence": [ { "id": "E9Q9A9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q9A9" } ] } ] }, { "uniprot_ac": "O00635", "gene_name": "TRIM38", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "O00635", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00635" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "O00635", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00635" } ] } ] }, { "uniprot_ac": "O15344", "gene_name": "MID1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "O15344", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15344" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "O15344", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15344" } ] } ] }, { "uniprot_ac": "O75382", "gene_name": "TRIM3", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "O75382", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75382" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "O75382", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75382" } ] } ] }, { "uniprot_ac": "P00973", "gene_name": "OAS1", "activity": [ { "ec_number": "2.7.7.84", "activity": "3 ATP = 5'-triphosphoadenylyl-(2'->5')-adenylyl-(2'->5')-adenosine + 2 diphosphate.", "evidence": [ { "id": "P00973", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00973" } ] }, { "ec_number": "2.7.7.84", "activity": "", "evidence": [ { "id": "P00973", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00973" } ] } ] }, { "uniprot_ac": "P11928", "gene_name": "Oas1a", "activity": [ { "ec_number": "2.7.7.84", "activity": "3 ATP = 5'-triphosphoadenylyl-(2'->5')-adenylyl-(2'->5')-adenosine + 2 diphosphate.", "evidence": [ { "id": "P11928", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11928" } ] }, { "ec_number": "2.7.7.84", "activity": "", "evidence": [ { "id": "P11928", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11928" } ] } ] }, { "uniprot_ac": "P13284", "gene_name": "IFI30", "activity": [ { "ec_number": "1.8.-.-", "activity": "", "evidence": [ { "id": "P13284", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13284" } ] } ] }, { "uniprot_ac": "P19474", "gene_name": "TRIM21", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "P19474", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19474" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "P19474", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19474" } ] } ] }, { "uniprot_ac": "P19525", "gene_name": "EIF2AK2", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "P19525", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19525" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P19525", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19525" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P19525", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19525" } ] } ] }, { "uniprot_ac": "P28062", "gene_name": "PSMB8", "activity": [ { "ec_number": "3.4.25.1", "activity": "Cleavage of peptide bonds with very broad specificity.", "evidence": [ { "id": "P28062", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28062" } ] }, { "ec_number": "3.4.25.1", "activity": "", "evidence": [ { "id": "P28062", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28062" } ] } ] }, { "uniprot_ac": "P29590", "gene_name": "PML", "activity": [ { "ec_number": "2.3.2.-", "activity": "", "evidence": [ { "id": "P29590", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29590" } ] } ] }, { "uniprot_ac": "P29728", "gene_name": "OAS2", "activity": [ { "ec_number": "2.7.7.84", "activity": "3 ATP = 5'-triphosphoadenylyl-(2'->5')-adenylyl-(2'->5')-adenosine + 2 diphosphate.", "evidence": [ { "id": "P29728", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29728" } ] }, { "ec_number": "2.7.7.84", "activity": "", "evidence": [ { "id": "P29728", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29728" } ] } ] }, { "uniprot_ac": "P32455", "gene_name": "GBP1", "activity": [ { "ec_number": "3.6.1.-", "activity": "", "evidence": [ { "id": "P32455", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32455" } ] }, { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P32455", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32455" } ] } ] }, { "uniprot_ac": "P32456", "gene_name": "GBP2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P32456", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32456" } ] } ] }, { "uniprot_ac": "P33076", "gene_name": "CIITA", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P33076", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33076" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "P33076", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33076" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P33076", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33076" } ] } ] }, { "uniprot_ac": "P55265", "gene_name": "ADAR", "activity": [ { "ec_number": "3.5.4.37", "activity": "adenosine in double-stranded RNA + H(+) + H2O = inosine in double-stranded RNA + NH4(+).", "evidence": [ { "id": "P55265", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55265" } ] }, { "ec_number": "3.5.4.37", "activity": "", "evidence": [ { "id": "P55265", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55265" } ] } ] }, { "uniprot_ac": "Q05823", "gene_name": "RNASEL", "activity": [ { "ec_number": "3.1.26.-", "activity": "", "evidence": [ { "id": "Q05823", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05823" } ] } ] }, { "uniprot_ac": "Q05961", "gene_name": "Oas1a", "activity": [ { "ec_number": "2.7.7.84", "activity": "3 ATP = 5'-triphosphoadenylyl-(2'->5')-adenylyl-(2'->5')-adenosine + 2 diphosphate.", "evidence": [ { "id": "Q05961", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05961" } ] }, { "ec_number": "2.7.7.84", "activity": "", "evidence": [ { "id": "Q05961", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05961" } ] } ] }, { "uniprot_ac": "Q12899", "gene_name": "TRIM26", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q12899", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12899" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q12899", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12899" } ] } ] }, { "uniprot_ac": "Q14258", "gene_name": "TRIM25", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q14258", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14258" } ] }, { "ec_number": "6.3.2.n3", "activity": "ATP + [ISG15] + [protein]-lysine = AMP + diphosphate + [protein]-N-ISGyllysine.", "evidence": [ { "id": "Q14258", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14258" } ] }, { "ec_number": "6.3.2.n3", "activity": "", "evidence": [ { "id": "Q14258", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14258" } ] } ] }, { "uniprot_ac": "Q5BKD0", "gene_name": "Oas1b", "activity": [ { "ec_number": "2.7.7.84", "activity": "3 ATP = 5'-triphosphoadenylyl-(2'->5')-adenylyl-(2'->5')-adenosine + 2 diphosphate.", "evidence": [ { "id": "Q5BKD0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BKD0" } ] }, { "ec_number": "2.7.7.84", "activity": "", "evidence": [ { "id": "Q5BKD0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BKD0" } ] } ] }, { "uniprot_ac": "Q5MYT7", "gene_name": "Oas3", "activity": [ { "ec_number": "2.7.7.84", "activity": "3 ATP = 5'-triphosphoadenylyl-(2'->5')-adenylyl-(2'->5')-adenosine + 2 diphosphate.", "evidence": [ { "id": "Q5MYT7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5MYT7" } ] }, { "ec_number": "2.7.7.84", "activity": "", "evidence": [ { "id": "Q5MYT7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5MYT7" } ] } ] }, { "uniprot_ac": "Q5MYT9", "gene_name": "Oasl2", "activity": [ { "ec_number": "2.7.7.84", "activity": "3 ATP = 5'-triphosphoadenylyl-(2'->5')-adenylyl-(2'->5')-adenosine + 2 diphosphate.", "evidence": [ { "id": "Q5MYT9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5MYT9" } ] }, { "ec_number": "2.7.7.84", "activity": "", "evidence": [ { "id": "Q5MYT9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5MYT9" } ] } ] }, { "uniprot_ac": "Q5MYU0", "gene_name": "Oas2", "activity": [ { "ec_number": "2.7.7.84", "activity": "3 ATP = 5'-triphosphoadenylyl-(2'->5')-adenylyl-(2'->5')-adenosine + 2 diphosphate.", "evidence": [ { "id": "Q5MYU0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5MYU0" } ] }, { "ec_number": "2.7.7.84", "activity": "", "evidence": [ { "id": "Q5MYU0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5MYU0" } ] } ] }, { "uniprot_ac": "Q5MYX1", "gene_name": "Oas1i", "activity": [ { "ec_number": "2.7.7.84", "activity": "3 ATP = 5'-triphosphoadenylyl-(2'->5')-adenylyl-(2'->5')-adenosine + 2 diphosphate.", "evidence": [ { "id": "Q5MYX1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5MYX1" } ] }, { "ec_number": "2.7.7.84", "activity": "", "evidence": [ { "id": "Q5MYX1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5MYX1" } ] } ] }, { "uniprot_ac": "Q6AZZ1", "gene_name": "TRIM68", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q6AZZ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AZZ1" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q6AZZ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AZZ1" } ] } ] }, { "uniprot_ac": "Q6ZN66", "gene_name": "GBP6", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q6ZN66", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZN66" } ] } ] }, { "uniprot_ac": "Q8IWZ4", "gene_name": "TRIM48", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8IWZ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IWZ4" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q8IWZ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IWZ4" } ] } ] }, { "uniprot_ac": "Q8IYM9", "gene_name": "TRIM22", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8IYM9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IYM9" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q8IYM9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IYM9" } ] } ] }, { "uniprot_ac": "Q8K469", "gene_name": "Oas1g", "activity": [ { "ec_number": "2.7.7.84", "activity": "3 ATP = 5'-triphosphoadenylyl-(2'->5')-adenylyl-(2'->5')-adenosine + 2 diphosphate.", "evidence": [ { "id": "Q8K469", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K469" } ] }, { "ec_number": "2.7.7.84", "activity": "", "evidence": [ { "id": "Q8K469", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K469" } ] } ] }, { "uniprot_ac": "Q8N8V2", "gene_name": "GBP7", "activity": [ { "ec_number": "3.6.1.-", "activity": "", "evidence": [ { "id": "Q8N8V2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N8V2" } ] }, { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8N8V2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N8V2" } ] } ] }, { "uniprot_ac": "Q8VI93", "gene_name": "Oas3", "activity": [ { "ec_number": "2.7.7.84", "activity": "3 ATP = 5'-triphosphoadenylyl-(2'->5')-adenylyl-(2'->5')-adenosine + 2 diphosphate.", "evidence": [ { "id": "Q8VI93", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VI93" } ] }, { "ec_number": "2.7.7.84", "activity": "", "evidence": [ { "id": "Q8VI93", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VI93" } ] } ] }, { "uniprot_ac": "Q8WXG1", "gene_name": "RSAD2", "activity": [ { "ec_number": "4.2.-.-", "activity": "", "evidence": [ { "id": "Q8WXG1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WXG1" } ] } ] }, { "uniprot_ac": "Q96AZ6", "gene_name": "ISG20", "activity": [ { "ec_number": "3.1.13.1", "activity": "Exonucleolytic cleavage in the 3'- to 5'-direction to yield nucleoside 5'-phosphates.", "evidence": [ { "id": "Q96AZ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96AZ6" } ] }, { "ec_number": "3.1.13.1", "activity": "", "evidence": [ { "id": "Q96AZ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96AZ6" } ] } ] }, { "uniprot_ac": "Q96PP8", "gene_name": "GBP5", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q96PP8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96PP8" } ] } ] }, { "uniprot_ac": "Q96PP9", "gene_name": "GBP4", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q96PP9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96PP9" } ] } ] }, { "uniprot_ac": "Q9BVG3", "gene_name": "TRIM62", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9BVG3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BVG3" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9BVG3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BVG3" } ] } ] }, { "uniprot_ac": "Q9BYJ4", "gene_name": "TRIM34", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9BYJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BYJ4" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9BYJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BYJ4" } ] } ] }, { "uniprot_ac": "Q9BZR9", "gene_name": "TRIM8", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9BZR9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BZR9" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9BZR9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BZR9" } ] } ] }, { "uniprot_ac": "Q9BZY9", "gene_name": "TRIM31", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9BZY9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BZY9" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9BZY9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BZY9" } ] } ] }, { "uniprot_ac": "Q9C030", "gene_name": "TRIM6", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9C030", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9C030" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9C030", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9C030" } ] } ] }, { "uniprot_ac": "Q9C035", "gene_name": "TRIM5", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9C035", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9C035" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9C035", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9C035" } ] } ] }, { "uniprot_ac": "Q9C040", "gene_name": "TRIM2", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9C040", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9C040" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9C040", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9C040" } ] } ] }, { "uniprot_ac": "Q9H0R5", "gene_name": "GBP3", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9H0R5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H0R5" } ] } ] }, { "uniprot_ac": "Q9H8W5", "gene_name": "TRIM45", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9H8W5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H8W5" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9H8W5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H8W5" } ] } ] }, { "uniprot_ac": "Q9UHH9", "gene_name": "IP6K2", "activity": [ { "ec_number": "2.7.-.-", "activity": "", "evidence": [ { "id": "Q9UHH9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UHH9" } ] }, { "ec_number": "2.7.4.-", "activity": "", "evidence": [ { "id": "Q9UHH9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UHH9" } ] } ] }, { "uniprot_ac": "Q9UPQ4", "gene_name": "TRIM35", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9UPQ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UPQ4" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9UPQ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UPQ4" } ] } ] }, { "uniprot_ac": "Q9Y3Z3", "gene_name": "SAMHD1", "activity": [ { "ec_number": "3.1.5.-", "activity": "", "evidence": [ { "id": "Q9Y3Z3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y3Z3" } ] } ] }, { "uniprot_ac": "Q9Y577", "gene_name": "TRIM17", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9Y577", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y577" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9Y577", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y577" } ] } ] }, { "uniprot_ac": "Q9Y6K5", "gene_name": "OAS3", "activity": [ { "ec_number": "2.7.7.84", "activity": "3 ATP = 5'-triphosphoadenylyl-(2'->5')-adenylyl-(2'->5')-adenosine + 2 diphosphate.", "evidence": [ { "id": "Q9Y6K5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6K5" } ] }, { "ec_number": "2.7.7.84", "activity": "", "evidence": [ { "id": "Q9Y6K5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6K5" } ] } ] }, { "uniprot_ac": "Q9Z2F2", "gene_name": "Oasl2", "activity": [ { "ec_number": "2.7.7.84", "activity": "3 ATP = 5'-triphosphoadenylyl-(2'->5')-adenylyl-(2'->5')-adenosine + 2 diphosphate.", "evidence": [ { "id": "Q9Z2F2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2F2" } ] }, { "ec_number": "2.7.7.84", "activity": "", "evidence": [ { "id": "Q9Z2F2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2F2" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 153 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }