{ "uniprot_canonical_ac": "P00749-1", "uniprot_ac": "P00749", "uniprot_id": "UROK_HUMAN", "mass": { "chemical_mass": 48523.0, "monoisotopic_mass": 48523.0 }, "refseq": { "ac": "NP_001138503", "name": "urokinase-type plasminogen activator isoform 2", "summary": "This gene encodes a secreted serine protease that converts plasminogen to plasmin. The encoded preproprotein is proteolytically processed to generate A and B polypeptide chains. These chains associate via a single disulfide bond to form the catalytically inactive high molecular weight urokinase-type plasminogen activator (HMW-uPA). HMW-uPA can be further processed into the catalytically active low molecular weight urokinase-type plasminogen activator (LMW-uPA). This low molecular weight form does not bind to the urokinase-type plasminogen activator receptor. Mutations in this gene may be associated with Quebec platelet disorder and late-onset Alzheimer's disease. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138503" }, "gene_names": [ { "name": "PLAU", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P00749", "id": "P00749" }, { "name": "ATF; BDPLT5; QPD; u-PA; UPA; URK", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138503", "id": "NP_001138503" }, { "name": "PLAU", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138503", "id": "NP_001138503" } ], "protein_names": [ { "name": "Urokinase-type plasminogen activator", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P00749" }, { "name": "3.4.21.73", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P00749" }, { "name": "U-plasminogen activator", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P00749" }, { "name": "plasminogen activator, urinary; U-plasminogen activator; urokinase-type plasminogen activator", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138503", "id": "NP_001138503" }, { "name": "uPA", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P00749" }, { "name": "urokinase-type plasminogen activator isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138503", "id": "NP_001138503" } ], "function": [ { "annotation": "M6A Methyltransferase, WTAP, Promotes Cancer Progression in Laryngeal Squamous Cell Carcinoma by Regulating PLAU Stability.", "evidence": [ { "database": "RefSeq", "id": "NP_001138503", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138503" }, { "database": "PubMed", "id": "37094860", "url": "https://glygen.org/publication/PubMed/37094860" } ] }, { "annotation": "PLAU contributes to the development of cholangiocarcinoma via activating NF-kappaB signaling pathway.", "evidence": [ { "database": "RefSeq", "id": "NP_001138503", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138503" }, { "database": "PubMed", "id": "37067236", "url": "https://glygen.org/publication/PubMed/37067236" } ] }, { "annotation": "Pan-cancer analysis of PLAU indicates its potential prognostic value and correlation with neutrophil infiltration in BLCA.", "evidence": [ { "database": "RefSeq", "id": "NP_001138503", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138503" }, { "database": "PubMed", "id": "38000776", "url": "https://glygen.org/publication/PubMed/38000776" } ] }, { "annotation": "Prognostic evaluation of oral squamous cell carcinoma based on pleiotrophin, urokinase plasminogen activator, and glycoprotein nonmetastatic melanoma protein B expression.", "evidence": [ { "database": "RefSeq", "id": "NP_001138503", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138503" }, { "database": "PubMed", "id": "37960806", "url": "https://glygen.org/publication/PubMed/37960806" } ] }, { "annotation": "Recent Advances in Targeting the Urokinase Plasminogen Activator with Nanotherapeutics. Review article", "evidence": [ { "database": "RefSeq", "id": "NP_001138503", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138503" }, { "database": "PubMed", "id": "37119285", "url": "https://glygen.org/publication/PubMed/37119285" } ] }, { "annotation": "Specifically cleaves the zymogen plasminogen to form the active enzyme plasmin.", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749#function" }, { "database": "UniProtKB", "id": "E7ET40", "url": "https://www.uniprot.org/uniprot/E7ET40#function" }, { "database": "UniProtKB", "id": "ARBA00004018", "url": "https://www.uniprot.org/uniprot/ARBA00004018#function" } ] }, { "annotation": "This gene encodes a secreted serine protease that converts plasminogen to plasmin. The encoded preproprotein is proteolytically processed to generate A and B polypeptide chains. These chains associate via a single disulfide bond to form the catalytically inactive high molecular weight urokinase-type plasminogen activator (HMW-uPA). HMW-uPA can be further processed into the catalytically active low molecular weight urokinase-type plasminogen activator (LMW-uPA). This low molecular weight form does not bind to the urokinase-type plasminogen activator receptor. Mutations in this gene may be associated with Quebec platelet disorder and late-onset Alzheimer's disease. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016].", "evidence": [ { "database": "RefSeq", "id": "NP_001138503", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138503" } ] } ], "disease": [ { "disease_id": "DOID:0111050", "recommended_name": { "id": "DOID:0111050", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111050", "name": "Quebec platelet disorder", "description": "A blood platelet disease characterized by autosomal dominant inheritance of delayed onset bleeding after challenge, moderate to severe bleeding tendencies, frequent ecchymoses, mucocutaneous bleeding, muscle and joint bleeds and platelet alpha-granule degredation that has_material_basis_in heterozygous tandem duplication of the PLAU gene on chromosome 10q22." }, "synonyms": [ { "id": "DOID:0111050", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111050", "name": "BDPLT5", "description": "" }, { "id": "DOID:0111050", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111050", "name": "factor V Quebec", "description": "" }, { "id": "DOID:0111050", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111050", "name": "platelet-type bleeding disorder 5", "description": "" }, { "id": "MONDO:0011136", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011136", "name": "Quebec platelet disorder", "description": "Quebec platelet syndrome (QPS) is a platelet granule disorder characterized by moderate to severe bleeding after trauma, surgery or obstetric interventions, frequent ecchymoses, mucocutaneous bleeding and muscle and joint bleeds." }, { "id": "MONDO:0011136", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011136", "name": "BDPLT5", "description": "" }, { "id": "MONDO:0011136", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011136", "name": "Quebec platelet disorder", "description": "" }, { "id": "MONDO:0011136", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011136", "name": "factor V Quebec", "description": "" }, { "id": "MONDO:0011136", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011136", "name": "platelet-type bleeding disorder 5", "description": "" }, { "id": "MONDO:0011136", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011136", "name": "QPD", "description": "" }, { "id": "MONDO:0011136", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011136", "name": "bleeding disorder, platelet-type, 5", "description": "" }, { "id": "MONDO:0011136", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011136", "name": "factor 5 Quebec", "description": "" }, { "id": "MIM:601709", "resource": "MIM", "url": "https://www.omim.org/entry/601709", "name": "Quebec platelet disorder", "description": "Quebec platelet disorder" } ], "evidence": [ { "id": "601709", "database": "MIM", "url": "https://www.omim.org/entry/601709" } ] } ], "snv": [ { "evidence": [ { "id": "rs1265304910", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1265304910" }, { "id": "rs1265304910", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1265304910#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 158, "end_pos": 158, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).", "chr_id": "10", "chr_pos": "73913551", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S158", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1001108568", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1001108568" }, { "id": "rs1001108568", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1001108568" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 191, "end_pos": 191, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NQP->NQS).", "chr_id": "10", "chr_pos": "73913649", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P191", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1001108568", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1001108568" }, { "id": "rs1001108568", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1001108568" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 191, "end_pos": 191, "sequence_org": "P", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NQP->NQT).", "chr_id": "10", "chr_pos": "73913649", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P191", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1591616949", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1591616949" }, { "id": "rs1591616949", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1591616949" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 247, "end_pos": 247, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSN->NST).", "chr_id": "10", "chr_pos": "73914039", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N247", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs867805475", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs867805475" }, { "id": "rs867805475", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs867805475" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 264, "end_pos": 264, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DYS->NYS).", "chr_id": "10", "chr_pos": "73914089", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D264", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs771903964", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771903964" }, { "id": "rs771903964", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771903964" }, { "id": "rs771903964", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs771903964#frequency_tab" }, { "id": "rs771903964", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771903964" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 276, "end_pos": 276, "sequence_org": "I", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NDI->NDT).", "chr_id": "10", "chr_pos": "73914126", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I276", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1478820563", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1478820563" }, { "id": "rs1478820563", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1478820563#frequency_tab" }, { "id": "rs1478820563", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1478820563" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 38, "end_pos": 38, "sequence_org": "T", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->R).", "chr_id": "10", "chr_pos": "73912242", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T38", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1208425827", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1208425827" }, { "id": "rs1208425827", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1208425827" }, { "id": "rs1208425827", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1208425827#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 81, "end_pos": 81, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KAS->NAS).", "chr_id": "10", "chr_pos": "73912973", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K81", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 158, "end_pos": 158, "sequence_org": "S", "sequence_mut": "E", "comment": "Abolishes phosphorylation, proadhesive function and ability to induce chemotactic response; when associated with E-323.", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" }, { "database": "PubMed", "id": "9151681", "url": "https://glygen.org/publication/PubMed/9151681" } ] }, { "start_pos": 323, "end_pos": 323, "sequence_org": "S", "sequence_mut": "E", "comment": "Abolishes phosphorylation, proadhesive function and ability to induce chemotactic response; when associated with E-158.", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" }, { "database": "PubMed", "id": "9151681", "url": "https://glygen.org/publication/PubMed/9151681" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "82.77", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000122861", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000122861" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "69.15", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000122861", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000122861" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "70.57", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000122861", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000122861" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "65.56", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000122861", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000122861" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "81.49", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000122861", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000122861" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "88.1", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000122861", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000122861" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "56.55", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000122861", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000122861" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "74.64", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000122861", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000122861" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "83.52", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000122861", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000122861" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "68.15", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000122861", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000122861" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "61.92", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000122861", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000122861" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "78.89", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000122861", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000122861" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "85.38", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000122861", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000122861" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P00749", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00749" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P00749", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00749" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P00749", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00749" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P00749", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00749" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P00749", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00749" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P00749", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00749" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P00749", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00749" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P00749", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00749" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P00749", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00749" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P00749", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00749" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P00749", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00749" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P00749", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00749" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "common_name": "Human" } ], "gene": [ { "name": "PLAU", "url": "https://www.uniprot.org/uniprot/P00749", "locus": { "chromosome": "10", "start_pos": 73917496, "end_pos": 73909177, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000122861", "url": "https://www.ensembl.org/id/ENSG00000122861" } ] } } ], "crossref": [ { "id": "ENSG00000122861", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000122861", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "3.4.21.73", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.4.21.73&UniProtAcc=P00749", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd00108", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00108", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd00190", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00190", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL3286", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3286", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "PLAU", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=PLAU", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "5328", "url": "https://www.ncbi.nlm.nih.gov/gene/5328", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "612", "url": "https://glyconnect.expasy.org/browser/proteins/612", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "86", "url": "https://glyconnect.expasy.org/browser/proteins/86", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "9052", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=9052", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P00749", "url": "https://www.ebi.ac.uk/intact/interactors/id:P00749*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000001", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000001", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000742", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000742", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001254", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001254", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001314", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001314", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009003", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009003", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013806", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013806", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018056", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018056", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018114", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018114", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033116", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033116", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038178", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038178", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043504", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043504", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:5328", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5328", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "191840", "url": "http://www.omim.org/entry/191840", "database": "MIM", "categories": [ "Other" ] }, { "id": "601709", "url": "http://www.omim.org/entry/601709", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P00749", "url": "https://www.nextprot.org/entry/NX_P00749", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "WPWCYVQ", "url": "https://omabrowser.org/oma/group/WPWCYVQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4629979at2759", "url": "http://www.orthodb.org/?query=4629979at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24264", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24264", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24264:SF38", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24264:SF38", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1C5W", "url": "https://www.rcsb.org/structure/1C5W", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1C5X", "url": "https://www.rcsb.org/structure/1C5X", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1C5Y", "url": "https://www.rcsb.org/structure/1C5Y", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1C5Z", "url": "https://www.rcsb.org/structure/1C5Z", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1EJN", "url": "https://www.rcsb.org/structure/1EJN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1F5K", "url": "https://www.rcsb.org/structure/1F5K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1F5L", "url": "https://www.rcsb.org/structure/1F5L", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1F92", "url": "https://www.rcsb.org/structure/1F92", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1FV9", "url": "https://www.rcsb.org/structure/1FV9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1GI7", "url": "https://www.rcsb.org/structure/1GI7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1GI8", "url": "https://www.rcsb.org/structure/1GI8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1GI9", "url": "https://www.rcsb.org/structure/1GI9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1GJ7", "url": "https://www.rcsb.org/structure/1GJ7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1GJ8", "url": "https://www.rcsb.org/structure/1GJ8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1GJ9", "url": "https://www.rcsb.org/structure/1GJ9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1GJA", "url": "https://www.rcsb.org/structure/1GJA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1GJB", "url": "https://www.rcsb.org/structure/1GJB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1GJC", "url": "https://www.rcsb.org/structure/1GJC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1GJD", "url": "https://www.rcsb.org/structure/1GJD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1KDU", "url": "https://www.rcsb.org/structure/1KDU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1LMW", "url": "https://www.rcsb.org/structure/1LMW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1O3P", "url": "https://www.rcsb.org/structure/1O3P", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1O5A", "url": "https://www.rcsb.org/structure/1O5A", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1O5B", "url": "https://www.rcsb.org/structure/1O5B", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1O5C", "url": "https://www.rcsb.org/structure/1O5C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1OWD", "url": "https://www.rcsb.org/structure/1OWD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1OWE", "url": "https://www.rcsb.org/structure/1OWE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1OWH", "url": "https://www.rcsb.org/structure/1OWH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1OWI", "url": "https://www.rcsb.org/structure/1OWI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1OWJ", "url": "https://www.rcsb.org/structure/1OWJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1OWK", "url": "https://www.rcsb.org/structure/1OWK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1SC8", "url": "https://www.rcsb.org/structure/1SC8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1SQA", "url": "https://www.rcsb.org/structure/1SQA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1SQO", "url": "https://www.rcsb.org/structure/1SQO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1SQT", "url": "https://www.rcsb.org/structure/1SQT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1U6Q", "url": "https://www.rcsb.org/structure/1U6Q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1URK", "url": "https://www.rcsb.org/structure/1URK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1VJ9", "url": "https://www.rcsb.org/structure/1VJ9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1VJA", "url": "https://www.rcsb.org/structure/1VJA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1W0Z", "url": "https://www.rcsb.org/structure/1W0Z", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1W10", "url": "https://www.rcsb.org/structure/1W10", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1W11", "url": "https://www.rcsb.org/structure/1W11", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1W12", "url": "https://www.rcsb.org/structure/1W12", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1W13", "url": "https://www.rcsb.org/structure/1W13", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1W14", "url": "https://www.rcsb.org/structure/1W14", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2FD6", "url": "https://www.rcsb.org/structure/2FD6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2I9A", "url": "https://www.rcsb.org/structure/2I9A", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2I9B", "url": "https://www.rcsb.org/structure/2I9B", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2NWN", "url": "https://www.rcsb.org/structure/2NWN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2O8T", "url": "https://www.rcsb.org/structure/2O8T", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2O8U", "url": "https://www.rcsb.org/structure/2O8U", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2O8W", "url": "https://www.rcsb.org/structure/2O8W", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2R2W", "url": "https://www.rcsb.org/structure/2R2W", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2VIN", "url": "https://www.rcsb.org/structure/2VIN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2VIO", "url": "https://www.rcsb.org/structure/2VIO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2VIP", "url": "https://www.rcsb.org/structure/2VIP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2VIQ", "url": "https://www.rcsb.org/structure/2VIQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2VIV", "url": "https://www.rcsb.org/structure/2VIV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2VIW", "url": "https://www.rcsb.org/structure/2VIW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2VNT", "url": "https://www.rcsb.org/structure/2VNT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3BT1", "url": "https://www.rcsb.org/structure/3BT1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3BT2", "url": "https://www.rcsb.org/structure/3BT2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3IG6", "url": "https://www.rcsb.org/structure/3IG6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KGP", "url": "https://www.rcsb.org/structure/3KGP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KHV", "url": "https://www.rcsb.org/structure/3KHV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KID", "url": "https://www.rcsb.org/structure/3KID", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3M61", "url": "https://www.rcsb.org/structure/3M61", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3MHW", "url": "https://www.rcsb.org/structure/3MHW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3MWI", "url": "https://www.rcsb.org/structure/3MWI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3OX7", "url": "https://www.rcsb.org/structure/3OX7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3OY5", "url": "https://www.rcsb.org/structure/3OY5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3OY6", "url": "https://www.rcsb.org/structure/3OY6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3PB1", "url": "https://www.rcsb.org/structure/3PB1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3QN7", "url": "https://www.rcsb.org/structure/3QN7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3U73", "url": "https://www.rcsb.org/structure/3U73", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4DVA", "url": "https://www.rcsb.org/structure/4DVA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4DW2", "url": "https://www.rcsb.org/structure/4DW2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4FU7", "url": "https://www.rcsb.org/structure/4FU7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4FU8", "url": "https://www.rcsb.org/structure/4FU8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4FU9", "url": "https://www.rcsb.org/structure/4FU9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4FUB", "url": "https://www.rcsb.org/structure/4FUB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4FUC", "url": "https://www.rcsb.org/structure/4FUC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4FUD", "url": "https://www.rcsb.org/structure/4FUD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4FUE", "url": "https://www.rcsb.org/structure/4FUE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4FUF", "url": "https://www.rcsb.org/structure/4FUF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4FUG", "url": "https://www.rcsb.org/structure/4FUG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4FUH", "url": "https://www.rcsb.org/structure/4FUH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4FUI", "url": "https://www.rcsb.org/structure/4FUI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4FUJ", "url": "https://www.rcsb.org/structure/4FUJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4GLY", "url": "https://www.rcsb.org/structure/4GLY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4H42", "url": "https://www.rcsb.org/structure/4H42", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4JK5", "url": "https://www.rcsb.org/structure/4JK5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4JK6", "url": "https://www.rcsb.org/structure/4JK6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4K24", "url": "https://www.rcsb.org/structure/4K24", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4MNV", "url": "https://www.rcsb.org/structure/4MNV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4MNW", "url": "https://www.rcsb.org/structure/4MNW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4MNX", "url": "https://www.rcsb.org/structure/4MNX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4MNY", "url": "https://www.rcsb.org/structure/4MNY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4OS1", "url": "https://www.rcsb.org/structure/4OS1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4OS2", "url": "https://www.rcsb.org/structure/4OS2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4OS4", "url": "https://www.rcsb.org/structure/4OS4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4OS5", "url": "https://www.rcsb.org/structure/4OS5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4OS6", "url": "https://www.rcsb.org/structure/4OS6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4OS7", "url": "https://www.rcsb.org/structure/4OS7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4X0W", "url": "https://www.rcsb.org/structure/4X0W", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4X1N", "url": "https://www.rcsb.org/structure/4X1N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4X1P", "url": "https://www.rcsb.org/structure/4X1P", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4X1Q", "url": "https://www.rcsb.org/structure/4X1Q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4X1R", "url": "https://www.rcsb.org/structure/4X1R", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4X1S", "url": "https://www.rcsb.org/structure/4X1S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4XSK", "url": "https://www.rcsb.org/structure/4XSK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4ZHL", "url": "https://www.rcsb.org/structure/4ZHL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4ZHM", "url": "https://www.rcsb.org/structure/4ZHM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4ZKN", "url": "https://www.rcsb.org/structure/4ZKN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4ZKO", "url": "https://www.rcsb.org/structure/4ZKO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4ZKR", "url": "https://www.rcsb.org/structure/4ZKR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4ZKS", "url": "https://www.rcsb.org/structure/4ZKS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5HGG", "url": "https://www.rcsb.org/structure/5HGG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5WXF", "url": "https://www.rcsb.org/structure/5WXF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5WXO", "url": "https://www.rcsb.org/structure/5WXO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5WXP", "url": "https://www.rcsb.org/structure/5WXP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5WXQ", "url": "https://www.rcsb.org/structure/5WXQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5WXR", "url": "https://www.rcsb.org/structure/5WXR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5WXS", "url": "https://www.rcsb.org/structure/5WXS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5WXT", "url": "https://www.rcsb.org/structure/5WXT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5XG4", "url": "https://www.rcsb.org/structure/5XG4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5YC6", "url": "https://www.rcsb.org/structure/5YC6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5YC7", "url": "https://www.rcsb.org/structure/5YC7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5Z1C", "url": "https://www.rcsb.org/structure/5Z1C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5ZA7", "url": "https://www.rcsb.org/structure/5ZA7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5ZA8", "url": "https://www.rcsb.org/structure/5ZA8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5ZA9", "url": "https://www.rcsb.org/structure/5ZA9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5ZAE", "url": "https://www.rcsb.org/structure/5ZAE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5ZAF", "url": "https://www.rcsb.org/structure/5ZAF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5ZAG", "url": "https://www.rcsb.org/structure/5ZAG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5ZAH", "url": "https://www.rcsb.org/structure/5ZAH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5ZAJ", "url": "https://www.rcsb.org/structure/5ZAJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5ZC5", "url": "https://www.rcsb.org/structure/5ZC5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6AG2", "url": "https://www.rcsb.org/structure/6AG2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6AG3", "url": "https://www.rcsb.org/structure/6AG3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6AG7", "url": "https://www.rcsb.org/structure/6AG7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6AG9", "url": "https://www.rcsb.org/structure/6AG9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6JYP", "url": "https://www.rcsb.org/structure/6JYP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6JYQ", "url": "https://www.rcsb.org/structure/6JYQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6L04", "url": "https://www.rcsb.org/structure/6L04", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6L05", "url": "https://www.rcsb.org/structure/6L05", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6NMB", "url": "https://www.rcsb.org/structure/6NMB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6XVD", "url": "https://www.rcsb.org/structure/6XVD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7DZD", "url": "https://www.rcsb.org/structure/7DZD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7VM4", "url": "https://www.rcsb.org/structure/7VM4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7VM5", "url": "https://www.rcsb.org/structure/7VM5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7VM6", "url": "https://www.rcsb.org/structure/7VM6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7VM7", "url": "https://www.rcsb.org/structure/7VM7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00051", "url": "http://pfam.xfam.org/family/PF00051", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00089", "url": "http://pfam.xfam.org/family/PF00089", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P00749", "url": "https://pharos.nih.gov/targets/P00749", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000051248", "url": "https://proconsortium.org/app/entry/PR:000051248", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051249", "url": "https://proconsortium.org/app/entry/PR:000051249", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P00749", "url": "http://purl.obolibrary.org/obo/PR_P00749", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001138503", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138503", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P00749", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "E7ET40", "url": "https://www.uniprot.org/uniprot/E7ET40", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7ET40-1", "url": "https://www.uniprot.org/uniprot/E7ET40-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P00749-1", "url": "https://www.uniprot.org/uniprot/P00749-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P00749-2", "url": "https://www.uniprot.org/uniprot/P00749-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "S4R3G7", "url": "https://www.uniprot.org/uniprot/S4R3G7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "S4R3G7-1", "url": "https://www.uniprot.org/uniprot/S4R3G7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKLLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL", "length": 431, "header": "sp|P00749-1|UROK_HUMAN Isoform 1 of Urokinase-type plasminogen activator OS=Homo sapiens OX=9606 GN=PLAU PE=1 SV=3 CANONICAL=P00749-1" }, "isoforms": [ { "isoform_ac": "E7ET40-1", "url": "", "sequence": { "sequence": "MVFHLRTRYEQANCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKLLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL", "length": 414, "header": "tr|E7ET40-1|E7ET40_HUMAN Computationally mapped isoform of Urokinase-type plasminogen activator OS=Homo sapiens OX=9606 GN=PLAU PE=1 SV=1 CANONICAL=P00749-1" }, "locus": { "chromosome": "10", "start_pos": 73916562, "end_pos": 73911892, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000446342", "url": "https://www.ensembl.org/id/ENST00000446342" }, { "database": "Ensembl Peptide", "id": "ENSP00000388474", "url": "https://www.ensembl.org/id/ENSP00000388474" } ] } }, { "isoform_ac": "P00749-1", "url": "", "sequence": { "sequence": "MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKLLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL", "length": 431, "header": "sp|P00749-1|UROK_HUMAN Isoform 1 of Urokinase-type plasminogen activator OS=Homo sapiens OX=9606 GN=PLAU PE=1 SV=3 CANONICAL=P00749-1" }, "locus": { "chromosome": "10", "start_pos": 73916562, "end_pos": 73911556, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000372764.4", "url": "https://www.ensembl.org/id/ENST00000372764.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000361850.3", "url": "https://www.ensembl.org/id/ENSP00000361850.3" } ] } }, { "isoform_ac": "P00749-2", "url": "", "sequence": { "sequence": "MVFHLRTRYEQANCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKLLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL", "length": 414, "header": "sp|P00749-2|UROK_HUMAN Isoform 2 of Urokinase-type plasminogen activator OS=Homo sapiens OX=9606 GN=PLAU PE=1 SV=3 CANONICAL=P00749-1" }, "locus": {} }, { "isoform_ac": "S4R3G7-1", "url": "", "sequence": { "sequence": "MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHA", "length": 106, "header": "tr|S4R3G7-1|UROK_HUMAN Computationally mapped isoform of Urokinase-type plasminogen activator OS=Homo sapiens OX=9606 GN=PLAU PE=1 SV=1 CANONICAL=P00749-1" }, "locus": { "chromosome": "10", "start_pos": 73913048, "end_pos": 73911556, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000481390.5", "url": "https://www.ensembl.org/id/ENST00000481390.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000474318.1", "url": "https://www.ensembl.org/id/ENSP00000474318.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "KPSSPPEELK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 156, "start_aa": "Lys", "end_pos": 165, "end_aa": "Lys", "evidence": [ { "id": "P00749", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 158, "start_aa": "Ser", "end_pos": 158, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser158", "evidence": [ { "id": "P00749", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G23626NI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "ASN-322", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P00749", "database": "UniCarbKB", "url": "" }, { "id": "2393398", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2393398" }, { "id": "1468573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1468573" }, { "id": "2023947", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2023947" }, { "id": "612", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/612" } ] }, { "glytoucan_ac": "G82592ZH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "612", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/612" }, { "id": "1468573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1468573" } ] }, { "glytoucan_ac": "G86102AA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: ASN-322 ; ASN-322", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P00749", "database": "UniCarbKB", "url": "" }, { "id": "2393398", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2393398" }, { "id": "2023947", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2023947" }, { "id": "1468573", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1468573" }, { "id": "612", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/612" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P00749", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00749#ptm_processing" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "glytoucan_ac": "G96881BQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 38, "start_aa": "Thr", "end_pos": 38, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr38", "evidence": [ { "id": "612", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/612" }, { "id": "2023947", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2023947" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-fucosylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (Fuc) threonine O-fucosylation", "start_pos": 38, "start_aa": "Thr", "end_pos": 38, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr38", "evidence": [ { "id": "P00749", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00749#ptm_processing" }, { "id": "2023947", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2023947" } ] }, { "glytoucan_ac": "G06330RB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "86", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/86" }, { "id": "2124546", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2124546" } ] }, { "glytoucan_ac": "G17689DH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "86", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/86" }, { "id": "2124546", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2124546" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "86", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/86" }, { "id": "2124546", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2124546" } ] }, { "glytoucan_ac": "G37022BP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "86", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/86" }, { "id": "2124546", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2124546" } ] }, { "glytoucan_ac": "G46665ZP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "86", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/86" }, { "id": "8462541", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8462541" } ] }, { "glytoucan_ac": "G53752TA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "86", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/86" }, { "id": "8462541", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8462541" } ] }, { "glytoucan_ac": "G70511VE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "86", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/86" }, { "id": "2124546", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2124546" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "86", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/86" }, { "id": "8462541", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8462541" } ] }, { "glytoucan_ac": "G85194VU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "86", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/86" }, { "id": "8462541", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8462541" } ] }, { "glytoucan_ac": "G96881BQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "612", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/612" }, { "id": "2393398", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2393398" } ] }, { "glytoucan_ac": "G98481KT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "86", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/86" }, { "id": "8462541", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8462541" } ] } ], "phosphorylation": [ { "start_pos": 158, "end_pos": 158, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" }, { "database": "PubMed", "id": "9151681", "url": "https://glygen.org/publication/PubMed/9151681" }, { "database": "phospho.ELM", "id": "P00749", "url": "http://phospho.elm.eu.org/byAccession/P00749.html" }, { "database": "iPTMnet", "id": "P00749", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00749" }, { "database": "PubMed", "id": "9765311", "url": "https://glygen.org/publication/PubMed/9765311" } ], "site_lbl": "Ser158" }, { "start_pos": 323, "end_pos": 323, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" }, { "database": "PubMed", "id": "9151681", "url": "https://glygen.org/publication/PubMed/9151681" }, { "database": "phospho.ELM", "id": "P00749", "url": "http://phospho.elm.eu.org/byAccession/P00749.html" }, { "database": "iPTMnet", "id": "P00749", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00749" }, { "database": "PubMed", "id": "9765311", "url": "https://glygen.org/publication/PubMed/9765311" } ], "site_lbl": "Ser323" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology", "journal": "EMBO J", "date": "2013", "authors": "Steentoft C., Vakhrushev S.Y., Joshi H.J., Kong Y., Vester-Christensen M.B., Schjoldager K.T., Lavrsen K., Dabelsteen S., Pedersen N.B., Marcos-Silva L., Gupta R., Bennett E.P., Mandel U., Brunak S., Wandall H.H., Levery S.B., Clausen H.", "evidence": [ { "database": "UniCarbKB", "id": "P00749", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1038/emboj.2013.79", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "title": "Functionally inactive protein C inhibitor in seminal plasma may be associated with infertility.", "journal": "Mol. Hum. Reprod.", "date": "1999", "authors": "He S, Lin Y L, Liu Y X", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "reference": [ { "type": "PubMed", "id": "10340997", "url": "https://glygen.org/publication/PubMed/10340997" } ] }, { "title": "A urokinase receptor-associated protein with specific collagen binding properties.", "journal": "J. Biol. Chem.", "date": "2000", "authors": "Behrendt N, Jensen ON, Engelholm LH, Mortz E, Mann M, Dano K", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "reference": [ { "type": "PubMed", "id": "10636902", "url": "https://glygen.org/publication/PubMed/10636902" } ] }, { "title": "(4-aminomethyl)phenylguanidine derivatives as nonpeptidic highly selective inhibitors of human urokinase.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2000", "authors": "Sperl S, Jacob U, Arroyo de Prada N, St\u00fcrzebecher J, Wilhelm O G, Bode W, Magdolen V, Huber R, Moroder L", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "reference": [ { "type": "PubMed", "id": "10805774", "url": "https://glygen.org/publication/PubMed/10805774" } ] }, { "title": "The putative tumor suppressor LRP1B, a novel member of the low density lipoprotein (LDL) receptor family, exhibits both overlapping and distinct properties with the LDL receptor-related protein.", "journal": "J. Biol. Chem.", "date": "2001", "authors": "Liu CX, Li Y, Obermoeller-McCormick LM, Schwartz AL, Bu G", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "reference": [ { "type": "PubMed", "id": "11384978", "url": "https://glygen.org/publication/PubMed/11384978" } ] }, { "title": "The blockage of the high-affinity lysine binding sites of plasminogen by EACA significantly inhibits prourokinase-induced plasminogen activation.", "journal": "Biochimica et biophysica acta", "date": "2002", "authors": "Sun Z, Chen YH, Wang P, Zhang J, Gurewich V, Zhang P, Liu JN", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "12007600", "url": "https://glygen.org/publication/PubMed/12007600" } ] }, { "title": "Sequential 1H NMR assignments and secondary structure of the kringle domain from urokinase.", "journal": "Biochemistry", "date": "1992", "authors": "Li X, Smith R A, Dobson C M", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "reference": [ { "type": "PubMed", "id": "1327118", "url": "https://glygen.org/publication/PubMed/1327118" } ] }, { "title": "Isolation and characterization of alpha2-plasmin inhibitor from human plasma. A novel proteinase inhibitor which inhibits activator-induced clot lysis.", "journal": "The Journal of biological chemistry", "date": "1976", "authors": "Moroi M, Aoki N", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "134998", "url": "https://glygen.org/publication/PubMed/134998" } ] }, { "title": "Human urokinase contains GalNAc beta (1-4)[Fuc alpha (1-3)]GlcNAc beta (1-2) as a novel terminal element in N-linked carbohydrate chains.", "journal": "FEBS letters", "date": "1992", "authors": "Bergwerff AA, Thomas-Oates JE, van Oostrum J, Kamerling JP, Vliegenthart JF", "evidence": [ { "database": "UniCarbKB", "id": "P00749", "url": "" }, { "database": "GlyConnect", "id": "612", "url": "https://glyconnect.expasy.org/browser/proteins/612" } ], "reference": [ { "type": "PubMed", "id": "1468573", "url": "https://glygen.org/publication/PubMed/1468573" } ] }, { "title": "Regulation of carcinoma cell invasion by protein C inhibitor whose expression is decreased in renal cell carcinoma.", "journal": "Int. J. Cancer", "date": "2004", "authors": "Wakita Toshiaki, Hayashi Tatsuya, Nishioka Junji, Tamaru Hiroshi, Akita Nobuyuki, Asanuma Kunihiro, Kamada Haruhiko, Gabazza Esteban C, Ido Masaru, Kawamura Juichi, Suzuki Koji", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "reference": [ { "type": "PubMed", "id": "14696115", "url": "https://glygen.org/publication/PubMed/14696115" } ] }, { "title": "The mosaic receptor sorLA/LR11 binds components of the plasminogen-activating system and platelet-derived growth factor-BB similarly to LRP1 (low-density lipoprotein receptor-related protein), but mediates slow internalization of bound ligand.", "journal": "Biochem. J.", "date": "2004", "authors": "Gliemann J\u00f8rgen, Hermey Guido, Nykjaer Anders, Petersen Claus M, Jacobsen Christian, Andreasen Peter A", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "reference": [ { "type": "PubMed", "id": "15053742", "url": "https://glygen.org/publication/PubMed/15053742" } ] }, { "title": "Platelet-derived growth factor D is activated by urokinase plasminogen activator in prostate carcinoma cells.", "journal": "Mol. Cell. Biol.", "date": "2005", "authors": "Ustach CV, Kim HR", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "reference": [ { "type": "PubMed", "id": "15988036", "url": "https://glygen.org/publication/PubMed/15988036" } ] }, { "title": "Structure of human urokinase plasminogen activator in complex with its receptor.", "journal": "Science", "date": "2006", "authors": "Huai Q, Mazar AP, Kuo A, Parry GC, Shaw DE, Callahan J, Li Y, Yuan C, Bian C, Chen L, Furie B, Furie BC, Cines DB, Huang M", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "reference": [ { "type": "PubMed", "id": "16456079", "url": "https://glygen.org/publication/PubMed/16456079" } ] }, { "title": "Evaluation of aprotinin and tranexamic acid in different in vitro and in vivo models of fibrinolysis, coagulation and thrombus formation.", "journal": "Journal of thrombosis and haemostasis : JTH", "date": "2007", "authors": "Sperzel M, Huetter J", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "17666018", "url": "https://glygen.org/publication/PubMed/17666018" } ] }, { "title": "Plasminogen activation by receptor-bound urokinase. A kinetic study with both cell-associated and isolated receptor.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Ellis V, Behrendt N, Dano K", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "1829461", "url": "https://glygen.org/publication/PubMed/1829461" } ] }, { "title": "Cellular receptor for urokinase plasminogen activator. Carboxyl-terminal processing and membrane anchoring by glycosyl-phosphatidylinositol.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Ploug M, Ronne E, Behrendt N, Jensen AL, Blasi F, Dano K", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "1846368", "url": "https://glygen.org/publication/PubMed/1846368" } ] }, { "title": "DNA sequencing of a cytogenetically normal acute myeloid leukaemia genome.", "journal": "Nature", "date": "2008", "authors": "Ley TJ, Mardis ER, Ding L, Fulton B, McLellan MD, Chen K, Dooling D, Dunford-Shore BH, McGrath S, Hickenbotham M, Cook L, Abbott R, Larson DE, Koboldt DC, Pohl C, Smith S, Hawkins A, Abbott S, Locke D, Hillier LW, Miner T, Fulton L, Magrini V, Wylie T, Glasscock J, Conyers J, Sander N, Shi X, Osborne JR, Minx P, Gordon D, Chinwalla A, Zhao Y, Ries RE, Payton JE, Westervelt P, Tomasson MH, Watson M, Baty J, Ivanovich J, Heath S, Shannon WD, Nagarajan R, Walter MJ, Link DC, Graubert TA, DiPersio JF, Wilson RK", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "reference": [ { "type": "PubMed", "id": "18987736", "url": "https://glygen.org/publication/PubMed/18987736" } ] }, { "title": "Persons with Quebec platelet disorder have a tandem duplication of PLAU, the urokinase plasminogen activator gene.", "journal": "Blood", "date": "2010", "authors": "Paterson Andrew D, Rommens Johanna M, Bharaj Bhupinder, Blavignac Jessica, Wong Isidro, Diamandis Maria, Waye John S, Rivard Georges E, Hayward Catherine P M", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "reference": [ { "type": "PubMed", "id": "20007542", "url": "https://glygen.org/publication/PubMed/20007542" } ] }, { "title": "Characterization of a posttranslational fucosylation in the growth factor domain of urinary plasminogen activator.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1991", "authors": "Buko AM, Kentzer EJ, Petros A, Menon G, Zuiderweg ER, Sarin VK", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749#ptm_processing" }, { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" }, { "database": "UniCarbKB", "id": "P00749", "url": "" }, { "database": "GlyConnect", "id": "612", "url": "https://glyconnect.expasy.org/browser/proteins/612" } ], "reference": [ { "type": "PubMed", "id": "2023947", "url": "https://glygen.org/publication/PubMed/2023947" } ] }, { "title": "Sialylated carbohydrate chains of recombinant human glycoproteins expressed in Chinese hamster ovary cells contain traces of N-glycolylneuraminic acid.", "journal": "FEBS letters", "date": "1990", "authors": "Hokke CH, Bergwerff AA, van Dedem GW, van Oostrum J, Kamerling JP, Vliegenthart JF", "evidence": [ { "database": "GlyConnect", "id": "86", "url": "https://glyconnect.expasy.org/browser/proteins/86" } ], "reference": [ { "type": "PubMed", "id": "2124546", "url": "https://glygen.org/publication/PubMed/2124546" } ] }, { "title": "The human receptor for urokinase plasminogen activator. NH2-terminal amino acid sequence and glycosylation variants.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Behrendt N, Ronne E, Ploug M, Petri T, Lober D, Nielsen LS, Schleuning WD, Blasi F, Appella E, Dano K", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "2156852", "url": "https://glygen.org/publication/PubMed/2156852" } ] }, { "title": "The receptor for urokinase type plasminogen activator polarizes expression of the protease to the leading edge of migrating monocytes and promotes degradation of enzyme inhibitor complexes.", "journal": "The Journal of cell biology", "date": "1990", "authors": "Estreicher A, Muhlhauser J, Carpentier JL, Orci L, Vassalli JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "2166055", "url": "https://glygen.org/publication/PubMed/2166055" } ] }, { "title": "Quantification of the N-glycosylated secretome by super-SILAC during breast cancer progression and in human blood samples.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Boersema PJ, Geiger T, Wisniewski JR, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "23090970", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "title": "Characterization of the gene for human plasminogen, a key proenzyme in the fibrinolytic system.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Petersen TE, Martzen MR, Ichinose A, Davie EW", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "2318848", "url": "https://glygen.org/publication/PubMed/2318848" } ] }, { "title": "The annexin A2/S100A10 system in health and disease: emerging paradigms.", "journal": "Journal of biomedicine & biotechnology", "date": "2012", "authors": "Hedhli N, Falcone DJ, Huang B, Cesarman-Maus G, Kraemer R, Zhai H, Tsirka SE, Santambrogio L, Hajjar KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "23193360", "url": "https://glygen.org/publication/PubMed/23193360" } ] }, { "title": "Annexin A2 system in human biology: cell surface and beyond.", "journal": "Seminars in thrombosis and hemostasis", "date": "2013", "authors": "Luo M, Hajjar KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "23483454", "url": "https://glygen.org/publication/PubMed/23483454" } ] }, { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology.", "journal": "The EMBO journal", "date": "2013", "authors": "Steentoft C, Vakhrushev SY, Joshi HJ, Kong Y, Vester-Christensen MB, Schjoldager KT, Lavrsen K, Dabelsteen S, Pedersen NB, Marcos-Silva L, Gupta R, Bennett EP, Mandel U, Brunak S, Wandall HH, Levery SB, Clausen H", "evidence": [ { "database": "UniCarbKB", "id": "P00749", "url": "" } ], "reference": [ { "type": "PubMed", "id": "23584533", "url": "https://glygen.org/publication/PubMed/23584533" } ] }, { "title": "Proteome profiling of human neutrophil granule subsets, secretory vesicles, and cell membrane: correlation with transcriptome profiling of neutrophil precursors.", "journal": "Journal of leukocyte biology", "date": "2013", "authors": "Rorvig S, Ostergaard O, Heegaard NH, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "23650620", "url": "https://glygen.org/publication/PubMed/23650620" } ] }, { "title": "Carbohydrate composition and presence of a fucose-protein linkage in recombinant human pro-urokinase.", "journal": "Biochemical and biophysical research communications", "date": "1990", "authors": "Kentzer EJ, Buko A, Menon G, Sarin VK", "evidence": [ { "database": "UniCarbKB", "id": "P00749", "url": "" }, { "database": "GlyConnect", "id": "612", "url": "https://glyconnect.expasy.org/browser/proteins/612" } ], "reference": [ { "type": "PubMed", "id": "2393398", "url": "https://glygen.org/publication/PubMed/2393398" } ] }, { "title": "Molecular cloning of cDNA coding for human preprourokinase.", "journal": "Gene", "date": "1985", "authors": "Nagai M, Hiramatsu R, Kan\u00e9da T, Hayasuke N, Arimura H, Nishida M, Suyama T", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "reference": [ { "type": "PubMed", "id": "2415429", "url": "https://glygen.org/publication/PubMed/2415429" } ] }, { "title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "24190977", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "title": "Amino-acid sequence of human alpha 2-antiplasmin.", "journal": "European journal of biochemistry", "date": "1987", "authors": "Lijnen HR, Holmes WE, van Hoef B, Wiman B, Rodriguez H, Collen D", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "2440681", "url": "https://glygen.org/publication/PubMed/2440681" } ] }, { "title": "TMPRSS4 induces cancer cell invasion through pro-uPA processing.", "journal": "Biochemical and biophysical research communications", "date": "2014", "authors": "Min HJ, Lee MK, Lee JW, Kim S", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "reference": [ { "type": "PubMed", "id": "24434139", "url": "https://glygen.org/publication/PubMed/24434139" } ] }, { "title": "Discovery of the Fibrinolysis Inhibitor AZD6564, Acting via Interference of a Protein-Protein Interaction.", "journal": "ACS medicinal chemistry letters", "date": "2014", "authors": "Cheng L, Pettersen D, Ohlsson B, Schell P, Karle M, Evertsson E, Pahlen S, Jonforsen M, Plowright AT, Bostrom J, Fex T, Thelin A, Hilgendorf C, Xue Y, Wahlund G, Lindberg W, Larsson LO, Gustafsson D", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "24900876", "url": "https://glygen.org/publication/PubMed/24900876" } ] }, { "title": "The single-chain form of tissue-type plasminogen activator has catalytic activity: studies with a mutant enzyme that lacks the cleavage site.", "journal": "Biochemistry", "date": "1989", "authors": "Boose JA, Kuismanen E, Gerard R, Sambrook J, Gething MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "2496749", "url": "https://glygen.org/publication/PubMed/2496749" } ] }, { "title": "Interaction between plasminogen activator inhibitor type 1 (PAI-1) bound to fibrin and either tissue-type plasminogen activator (t-PA) or urokinase-type plasminogen activator (u-PA). Binding of t-PA/PAI-1 complexes to fibrin mediated by both the finger and the kringle-2 domain of t-PA.", "journal": "The Journal of clinical investigation", "date": "1989", "authors": "Wagner OF, de Vries C, Hohmann C, Veerman H, Pannekoek H", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "2503541", "url": "https://glygen.org/publication/PubMed/2503541" } ] }, { "title": "Plasminogen activation initiated by single-chain urokinase-type plasminogen activator. Potentiation by U937 monocytes.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Ellis V, Scully MF, Kakkar VV", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "2521625", "url": "https://glygen.org/publication/PubMed/2521625" } ] }, { "title": "Dynamics of the multidomain fibrinolytic protein urokinase from two-dimensional NMR.", "journal": "Nature", "date": "1989", "authors": "Oswald R E, Bogusky M J, Bamberger M, Smith R A, Dobson C M", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "reference": [ { "type": "PubMed", "id": "2536903", "url": "https://glygen.org/publication/PubMed/2536903" } ] }, { "title": "Accessibility of receptor-bound urokinase to type-1 plasminogen activator inhibitor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Cubellis MV, Andreasen P, Ragno P, Mayer M, Dano K, Blasi F", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "2544876", "url": "https://glygen.org/publication/PubMed/2544876" } ] }, { "title": "Activation of plasminogen by pro-urokinase. I. Mechanism.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Lijnen HR, Zamarron C, Blaber M, Winkler ME, Collen D", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "2935528", "url": "https://glygen.org/publication/PubMed/2935528" } ] }, { "title": "Interaction of one-chain and two-chain tissue plasminogen activator with intact and plasmin-degraded fibrin.", "journal": "Biochemistry", "date": "1987", "authors": "Higgins DL, Vehar GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "2962641", "url": "https://glygen.org/publication/PubMed/2962641" } ] }, { "title": "The human urokinase-plasminogen activator gene and its promoter.", "journal": "Nucleic Acids Res.", "date": "1985", "authors": "Riccio A, Grimaldi G, Verde P, Sebastio G, Boast S, Blasi F", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "reference": [ { "type": "PubMed", "id": "2987867", "url": "https://glygen.org/publication/PubMed/2987867" } ] }, { "title": "Amino acid sequence of human histidine-rich glycoprotein derived from the nucleotide sequence of its cDNA.", "journal": "Biochemistry", "date": "1986", "authors": "Koide T, Foster D, Yoshitake S, Davie EW", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "3011081", "url": "https://glygen.org/publication/PubMed/3011081" } ] }, { "title": "Binding of single-chain prourokinase to the urokinase receptor of human U937 cells.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Cubellis MV, Nolli ML, Cassani G, Blasi F", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "3023326", "url": "https://glygen.org/publication/PubMed/3023326" } ] }, { "title": "Purification and characterization of a plasminogen activator inhibitor from the histiocytic lymphoma cell line U-937.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Kruithof EK, Vassalli JD, Schleuning WD, Mattaliano RJ, Bachmann F", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "3090045", "url": "https://glygen.org/publication/PubMed/3090045" } ] }, { "title": "Inhibition of urokinase by protein C-inhibitor (PCI). Evidence for identity of PCI and plasminogen activator inhibitor 3.", "journal": "Biol. Chem. Hoppe-Seyler", "date": "1987", "authors": "Stief TW, Radtke KP, Heimburger N", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "reference": [ { "type": "PubMed", "id": "3501295", "url": "https://glygen.org/publication/PubMed/3501295" } ] }, { "title": "PLAU contributes to the development of cholangiocarcinoma via activating NF-\u03baB signaling pathway.", "journal": "Cell biology international", "date": "2023-08", "authors": "Hu Mei-Di, Jia Ling-Hua, Wang Ming-Long", "evidence": [ { "database": "RefSeq", "id": "NP_001138503", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138503" } ], "reference": [ { "type": "PubMed", "id": "37067236", "url": "https://glygen.org/publication/PubMed/37067236" } ] }, { "title": "m6A Methyltransferase, WTAP, Promotes Cancer Progression in Laryngeal Squamous Cell Carcinoma by Regulating PLAU Stability.", "journal": "Annals of clinical and laboratory science", "date": "2023-03", "authors": "Liu Fangfang, Xia Fan, Wang Cancan, Ren Rongling, Zhang Min, Gong Jie, Zhang Qiuying", "evidence": [ { "database": "RefSeq", "id": "NP_001138503", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138503" } ], "reference": [ { "type": "PubMed", "id": "37094860", "url": "https://glygen.org/publication/PubMed/37094860" } ] }, { "title": "Recent Advances in Targeting the Urokinase Plasminogen Activator with Nanotherapeutics.", "journal": "Molecular pharmaceutics", "date": "2023-04-29", "authors": "Kumar Ashna A, Vine Kara L, Ranson Marie", "evidence": [ { "database": "RefSeq", "id": "NP_001138503", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138503" } ], "reference": [ { "type": "PubMed", "id": "37119285", "url": "https://glygen.org/publication/PubMed/37119285" } ] }, { "title": "Prognostic evaluation of oral squamous cell carcinoma based on pleiotrophin, urokinase plasminogen activator, and glycoprotein nonmetastatic melanoma protein B expression.", "journal": "Medicine", "date": "2023-11-10", "authors": "Ma Yuxin, Liu Yue, Meng Han", "evidence": [ { "database": "RefSeq", "id": "NP_001138503", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138503" } ], "reference": [ { "type": "PubMed", "id": "37960806", "url": "https://glygen.org/publication/PubMed/37960806" } ] }, { "title": "Pan-cancer analysis of PLAU indicates its potential prognostic value and correlation with neutrophil infiltration in BLCA.", "journal": "Biochimica et biophysica acta. Molecular basis of disease", "date": "2024-02", "authors": "Shi Ke, Zhou Jianda, Li Man, Yan Wenguang, Zhang Jiaqi, Zhang Xiulan, Jiang Li", "evidence": [ { "database": "RefSeq", "id": "NP_001138503", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138503" } ], "reference": [ { "type": "PubMed", "id": "38000776", "url": "https://glygen.org/publication/PubMed/38000776" } ] }, { "title": "Molecular cloning, sequencing, and expression in Escherichia coli of human preprourokinase cDNA.", "journal": "DNA", "date": "1985", "authors": "Jacobs P, Cravador A, Loriau R, Brockly F, Colau B, Chuchana P, van Elsen A, Herzog A, Bollen A", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "reference": [ { "type": "PubMed", "id": "3888571", "url": "https://glygen.org/publication/PubMed/3888571" } ] }, { "title": "Tissue plasminogen activator: peptide analyses confirm an indirectly derived amino acid sequence, identify the active site serine residue, establish glycosylation sites, and localize variant differences.", "journal": "Biochemistry", "date": "1984", "authors": "Pohl G, Kallstrom M, Bergsdorf N, Wallen P, Jornvall H", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "6433976", "url": "https://glygen.org/publication/PubMed/6433976" } ] }, { "title": "Isolation and characterization of a human plasma protein with affinity for the lysine binding sites in plasminogen. Role in the regulation of fibrinolysis and identification as histidine-rich glycoprotein.", "journal": "The Journal of biological chemistry", "date": "1980", "authors": "Lijnen HR, Hoylaerts M, Collen D", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "6448849", "url": "https://glygen.org/publication/PubMed/6448849" } ] }, { "title": "Identification and primary sequence of an unspliced human urokinase poly(A)+ RNA.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1984", "authors": "Verde P, Stoppelli M P, Galeffi P, Di Nocera P, Blasi F", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "reference": [ { "type": "PubMed", "id": "6589620", "url": "https://glygen.org/publication/PubMed/6589620" } ] }, { "title": "Human low-molecular-weight urinary urokinase. Partial characterization and preliminary sequence data of the two polypeptide chains.", "journal": "Eur. J. Biochem.", "date": "1982", "authors": "Schaller J, Nick H, Rickli E E, Gillessen D, Lergier W, Studer R O", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "reference": [ { "type": "PubMed", "id": "6749491", "url": "https://glygen.org/publication/PubMed/6749491" } ] }, { "title": "The primary structure of high molecular mass urokinase from human urine. The complete amino acid sequence of the A chain.", "journal": "Hoppe-Seyler's Z. Physiol. Chem.", "date": "1982", "authors": "G\u00fcnzler W A, Steffens G J, Otting F, Kim S M, Frankus E, Floh\u00e9 L", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "reference": [ { "type": "PubMed", "id": "6754569", "url": "https://glygen.org/publication/PubMed/6754569" } ] }, { "title": "The complete amino acid sequence of low molecular mass urokinase from human urine.", "journal": "Hoppe-Seyler's Z. Physiol. Chem.", "date": "1982", "authors": "Steffens G J, G\u00fcnzler W A, Otting F, Frankus E, Floh\u00e9 L", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "reference": [ { "type": "PubMed", "id": "6754572", "url": "https://glygen.org/publication/PubMed/6754572" } ] }, { "title": "Kinetics of the activation of plasminogen by human tissue plasminogen activator. Role of fibrin.", "journal": "The Journal of biological chemistry", "date": "1982", "authors": "Hoylaerts M, Rijken DC, Lijnen HR, Collen D", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "7199524", "url": "https://glygen.org/publication/PubMed/7199524" } ] }, { "title": "Solution structure of the kringle domain from urokinase-type plasminogen activator.", "journal": "J. Mol. Biol.", "date": "1994", "authors": "Li X, Bokman A M, Llin\u00e1s M, Smith R A, Dobson C M", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "reference": [ { "type": "PubMed", "id": "8107091", "url": "https://glygen.org/publication/PubMed/8107091" } ] }, { "title": "Primary structure of N-linked carbohydrate chains of a human chimeric plasminogen activator K2tu-PA expressed in Chinese hamster ovary cells.", "journal": "European journal of biochemistry", "date": "1993", "authors": "Bergwerff AA, van Oostrum J, Asselbergs FA, Burgi R, Hokke CH, Kamerling JP, Vliegenthart JF", "evidence": [ { "database": "GlyConnect", "id": "86", "url": "https://glyconnect.expasy.org/browser/proteins/86" } ], "reference": [ { "type": "PubMed", "id": "8462541", "url": "https://glygen.org/publication/PubMed/8462541" } ] }, { "title": "The crystal structure of the catalytic domain of human urokinase-type plasminogen activator.", "journal": "Structure", "date": "1995", "authors": "Spraggon G, Phillips C, Nowak U K, Ponting C P, Saunders D, Dobson C M, Stuart D I, Jones E Y", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "reference": [ { "type": "PubMed", "id": "8591045", "url": "https://glygen.org/publication/PubMed/8591045" } ] }, { "title": "Characterization of single chain urokinase-type plasminogen activator with a novel amino-acid substitution in the kringle structure.", "journal": "Biochim. Biophys. Acta", "date": "1996", "authors": "Yoshimoto M, Ushiyama Y, Sakai M, Tamaki S, Hara H, Takahashi K, Sawasaki Y, Hanada K", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "reference": [ { "type": "PubMed", "id": "8652631", "url": "https://glygen.org/publication/PubMed/8652631" } ] }, { "title": "Targeting of proteins to granule subsets is determined by timing and not by sorting: The specific granule protein NGAL is localized to azurophil granules when expressed in HL-60 cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Le Cabec V, Cowland JB, Calafat J, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "8692836", "url": "https://glygen.org/publication/PubMed/8692836" } ] }, { "title": "Detection of polymorphisms in the human urokinase-type plasminogen activator gene.", "journal": "Thromb. Haemost.", "date": "1997", "authors": "Conne B, Berczy M, Belin D", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "reference": [ { "type": "PubMed", "id": "9065988", "url": "https://glygen.org/publication/PubMed/9065988" } ] }, { "title": "Phosphorylation of human pro-urokinase on Ser138/303 impairs its receptor-dependent ability to promote myelomonocytic adherence and motility.", "journal": "The Journal of cell biology", "date": "1997", "authors": "Franco P, Iaccarino C, Chiaradonna F, Brandazza A, Iavarone C, Mastronicola MR, Nolli ML, Stoppelli MP", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" }, { "database": "iPTMnet", "id": "P00749", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00749" } ], "reference": [ { "type": "PubMed", "id": "9151681", "url": "https://glygen.org/publication/PubMed/9151681" } ] }, { "title": "Mutational analysis of the genes encoding urokinase-type plasminogen activator (uPA) and its inhibitor PAI-1 in advanced ovarian cancer.", "journal": "Electrophoresis", "date": "1997", "authors": "T\u00fcrkmen B, Schmitt M, Schmalfeldt B, Trommler P, Hell W, Creutzburg S, Graeff H, Magdolen V", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "reference": [ { "type": "PubMed", "id": "9194591", "url": "https://glygen.org/publication/PubMed/9194591" } ] }, { "title": "HRG Tokushima: molecular and cellular characterization of histidine-rich glycoprotein (HRG) deficiency.", "journal": "Blood", "date": "1998", "authors": "Shigekiyo T, Yoshida H, Matsumoto K, Azuma H, Wakabayashi S, Saito S, Fujikawa K, Koide T", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "9414276", "url": "https://glygen.org/publication/PubMed/9414276" } ] }, { "title": "Protein kinase C-dependent in vivo phosphorylation of prourokinase leads to the formation of a receptor competitive antagonist.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Franco P, Massa O, Garcia-Rocha M, Chiaradonna F, Iaccarino C, Correas I, Mendez E, Avila J, Blasi F, Stoppelli MP", "evidence": [ { "database": "iPTMnet", "id": "P00749", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00749" } ], "reference": [ { "type": "PubMed", "id": "9765311", "url": "https://glygen.org/publication/PubMed/9765311" } ] }, { "title": "The crystal structure of a complex of p11 with the annexin II N-terminal peptide.", "journal": "Nature structural biology", "date": "1999", "authors": "Rety S, Sopkova J, Renouard M, Osterloh D, Gerke V, Tabaries S, Russo-Marie F, Lewit-Bentley A", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "9886297", "url": "https://glygen.org/publication/PubMed/9886297" } ] } ], "pathway": [ { "id": "hsa:5328", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5328", "resource": "KEGG Pathway" }, { "id": "R-HSA-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" }, { "id": "R-HSA-75205", "name": "Dissolution of Fibrin Clot", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205", "resource": "Reactome", "description": "Dissolution of Fibrin Clot" } ], "orthologs": [ { "uniprot_canonical_ac": "P06869-1", "protein_name": "Urokinase-type plasminogen activator", "gene_name": "Plau", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKVWLASLFLCALVVKNSEGGSVLGAPDESNCGCQNGGVCVSYKYFSRIRRCSCPRKFQGEHCEIDASKTCYHGNGDSYRGKANTDTKGRPCLAWNAPAVLQKPYNAHRPDAISLGLGKHNYCRNPDNQKRPWCYVQIGLRQFVQECMVHDCSLSKKPSSSVDQQGFQCGQKALRPRFKIVGGEFTEVENQPWFAAIYQKNKGGSPPSFKCGGSLISPCWVASAAHCFIQLPKKENYVVYLGQSKESSYNPGEMKFEVEQLILHEYYREDSLAYHNDIALLKIRTSTGQCAQPSRSIQTICLPPRFTDAPFGSDCEITGFGKESESDYLYPKNLKMSVVKLVSHEQCMQPHYYGSEINYKMLCAADPEWKTDSCKGDSGGPLICNIEGRPTLSGIVSWGRGCAEKNKPGVYTRVSHFLDWIQSHIGEEKGLAF", "length": 433 }, "evidence": [ { "id": "45927531", "url": "http://www.informatics.jax.org/homology/45927531", "database": "MGI" }, { "id": "P00749", "url": "https://omabrowser.org/oma/group/P00749/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P29598-1", "protein_name": "Urokinase-type plasminogen activator", "gene_name": "Plau", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MRVWLASLFLCALVANSEGGSELEASDESNCGCQNGGVCVSYKYFSSIRRCSCPKKFKGEHCEIDTSKTCYHGNGQSYRGKANTDTKGRPCLAWNSPAVLQQTYNAHRSDALSLGLGKHNYCRNPDNQRRPWCYVQIGLKQFVQECMVQDCSLSKKPSSTVDQQGFQCGQKALRPRFKIVGGEFTVVENQPWFAAIYLKNKGGSPPSFKCGGSLISPCWVASATHCFVNQPKKEEYVVYLGQSKRNSYNPGEMKFEVEQLILHEDFSDETLAFHNDIALLKIRTSTGQCAQPSRTIQTICLPPRFGDAPFGSDCEITGFGQESATDYFYPKDLKMSVVKIISHEQCKQPHYYGSEINYKMLCAADPEWKTDSCSGDSGGPLICNIDGRPTLSGIVSWGSGCAEKNKPGVYTRVSYFLNWIQSHIGEENGLAF", "length": 432 }, "evidence": [ { "id": "45927531", "url": "http://www.informatics.jax.org/homology/45927531", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "serine-type endopeptidase activity", "id": "GO:0004252", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004252", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 21, "go_terms": [ { "name": "proteolysis", "id": "GO:0006508", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006508", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "pmid": "" }, { "name": "regulation of cell adhesion mediated by integrin", "id": "GO:0033628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033628", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "pmid": "" }, { "name": "urokinase plasminogen activator signaling pathway", "id": "GO:0038195", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038195", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "pmid": "" }, { "name": "regulation of wound healing", "id": "GO:0061041", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061041", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "pmid": "" }, { "name": "regulation of smooth muscle cell-matrix adhesion", "id": "GO:2000097", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000097", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "pmid": "" }, { "name": "chemotaxis", "id": "GO:0006935", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006935", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "pmid": "" }, { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "pmid": "" }, { "name": "regulation of cell adhesion", "id": "GO:0030155", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030155", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "pmid": "" }, { "name": "positive regulation of cell migration", "id": "GO:0030335", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030335", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "pmid": "" }, { "name": "regulation of cell population proliferation", "id": "GO:0042127", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042127", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "pmid": "" }, { "name": "response to hypoxia", "id": "GO:0001666", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001666", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "pmid": "" }, { "name": "blood coagulation", "id": "GO:0007596", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007596", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "pmid": "" }, { "name": "smooth muscle cell migration", "id": "GO:0014909", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014909", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "pmid": "" }, { "name": "regulation of smooth muscle cell migration", "id": "GO:0014910", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014910", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "pmid": "" }, { "name": "regulation of signaling receptor activity", "id": "GO:0010469", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010469", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "pmid": "" }, { "name": "negative regulation of plasminogen activation", "id": "GO:0010757", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010757", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "pmid": "" }, { "name": "fibrinolysis", "id": "GO:0042730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042730", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "pmid": "" }, { "name": "negative regulation of fibrinolysis", "id": "GO:0051918", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051918", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "pmid": "" }, { "name": "plasminogen activation", "id": "GO:0031639", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031639", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "pmid": "" }, { "name": "regulation of fibrinolysis", "id": "GO:0051917", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051917", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "pmid": "" }, { "name": "regulation of plasminogen activation", "id": "GO:0010755", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010755", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 12, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "pmid": "" }, { "name": "focal adhesion", "id": "GO:0005925", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005925", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "pmid": "" }, { "name": "specific granule membrane", "id": "GO:0035579", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035579", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "pmid": "" }, { "name": "tertiary granule membrane", "id": "GO:0070821", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070821", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "pmid": "" }, { "name": "external side of plasma membrane", "id": "GO:0009897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "pmid": "" }, { "name": "serine-type endopeptidase complex", "id": "GO:1905370", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905370", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "pmid": "" }, { "name": "serine protease inhibitor complex", "id": "GO:0097180", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097180", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "pmid": "" }, { "name": "protein complex involved in cell-matrix adhesion", "id": "GO:0098637", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098637", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "urokinase-type plasminogen activator N-glycosylated 1 (human)", "definition": "A urokinase-type plasminogen activator (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P00749-1, in which the glycan structure is represented by GlyTouCan:G23626NI. Example: UniProtKB:P00749-1, Asn-322, MOD:00160~GNO:G23626NI. [PRO:DNx, PMID:1468573, PMID:2023947, PMID:2393398]", "evidence": [ { "id": "PR:000051248", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051248" } ] }, { "name": "urokinase-type plasminogen activator N-glycosylated 2 (human)", "definition": "A urokinase-type plasminogen activator (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P00749-1, in which the glycan structure is represented by GlyTouCan:G86102AA. Example: UniProtKB:P00749-1, Asn-322, MOD:00160~GNO:G86102AA. [PRO:DNx, PMID:1468573, PMID:2023947, PMID:2393398]", "evidence": [ { "id": "PR:000051249", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051249" } ] } ], "site_annotation": [ { "start_pos": 322, "end_pos": 324, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylation of Ser-158 and Ser-323 abolishes proadhesive ability but does not interfere with receptor binding.", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" }, { "database": "PubMed", "id": "9151681", "url": "https://glygen.org/publication/PubMed/9151681" } ] }, { "annotation": "Produced as an inactive single-chain protein (pro-uPA or sc-uPA), is processed into the active disulfide-linked two-chain form of PLAU/uPA by a proteolytic event mediated, at least, by TMPRSS4.", "evidence": [ { "database": "UniProtKB", "id": "P00749", "url": "https://www.uniprot.org/uniprot/P00749" }, { "database": "PubMed", "id": "24434139", "url": "https://glygen.org/publication/PubMed/24434139" } ] } ], "interactions": [], "reactions": [ { "id": "R-HSA-158925", "name": "plasminogen:histidine-rich glycoprotein -> plasmin + histidine-rich glycoprotein (uPA [two-chain] catalyst)", "equation": "", "summary": "Plasminogen, tethered to the cell surface by its association with histidine-rich glycoprotein, is rapidly cleaved and activated to plasmin by the action of urokinase plasminogen activator(two-chain form) bound to uPAR, its cell-surface receptor. The association of both substrate and enzyme with the cell surface is necessary for the reaction to proceed efficiently (Ellis et al. 1989, 1991).", "cellular_location": "extracellular region, plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P00749-1", "P00747-1" ], "evidence": [ { "id": "R-HSA-158925", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-158925" } ] }, { "id": "R-HSA-158942", "name": "urokinase plasminogen activator (one-chain):uPAR -> urokinase plasminogen activator (two-chain):uPAR", "equation": "", "summary": "The small amount of plasmin generated by the activity of the one-chain form of urokinase plasminogen activator in turn cleaves urokinase plasminogen activator, converting it to its substantially more active two-chain form (Cubellis et al. 1986; Lijnen et al. 1991).", "cellular_location": "extracellular region, plasma membrane", "input_participant_list": [ "R-HSA-158926" ], "output_participant_list": [ "R-HSA-158969" ], "enzyme_list": [ "P00749-1", "P00747-1" ], "evidence": [ { "id": "R-HSA-158942", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-158942" } ] }, { "id": "R-HSA-158959", "name": "urokinase plasminogen activator + urokinase plasminogen activator receptor (uPAR) -> urokinase plasminogen activator:uPAR", "equation": "", "summary": "The uncleaved (one-chain) form of urokinase plasminogen activator associates with urokinase plasminogen activator receptor (uPAR), forming a complex at the cell surface (Cubellis et al. 1986). The complex is anchored to the outer face of the plasma membrane by a glycophosphatidylinositol moiety at the carboxy terminus of uPAR (Behrendt et al. 1990; Ploug et al. 1991).", "cellular_location": "extracellular region, plasma membrane", "input_participant_list": [ "R-HSA-158946", "R-HSA-158979" ], "output_participant_list": [], "enzyme_list": [ "P00749-1" ], "evidence": [ { "id": "R-HSA-158959", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-158959" } ] }, { "id": "R-HSA-158982", "name": "plasminogen:histidine-rich glycoprotein -> plasmin + histidine-rich glycoprotein (uPA [one-chain] catalyst)", "equation": "", "summary": "Plasminogen, tethered to the cell surface by its association with histidine-rich glycoprotein, is cleaved and activated to plasmin by the action of urokinase plasminogen activator bound to uPAR, its cell-surface receptor. The association of both substrate and enzyme with the cell surface is necessary for the reaction to proceed efficiently (Ellis et al. 1991). While the one-chain form of urokinase plasminogen activator is lower than that of the two-chain form, it is still sufficient to initiate the process of plasmin activation (Ellis et al. 1989; Lijnen et al. 1986).", "cellular_location": "extracellular region, plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P00749-1", "P00747-1" ], "evidence": [ { "id": "R-HSA-158982", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-158982" } ] }, { "id": "R-HSA-159001", "name": "urokinase plasminogen activator (two-chain):uPAR + plasminogen activator inhibitor 2 (PAI-2) -> PAI-2:urokinase plasminogen activator (two-chain):uPAR", "equation": "", "summary": "Activated (two-chain) urokinase plasminogen activator binds plasminogen activator inhibitor 2, a serpin, to form a stable, inactive complex that remains associated with uPAR on the plasma membrane (Estreicher et al. 1990; Kruithof et al. 1986).", "cellular_location": "extracellular region, plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P00749-1" ], "evidence": [ { "id": "R-HSA-159001", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159001" } ] }, { "id": "R-HSA-159005", "name": "urokinase plasminogen activator (two-chain):uPAR + plasminogen activator inhibitor 1 (PAI-1) -> PAI-1:urokinase plasminogen activator (two-chain):uPAR", "equation": "", "summary": "Activated (two-chain) urokinase plasminogen activator binds plasminogen activator inhibitor 1, a serpin, to form a stable, inactive complex that remains associated with uPAR on the plasma membrane (Cubellis et al. 1989).", "cellular_location": "extracellular region, plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P00749-1" ], "evidence": [ { "id": "R-HSA-159005", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159005" } ] }, { "id": "R-HSA-6798747", "name": "Exocytosis of tertiary granule membrane proteins", "equation": "", "summary": "Tertiary (gelatinase) granules are part of a continuum of peroxidase-negative granules formed in myelocytes, metamyelocytes, band cells and segmented neutrophils. They differ from secondary granules by having a low content of antimicrobial substances, and are more readily exocytosed (Sengelov et al. 1995). Tertiary granules are primarily a reservoir of extracellular matrix degrading enzymes and membrane receptors that are required for neutrophil extravasation and diapedesis (Faurschou & Borregaard 2003).", "cellular_location": "plasma membrane, tertiary granule membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P01111-1", "Q13393-1", "Q9Y3L5-1", "P61225-1", "O43451-2", "P00749-1", "O14672-1", "P78325-1", "Q8TF62-1", "P98196-1", "Q13303-1", "P10253-1", "Q5T4S7-1", "P04839-1", "Q68CP4-1", "P23467-1" ], "evidence": [ { "id": "R-HSA-6798747", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798747" } ] }, { "id": "R-HSA-6799350", "name": "Exocytosis of specific granule membrane proteins", "equation": "", "summary": "Secondary (specific) granules are peroxidase-negative and rich in antimicrobial substances (Joiner et al. 1989, Rorvig et al. 2012). They are more irregular and elongated in form than azurophil granules (Bainton et al. 1971). This may reflect volume adjustment in azurophil granules, which are known to proteolytically process a significant fraction of the proteins that are targeted to them, while little or no processing and therefore no increase in osmotic activity due to proteolysis has been observed in secondary granules (Borregaard & Cowland 1997). Secondary and tertiary granules have overlapping contents but can be discriminated by their intrinsic buoyant densities when centrifuged on gradient media (Kjeldsen et al. 1994).", "cellular_location": "plasma membrane, specific granule membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q13393-1", "P61225-1", "O15120-1", "Q9NPA2-1", "P62834-1", "P00749-1", "O14672-1", "P78325-1", "P43353-1", "Q8TF62-1", "P98196-1", "Q9Y2Q0-1", "Q12913-1", "Q13303-1", "O15121-1", "O75907-1", "O14975-1", "Q5T4S7-1", "Q10588-1", "P04839-1", "Q68CP4-1", "P23467-1", "P30519-1", "O94804-1" ], "evidence": [ { "id": "R-HSA-6799350", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6799350" } ] } ], "reaction_participants": [ { "participant_id": "R-HSA-158926", "participant_name": "PLAU(21-431):PI-PLAUR [plasma membrane]", "crossref": [ { "id": "CPX-487", "database": "ComplexPortal", "url": "" } ] }, { "participant_id": "R-HSA-158946", "participant_name": "GPI-PLAUR [plasma membrane]", "crossref": [ { "id": "Q03405", "database": "UniProt", "url": "" }, { "id": "1YWH", "database": "PDB", "url": "" }, { "id": "2FD6", "database": "PDB", "url": "" }, { "id": "NP_001005376.1", "database": "RefSeq", "url": "" }, { "id": "2I9B", "database": "PDB", "url": "" }, { "id": "NP_001005377.1", "database": "RefSeq", "url": "" }, { "id": "3BT1", "database": "PDB", "url": "" }, { "id": "Q03405", "database": "Pharos - Targets", "url": "" }, { "id": "7V63", "database": "PDB", "url": "" }, { "id": "Q03405", "database": "ZINC target", "url": "" }, { "id": "UPAR_HUMAN", "database": "ZINC - Substances", "url": "" }, { "id": "4K24", "database": "PDB", "url": "" }, { "id": "ENSP00000339328", "database": "Ensembl", "url": "" }, { "id": "ENSG00000011422", "database": "Ensembl", "url": "" }, { "id": "ENSP00000342049", "database": "Ensembl", "url": "" }, { "id": "ENST00000339082", "database": "Ensembl", "url": "" }, { "id": "ENSP00000221264", "database": "Ensembl", "url": "" }, { "id": "ENST00000340093", "database": "Ensembl", "url": "" }, { "id": "ENST00000221264", "database": "Ensembl", "url": "" }, { "id": "4QTI", "database": "PDB", "url": "" }, { "id": "Q03405", "database": "PRO", "url": "" }, { "id": "7E17", "database": "PDB", "url": "" }, { "id": "NP_001287966.1", "database": "RefSeq", "url": "" }, { "id": "3BT2", "database": "PDB", "url": "" }, { "id": "ENSG00000011422-PLAUR", "database": "HPA", "url": "" }, { "id": "NP_002650.1", "database": "RefSeq", "url": "" }, { "id": "UPAR_HUMAN", "database": "ZINC - Predictions - Purchasable", "url": "" }, { "id": "3U74", "database": "PDB", "url": "" }, { "id": "ENSG00000011422", "database": "OpenTargets", "url": "" }, { "id": "3U73", "database": "PDB", "url": "" }, { "id": "Q03405", "database": "GeneCards", "url": "" } ] }, { "participant_id": "R-HSA-158969", "participant_name": "PI-PLAUR:PLAU(21-177):PLAU(179-431) [plasma membrane]", "crossref": [ { "id": "CPX-487", "database": "ComplexPortal", "url": "" } ] }, { "participant_id": "R-HSA-158979", "participant_name": "PLAU(21-431) [extracellular region]", "crossref": [ { "id": "P00749", "database": "UniProt", "url": "" }, { "id": "6AG2", "database": "PDB", "url": "" }, { "id": "4MNW", "database": "PDB", "url": "" }, { "id": "2O8W", "database": "PDB", "url": "" }, { "id": "5WXF", "database": "PDB", "url": "" }, { "id": "P00749", "database": "GeneCards", "url": "" }, { "id": "1FV9", "database": "PDB", "url": "" }, { "id": "3OY5", "database": "PDB", "url": "" }, { "id": "1SC8", "database": "PDB", "url": "" }, { "id": "2O8U", "database": "PDB", "url": "" }, { "id": "1F92", "database": "PDB", "url": "" }, { "id": "4MNV", "database": "PDB", "url": "" }, { "id": "1GI8", "database": "PDB", "url": "" }, { "id": "6AG3", "database": "PDB", "url": "" }, { "id": "5WXO", "database": "PDB", "url": "" }, { "id": "2R2W", "database": "PDB", "url": "" }, { "id": "3OY6", "database": "PDB", "url": "" }, { "id": "4MNX", "database": "PDB", "url": "" }, { "id": "3PB1", "database": "PDB", "url": "" }, { "id": "1SQA", "database": "PDB", "url": "" }, { "id": "1GI7", "database": "PDB", "url": "" }, { "id": "4OS1", "database": "PDB", "url": "" }, { "id": "1SQT", "database": "PDB", "url": "" }, { "id": "2393", "database": "Guide to Pharmacology - Targets", "url": "" }, { "id": "1GI9", "database": "PDB", "url": "" }, { "id": "6AG7", "database": "PDB", "url": "" }, { "id": "5WXP", "database": "PDB", "url": "" }, { "id": "2VIN", "database": "PDB", "url": "" }, { "id": "1SQO", "database": "PDB", "url": "" }, { "id": "3QN7", "database": "PDB", "url": "" }, { "id": "4MNY", "database": "PDB", "url": "" }, { "id": "4DW2", "database": "PDB", "url": "" }, { "id": "5WXR", "database": "PDB", "url": "" }, { "id": "4DVA", "database": "PDB", "url": "" }, { "id": "1U6Q", "database": "PDB", "url": "" }, { "id": "1GJ7", "database": "PDB", "url": "" }, { "id": "6JYP", "database": "PDB", "url": "" }, { "id": "P00749", "database": "Pharos - Targets", "url": "" }, { "id": "4OS2", "database": "PDB", "url": "" }, { "id": "2VIO", "database": "PDB", "url": "" }, { "id": "6AG9", "database": "PDB", "url": "" }, { "id": "5WXQ", "database": "PDB", "url": "" }, { "id": "3U73", "database": "PDB", "url": "" }, { "id": "1C5Y", "database": "PDB", "url": "" }, { "id": "4ZKN", "database": "PDB", "url": "" }, { "id": "3M61", "database": "PDB", "url": "" }, { "id": "2FD6", "database": "PDB", "url": "" }, { "id": "1OWE", "database": "PDB", "url": "" }, { "id": "5ZAF", "database": "PDB", "url": "" }, { "id": "4FUI", "database": "PDB", "url": "" }, { "id": "1C5X", "database": "PDB", "url": "" }, { "id": "4ZHM", "database": "PDB", "url": "" }, { "id": "1OWD", "database": "PDB", "url": "" }, { "id": "3KID", "database": "PDB", "url": "" }, { "id": "1O5C", "database": "PDB", "url": "" }, { "id": "2I9B", "database": "PDB", "url": "" }, { "id": "3MHW", "database": "PDB", "url": "" }, { "id": "1OWI", "database": "PDB", "url": "" }, { "id": "4GLY", "database": "PDB", "url": "" }, { "id": "4ZKO", "database": "PDB", "url": "" }, { "id": "1C5Z", "database": "PDB", "url": "" }, { "id": "5ZAG", "database": "PDB", "url": "" }, { "id": "1OWH", "database": "PDB", "url": "" }, { "id": "4FUJ", "database": "PDB", "url": "" }, { "id": "2I9A", "database": "PDB", "url": "" }, { "id": "4JK6", "database": "PDB", "url": "" }, { "id": "4JK5", "database": "PDB", "url": "" }, { "id": "HMDBP02055", "database": "HMDB Protein", "url": "" }, { "id": "3MWI", "database": "PDB", "url": "" }, { "id": "2NWN", "database": "PDB", "url": "" }, { "id": "4H42", "database": "PDB", "url": "" }, { "id": "1OWJ", "database": "PDB", "url": "" }, { "id": "5ZAH", "database": "PDB", "url": "" }, { "id": "1EJN", "database": "PDB", "url": "" }, { "id": "4ZKR", "database": "PDB", "url": "" }, { "id": "ENSG00000122861", "database": "OpenTargets", "url": "" }, { "id": "5ZC5", "database": "PDB", "url": "" }, { "id": "5HGG", "database": "PDB", "url": "" }, { "id": "UROK_HUMAN", "database": "ZINC - Predictions - Purchasable", "url": "" }, { "id": "4K24", "database": "PDB", "url": "" }, { "id": "1OWK", "database": "PDB", "url": "" }, { "id": "UROK_HUMAN", "database": "ZINC - World Drugs", "url": "" }, { "id": "3OX7", "database": "PDB", "url": "" }, { "id": "1F5K", "database": "PDB", "url": "" }, { "id": "1F5L", "database": "PDB", "url": "" }, { "id": "2O8T", "database": "PDB", "url": "" }, { "id": "5ZAJ", "database": "PDB", "url": "" }, { "id": "4ZKS", "database": "PDB", "url": "" }, { "id": "1KDU", "database": "PDB", "url": "" }, { "id": "4X1R", "database": "PDB", "url": "" }, { "id": "NP_002649.1", "database": "RefSeq", "url": "" }, { "id": "7VM5", "database": "PDB", "url": "" }, { "id": "3BT2", "database": "PDB", "url": "" }, { "id": "1W10", "database": "PDB", "url": "" }, { "id": "NP_001306120.1", "database": "RefSeq", "url": "" }, { "id": "5ZA7", "database": "PDB", "url": "" }, { "id": "4FUD", "database": "PDB", "url": "" }, { "id": "7VM4", "database": "PDB", "url": "" }, { "id": "1GJD", "database": "PDB", "url": "" }, { "id": "4X1Q", "database": "PDB", "url": "" }, { "id": "UROK_HUMAN", "database": "ZINC - FDA approved", "url": "" }, { "id": "1W12", "database": "PDB", "url": "" }, { "id": "4X1S", "database": "PDB", "url": "" }, { "id": "3IG6", "database": "PDB", "url": "" }, { "id": "7VM6", "database": "PDB", "url": "" }, { "id": "P00749", "database": "PRO", "url": "" }, { "id": "1LMW", "database": "PDB", "url": "" }, { "id": "XP_011538168.1", "database": "RefSeq", "url": "" }, { "id": "1W11", "database": "PDB", "url": "" }, { "id": "5ZA8", "database": "PDB", "url": "" }, { "id": "4FUE", "database": "PDB", "url": "" }, { "id": "4FUG", "database": "PDB", "url": "" }, { "id": "4XSK", "database": "PDB", "url": "" }, { "id": "1W13", "database": "PDB", "url": "" }, { "id": "1O5A", "database": "PDB", "url": "" }, { "id": "3KGP", "database": "PDB", "url": "" }, { "id": "7VM7", "database": "PDB", "url": "" }, { "id": "4FUF", "database": "PDB", "url": "" }, { "id": "5ZA9", "database": "PDB", "url": "" }, { "id": "1O3P", "database": "PDB", "url": "" }, { "id": "ENSG00000122861-PLAU", "database": "HPA", "url": "" }, { "id": "1W14", "database": "PDB", "url": "" }, { "id": "5ZAE", "database": "PDB", "url": "" }, { "id": "4FUH", "database": "PDB", "url": "" }, { "id": "4ZHL", "database": "PDB", "url": "" }, { "id": "3KHV", "database": "PDB", "url": "" }, { "id": "1O5B", "database": "PDB", "url": "" }, { "id": "1C5W", "database": "PDB", "url": "" }, { "id": "1URK", "database": "PDB", "url": "" }, { "id": "UROK_HUMAN", "database": "ZINC - Investigational", "url": "" }, { "id": "4FU7", "database": "PDB", "url": "" }, { "id": "5WXS", "database": "PDB", "url": "" }, { "id": "4OS5", "database": "PDB", "url": "" }, { "id": "2VIP", "database": "PDB", "url": "" }, { "id": "6JYQ", "database": "PDB", "url": "" }, { "id": "1GJ8", "database": "PDB", "url": "" }, { "id": "4OS4", "database": "PDB", "url": "" }, { "id": "6L05", "database": "PDB", "url": "" }, { "id": "4X0W", "database": "PDB", "url": "" }, { "id": "4OS7", "database": "PDB", "url": "" }, { "id": "1VJ9", "database": "PDB", "url": "" }, { "id": "5WXT", "database": "PDB", "url": "" }, { "id": "4FU8", "database": "PDB", "url": "" }, { "id": "4OS6", "database": "PDB", "url": "" }, { "id": "ENST00000372764", "database": "Ensembl", "url": "" }, { "id": "ENST00000446342", "database": "Ensembl", "url": "" }, { "id": "ENSG00000122861", "database": "Ensembl", "url": "" }, { "id": "1GJC", "database": "PDB", "url": "" }, { "id": "1W0Z", "database": "PDB", "url": "" }, { "id": "4X1P", "database": "PDB", "url": "" }, { "id": "18967", "database": "Orphanet", "url": "" }, { "id": "UROK_HUMAN", "database": "ZINC - Substances", "url": "" }, { "id": "2VNT", "database": "PDB", "url": "" }, { "id": "NP_001138503.1", "database": "RefSeq", "url": "" }, { "id": "7DZD", "database": "PDB", "url": "" }, { "id": "4FUC", "database": "PDB", "url": "" }, { "id": "5Z1C", "database": "PDB", "url": "" }, { "id": "3BT1", "database": "PDB", "url": "" }, { "id": "ENSP00000361850", "database": "Ensembl", "url": "" }, { "id": "ENSP00000388474", "database": "Ensembl", "url": "" }, { "id": "5YC6", "database": "PDB", "url": "" }, { "id": "1GJA", "database": "PDB", "url": "" }, { "id": "2VIV", "database": "PDB", "url": "" }, { "id": "4FU9", "database": "PDB", "url": "" }, { "id": "6NMB", "database": "PDB", "url": "" }, { "id": "1VJA", "database": "PDB", "url": "" }, { "id": "1GJB", "database": "PDB", "url": "" }, { "id": "4X1N", "database": "PDB", "url": "" }, { "id": "6XVD", "database": "PDB", "url": "" }, { "id": "P00749", "database": "ZINC target", "url": "" }, { "id": "2VIW", "database": "PDB", "url": "" }, { "id": "4FUB", "database": "PDB", "url": "" }, { "id": "5YC7", "database": "PDB", "url": "" }, { "id": "1GJ9", "database": "PDB", "url": "" }, { "id": "2VIQ", "database": "PDB", "url": "" }, { "id": "6L04", "database": "PDB", "url": "" }, { "id": "5XG4", "database": "PDB", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "O14672", "gene_name": "ADAM10", "activity": [ { "ec_number": "3.4.24.81", "activity": "Endopeptidase of broad specificity.", "evidence": [ { "id": "O14672", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14672" } ] }, { "ec_number": "3.4.24.81", "activity": "", "evidence": [ { "id": "O14672", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14672" } ] } ] }, { "uniprot_ac": "O14975", "gene_name": "SLC27A2", "activity": [ { "ec_number": "6.2.1.3", "activity": "a long-chain fatty acid + ATP + CoA = a long-chain fatty acyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "O14975", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14975" } ] }, { "ec_number": "6.2.1.-", "activity": "", "evidence": [ { "id": "O14975", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14975" } ] }, { "ec_number": "6.2.1.7", "activity": "(25R)-3alpha,7alpha,12alpha-trihydroxy-5beta-cholestan-26-oate + ATP + CoA = (25R)-3alpha,7alpha,12alpha-trihydroxy-5beta-cholestan-26-oyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "O14975", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14975" } ] }, { "ec_number": "6.2.1.24", "activity": "3,7,11,15-tetramethylhexadecanoate + ATP + CoA = AMP + diphosphate + phytanoyl-CoA.", "evidence": [ { "id": "O14975", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14975" } ] }, { "ec_number": "6.2.1.15", "activity": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + ATP + CoA = (5Z,8Z,11Z,14Z)-eicosatetraenoyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "O14975", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14975" } ] }, { "ec_number": "6.2.1.3", "activity": "", "evidence": [ { "id": "O14975", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14975" } ] } ] }, { "uniprot_ac": "O15120", "gene_name": "AGPAT2", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "O15120", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15120" } ] }, { "ec_number": "2.3.1.51", "activity": "", "evidence": [ { "id": "O15120", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15120" } ] } ] }, { "uniprot_ac": "O15121", "gene_name": "DEGS1", "activity": [ { "ec_number": "1.14.19.17", "activity": "an N-acylsphinganine + 2 Fe(II)-[cytochrome b5] + 2 H(+) + O2 = an N-acylsphing-4-enine + 2 Fe(III)-[cytochrome b5] + 2 H2O.", "evidence": [ { "id": "O15121", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15121" } ] }, { "ec_number": "5.2.1.-", "activity": "", "evidence": [ { "id": "O15121", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15121" } ] }, { "ec_number": "1.14.19.17", "activity": "", "evidence": [ { "id": "O15121", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15121" } ] } ] }, { "uniprot_ac": "O43451", "gene_name": "MGAM", "activity": [ { "ec_number": "3.2.1.20", "activity": "Hydrolysis of terminal, non-reducing (1->4)-linked alpha-D-glucose residues with release of alpha-D-glucose.", "evidence": [ { "id": "O43451", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43451" } ] } ] }, { "uniprot_ac": "O75907", "gene_name": "DGAT1", "activity": [ { "ec_number": "2.3.1.20", "activity": "a 1,2-diacyl-sn-glycerol + an acyl-CoA = a triacyl-sn-glycerol + CoA.", "evidence": [ { "id": "O75907", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75907" } ] }, { "ec_number": "2.3.1.76", "activity": "all-trans-retinol + an acyl-CoA = an all-trans-retinyl ester + CoA.", "evidence": [ { "id": "O75907", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75907" } ] }, { "ec_number": "2.3.1.20", "activity": "", "evidence": [ { "id": "O75907", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75907" } ] } ] }, { "uniprot_ac": "O94804", "gene_name": "STK10", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O94804", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O94804" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O94804", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O94804" } ] } ] }, { "uniprot_ac": "P00747", "gene_name": "PLG", "activity": [ { "ec_number": "3.4.21.7", "activity": "Preferential cleavage: Lys-|-Xaa > Arg-|-Xaa, higher selectivity than trypsin. Converts fibrin into soluble products.", "evidence": [ { "id": "P00747", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00747" } ] }, { "ec_number": "3.4.21.7", "activity": "", "evidence": [ { "id": "P00747", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00747" } ] } ] }, { "uniprot_ac": "P00749", "gene_name": "PLAU", "activity": [ { "ec_number": "3.4.21.73", "activity": "Specific cleavage of Arg-|-Val bond in plasminogen to form plasmin.", "evidence": [ { "id": "P00749", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00749" } ] }, { "ec_number": "3.4.21.73", "activity": "", "evidence": [ { "id": "P00749", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00749" } ] } ] }, { "uniprot_ac": "P01111", "gene_name": "NRAS", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P01111", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01111" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P01111", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01111" } ] } ] }, { "uniprot_ac": "P04839", "gene_name": "CYBB", "activity": [ { "ec_number": "1.-.-.-", "activity": "", "evidence": [ { "id": "P04839", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04839" } ] } ] }, { "uniprot_ac": "P10253", "gene_name": "GAA", "activity": [ { "ec_number": "3.2.1.20", "activity": "Hydrolysis of terminal, non-reducing (1->4)-linked alpha-D-glucose residues with release of alpha-D-glucose.", "evidence": [ { "id": "P10253", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10253" } ] }, { "ec_number": "3.2.1.20", "activity": "", "evidence": [ { "id": "P10253", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10253" } ] } ] }, { "uniprot_ac": "P23467", "gene_name": "PTPRB", "activity": [ { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "P23467", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23467" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P23467", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23467" } ] } ] }, { "uniprot_ac": "P30519", "gene_name": "HMOX2", "activity": [ { "ec_number": "1.14.14.18", "activity": "heme b + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = biliverdin IXalpha + CO + Fe(2+) + H(+) + 3 H2O + 3 oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P30519", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30519" } ] }, { "ec_number": "1.14.14.18", "activity": "", "evidence": [ { "id": "P30519", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30519" } ] } ] }, { "uniprot_ac": "P43353", "gene_name": "ALDH3B1", "activity": [ { "ec_number": "1.2.1.5", "activity": "an aldehyde + H2O + NAD(+) = a carboxylate + 2 H(+) + NADH.", "evidence": [ { "id": "P43353", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P43353" } ] }, { "ec_number": "1.2.1.28", "activity": "benzaldehyde + H2O + NAD(+) = benzoate + 2 H(+) + NADH.", "evidence": [ { "id": "P43353", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P43353" } ] }, { "ec_number": "1.2.1.7", "activity": "benzaldehyde + H2O + NADP(+) = benzoate + 2 H(+) + NADPH.", "evidence": [ { "id": "P43353", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P43353" } ] }, { "ec_number": "1.2.1.7", "activity": "", "evidence": [ { "id": "P43353", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P43353" } ] }, { "ec_number": "1.2.1.5", "activity": "", "evidence": [ { "id": "P43353", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P43353" } ] }, { "ec_number": "1.2.1.28", "activity": "", "evidence": [ { "id": "P43353", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P43353" } ] } ] }, { "uniprot_ac": "P61225", "gene_name": "RAP2B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61225", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61225" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61225", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61225" } ] } ] }, { "uniprot_ac": "P62834", "gene_name": "RAP1A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P62834", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62834" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62834", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62834" } ] } ] }, { "uniprot_ac": "P78325", "gene_name": "ADAM8", "activity": [ { "ec_number": "3.4.24.-", "activity": "", "evidence": [ { "id": "P78325", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78325" } ] } ] }, { "uniprot_ac": "P98196", "gene_name": "ATP11A", "activity": [ { "ec_number": "7.6.2.1", "activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.", "evidence": [ { "id": "P98196", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P98196" } ] }, { "ec_number": "7.6.2.1", "activity": "", "evidence": [ { "id": "P98196", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P98196" } ] } ] }, { "uniprot_ac": "Q10588", "gene_name": "BST1", "activity": [ { "ec_number": "3.2.2.6", "activity": "H2O + NAD(+) = ADP-D-ribose + H(+) + nicotinamide.", "evidence": [ { "id": "Q10588", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q10588" } ] }, { "ec_number": "3.2.2.6", "activity": "", "evidence": [ { "id": "Q10588", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q10588" } ] } ] }, { "uniprot_ac": "Q12913", "gene_name": "PTPRJ", "activity": [ { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "Q12913", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12913" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q12913", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12913" } ] } ] }, { "uniprot_ac": "Q13303", "gene_name": "KCNAB2", "activity": [ { "ec_number": "1.1.1.-", "activity": "", "evidence": [ { "id": "Q13303", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13303" } ] } ] }, { "uniprot_ac": "Q13393", "gene_name": "PLD1", "activity": [ { "ec_number": "3.1.4.4", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphate + choline + H(+).", "evidence": [ { "id": "Q13393", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13393" } ] }, { "ec_number": "3.1.4.4", "activity": "", "evidence": [ { "id": "Q13393", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13393" } ] } ] }, { "uniprot_ac": "Q5T4S7", "gene_name": "UBR4", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q5T4S7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5T4S7" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q5T4S7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5T4S7" } ] } ] }, { "uniprot_ac": "Q68CP4", "gene_name": "HGSNAT", "activity": [ { "ec_number": "2.3.1.78", "activity": "acetyl-CoA + alpha-D-glucosaminyl-[heparan sulfate](n) = CoA + H(+) + N-acetyl-alpha-D-glucosaminyl-[heparan sulfate](n).", "evidence": [ { "id": "Q68CP4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68CP4" } ] }, { "ec_number": "2.3.1.78", "activity": "", "evidence": [ { "id": "Q68CP4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68CP4" } ] } ] }, { "uniprot_ac": "Q8TF62", "gene_name": "ATP8B4", "activity": [ { "ec_number": "7.6.2.1", "activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.", "evidence": [ { "id": "Q8TF62", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TF62" } ] }, { "ec_number": "7.6.2.1", "activity": "", "evidence": [ { "id": "Q8TF62", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TF62" } ] } ] }, { "uniprot_ac": "Q9NPA2", "gene_name": "MMP25", "activity": [ { "ec_number": "3.4.24.-", "activity": "", "evidence": [ { "id": "Q9NPA2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NPA2" } ] } ] }, { "uniprot_ac": "Q9Y2Q0", "gene_name": "ATP8A1", "activity": [ { "ec_number": "7.6.2.1", "activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.", "evidence": [ { "id": "Q9Y2Q0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2Q0" } ] }, { "ec_number": "7.6.2.1", "activity": "", "evidence": [ { "id": "Q9Y2Q0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2Q0" } ] } ] }, { "uniprot_ac": "Q9Y3L5", "gene_name": "RAP2C", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9Y3L5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y3L5" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9Y3L5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y3L5" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 322 ], "o_linked_sites": [ 38, 156, 158 ], "snv_sites": [ 38, 81, 158, 191, 247, 264, 276 ], "glycation_sites": [], "phosphorylation_sites": [ 158, 323 ], "sequon_annotation_sites": [ { "start_pos": 322, "end_pos": 324 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 19 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 13 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 4 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 17 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 13 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 3 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 70 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }