{
"uniprot_canonical_ac": "P00747-1",
"uniprot_ac": "P00747",
"uniprot_id": "PLMN_HUMAN",
"mass": {
"chemical_mass": 90569.0,
"monoisotopic_mass": 90569.0
},
"refseq": {
"ac": "NP_000292",
"name": "plasminogen isoform 1 precursor",
"summary": "The plasminogen protein encoded by this gene is a serine protease that circulates in blood plasma as an inactive zymogen and is converted to the active protease, plasmin, by several plasminogen activators such as tissue plasminogen activator (tPA), urokinase plasminogen activator (uPA), kallikrein, and factor XII (Hageman factor). The conversion of plasminogen to plasmin involves the cleavage of the peptide bond between Arg-561 and Val-562. Plasmin cleavage also releases the angiostatin protein which inhibits angiogenesis. Plasmin degrades many blood plasma proteins, including fibrin-containing blood clots. As a serine protease, plasmin cleaves many products in addition to fibrin such as fibronectin, thrombospondin, laminin, and von Willebrand factor. Plasmin is inactivated by proteins such as alpha-2-macroglobulin and alpha-2-antiplasmin in addition to inhibitors of the various plasminogen activators. Plasminogen also interacts with plasminogen receptors which results in the retention of plasmin on cell surfaces and in plasmin-induced cell signaling. The localization of plasminogen on cell surfaces plays a role in the degradation of extracellular matrices, cell migration, inflamation, wound healing, oncogenesis, metastasis, myogenesis, muscle regeneration, neurite outgrowth, and fibrinolysis. This protein may also play a role in acute respiratory distress syndrome (ARDS) which, in part, is caused by enhanced clot formation and the suppression of fibrinolysis. Compared to other mammals, the cluster of plasminogen-like genes to which this gene belongs has been rearranged in catarrhine primates. [provided by RefSeq, May 2020].",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000292"
},
"gene_names": [
{
"name": "PLG",
"resource": "UniProtKB",
"type": "recommended",
"url": "https://www.uniprot.org/uniprot/P00747",
"id": "P00747"
},
{
"name": "HAE4",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000292",
"id": "NP_000292"
},
{
"name": "PLG",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000292",
"id": "NP_000292"
},
{
"name": "hCG_2029799",
"resource": "UniProtKB",
"type": "synonym",
"url": "https://www.uniprot.org/uniprot/P00747",
"id": "P00747"
}
],
"protein_names": [
{
"name": "Plasminogen",
"resource": "UniProtKB",
"type": "recommended",
"url": "",
"id": "P00747"
},
{
"name": "3.4.21.7",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P00747"
},
{
"name": "plasminogen isoform 1 precursor",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000292",
"id": "NP_000292"
},
{
"name": "plasmin",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000292",
"id": "NP_000292"
}
],
"function": [
{
"annotation": "(Microbial infection) Binds to OspC on the surface of B.burgdorferi cells, possibly conferring an extracellular protease activity on the bacteria that allows it to traverse host tissue.",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747#function"
},
{
"database": "PubMed",
"id": "22433849",
"url": "https://glygen.org/publication/PubMed/22433849"
}
]
},
{
"annotation": "(Microbial infection) ENO/enoloase from parasite P.falciparum (strain NF54) interacts with PLG present in the mosquito blood meal to promote the invasion of the mosquito midgut by the parasite ookinete (PubMed:21949403). The catalytic active form, plasmin, is essential for the invasion of the mosquito midgut (PubMed:21949403).",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747#function"
},
{
"database": "PubMed",
"id": "21949403",
"url": "https://glygen.org/publication/PubMed/21949403"
}
]
},
{
"annotation": "A dual role for ERK-1/2 in the regulation of plasmin activity and cell migration in metastatic NSCLC-H1299 cells.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000292",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000292"
},
{
"database": "PubMed",
"id": "37712947",
"url": "https://glygen.org/publication/PubMed/37712947"
}
]
},
{
"annotation": "Angiostatin is an angiogenesis inhibitor that blocks neovascularization and growth of experimental primary and metastatic tumors in vivo.",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747#function"
},
{
"database": "PubMed",
"id": "14699093",
"url": "https://glygen.org/publication/PubMed/14699093"
}
]
},
{
"annotation": "Crosstalk between the plasminogen/plasmin system and inflammation resolution. Review article",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000292",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000292"
},
{
"database": "PubMed",
"id": "37495082",
"url": "https://glygen.org/publication/PubMed/37495082"
}
]
},
{
"annotation": "Increased glutamate in type 2 diabetes in the Korean population is associated with increased plasminogen levels.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000292",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000292"
},
{
"database": "PubMed",
"id": "37314019",
"url": "https://glygen.org/publication/PubMed/37314019"
}
]
},
{
"annotation": "Plasmin dissolves the fibrin of blood clots and acts as a proteolytic factor in a variety of other processes including embryonic development, tissue remodeling, tumor invasion, and inflammation. In ovulation, weakens the walls of the Graafian follicle. It activates the urokinase-type plasminogen activator, collagenases and several complement zymogens, such as C1 and C5. Cleavage of fibronectin and laminin leads to cell detachment and apoptosis. Also cleaves fibrin, thrombospondin and von Willebrand factor. Its role in tissue remodeling and tumor invasion may be modulated by CSPG4. Binds to cells.",
"evidence": [
{
"database": "UniProtKB",
"id": "A0A9L9PXP2",
"url": "https://www.uniprot.org/uniprot/A0A9L9PXP2#function"
},
{
"database": "UniProtKB",
"id": "ARBA00025229",
"url": "https://www.uniprot.org/uniprot/ARBA00025229#function"
},
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747#function"
},
{
"database": "PubMed",
"id": "14699093",
"url": "https://glygen.org/publication/PubMed/14699093"
},
{
"database": "UniProtKB",
"id": "A6PVI2",
"url": "https://www.uniprot.org/uniprot/A6PVI2#function"
}
]
},
{
"annotation": "Plasminogen deficiency suppresses pancreatic ductal adenocarcinoma disease progression.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000292",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000292"
},
{
"database": "PubMed",
"id": "37971174",
"url": "https://glygen.org/publication/PubMed/37971174"
}
]
},
{
"annotation": "The Role of the Plasminogen/Plasmin System in Inflammation of the Oral Cavity. Review article Publication Status: Online-Only",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000292",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000292"
},
{
"database": "PubMed",
"id": "36766787",
"url": "https://glygen.org/publication/PubMed/36766787"
}
]
},
{
"annotation": "The plasminogen protein encoded by this gene is a serine protease that circulates in blood plasma as an inactive zymogen and is converted to the active protease, plasmin, by several plasminogen activators such as tissue plasminogen activator (tPA), urokinase plasminogen activator (uPA), kallikrein, and factor XII (Hageman factor). The conversion of plasminogen to plasmin involves the cleavage of the peptide bond between Arg-561 and Val-562. Plasmin cleavage also releases the angiostatin protein which inhibits angiogenesis. Plasmin degrades many blood plasma proteins, including fibrin-containing blood clots. As a serine protease, plasmin cleaves many products in addition to fibrin such as fibronectin, thrombospondin, laminin, and von Willebrand factor. Plasmin is inactivated by proteins such as alpha-2-macroglobulin and alpha-2-antiplasmin in addition to inhibitors of the various plasminogen activators. Plasminogen also interacts with plasminogen receptors which results in the retention of plasmin on cell surfaces and in plasmin-induced cell signaling. The localization of plasminogen on cell surfaces plays a role in the degradation of extracellular matrices, cell migration, inflamation, wound healing, oncogenesis, metastasis, myogenesis, muscle regeneration, neurite outgrowth, and fibrinolysis. This protein may also play a role in acute respiratory distress syndrome (ARDS) which, in part, is caused by enhanced clot formation and the suppression of fibrinolysis. Compared to other mammals, the cluster of plasminogen-like genes to which this gene belongs has been rearranged in catarrhine primates. [provided by RefSeq, May 2020].",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000292",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000292"
}
]
}
],
"disease": [
{
"disease_id": "DOID:0111592",
"recommended_name": {
"id": "DOID:0111592",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0111592",
"name": "plasminogen deficiency type I",
"description": "A syndrome characterized by decreased serum plasminogen activity, decreased plasminogen antigen levels, and chronic mucosal pseudomembranous lesions typically manifesting as ligneous conjunctivitis that has_material_basis_in homozygous or compound heterozygous mutation in PLG on chromosome 6q26."
},
"synonyms": [
{
"id": "DOID:0111592",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0111592",
"name": "hypoplasminogenemia",
"description": ""
},
{
"id": "MONDO:0009009",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009009",
"name": "hypoplasminogenemia",
"description": "Severe hypoplasminogenemia (HPG) or type 1 plasminogen (plg) deficiency is a systemic disease characterized by markedly impaired extracellular fibrinolysis leading to the formation of ligneous (fibrin-rich) pseudomembranes on mucosae during wound healing."
},
{
"id": "MONDO:0009009",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009009",
"name": "hypoplasminogenemia",
"description": ""
},
{
"id": "MONDO:0009009",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009009",
"name": "plasminogen deficiency type 1",
"description": ""
},
{
"id": "MONDO:0009009",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009009",
"name": "Dysplasminogenemia",
"description": ""
},
{
"id": "MONDO:0009009",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009009",
"name": "ligneous conjunctivitis",
"description": ""
},
{
"id": "MONDO:0009009",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009009",
"name": "plasminogen deficiency, type 1",
"description": ""
},
{
"id": "MONDO:0009009",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009009",
"name": "plasminogen deficiency, type 2",
"description": ""
},
{
"id": "MONDO:0009009",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009009",
"name": "plasminogen deficiency, type I",
"description": ""
},
{
"id": "MONDO:0009009",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009009",
"name": "type 1 plasminogen deficiency",
"description": ""
},
{
"id": "MIM:217090",
"resource": "MIM",
"url": "https://www.omim.org/entry/217090",
"name": "Plasminogen deficiency",
"description": "Plasminogen deficiency"
}
],
"evidence": [
{
"id": "217090",
"database": "MIM",
"url": "https://www.omim.org/entry/217090"
}
]
},
{
"disease_id": "MONDO:0025712",
"recommended_name": {
"id": "MONDO:0025712",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0025712",
"name": "angioedema, hereditary, 4",
"description": ""
},
"synonyms": [
{
"id": "MONDO:0025712",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0025712",
"name": "HAE4",
"description": ""
},
{
"id": "MIM:619360",
"resource": "MIM",
"url": "https://www.omim.org/entry/619360",
"name": "Angioedema, hereditary, 4",
"description": "Angioedema, hereditary, 4"
}
],
"evidence": [
{
"id": "619360",
"database": "MIM",
"url": "https://www.omim.org/entry/619360"
}
]
}
],
"snv": [
{
"evidence": [
{
"id": "P00747",
"database": "BioMuta",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P00747"
}
],
"glycoeffect": [],
"start_pos": 158,
"end_pos": 158,
"subjects_tested": "0",
"subjects_positive": "0",
"frequency": "0.0",
"sequence_org": "D",
"sequence_mut": "N",
"comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).",
"chr_id": "6",
"chr_pos": "160713050",
"ref_nt": "G",
"alt_nt": "A",
"minor_allelic_frequency": "",
"site_lbl": "D158",
"disease": [
{
"disease_id": "DOID:4159",
"recommended_name": {
"id": "DOID:4159",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:4159",
"name": "skin cancer",
"description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells."
},
"synonyms": [
{
"id": "DOID:4159",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:4159",
"name": "CA - skin cancer",
"description": ""
},
{
"id": "DOID:4159",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:4159",
"name": "malignant neoplasm of skin",
"description": ""
},
{
"id": "DOID:4159",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:4159",
"name": "melanoma and Non-melanoma skin cancer",
"description": ""
}
]
},
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
},
{
"disease_id": "DOID:9256",
"recommended_name": {
"id": "DOID:9256",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9256",
"name": "colorectal cancer",
"description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
},
"synonyms": [
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, advanced, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer with chromosomal instability, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectum cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectum neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "CRC",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "large intestine cancer",
"description": ""
},
{
"id": "MIM:114500",
"resource": "MIM",
"url": "https://www.omim.org/entry/114500",
"name": "Colorectal cancer",
"description": "Colorectal cancer"
}
]
}
],
"keywords": [
"biomuta",
"somatic",
"cancer",
"disease"
]
},
{
"evidence": [
{
"id": "P00747",
"database": "BioMuta",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P00747"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 159,
"end_pos": 159,
"subjects_tested": "0",
"subjects_positive": "0",
"frequency": "0.0",
"sequence_org": "P",
"sequence_mut": "S",
"comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NDP->NDS).",
"chr_id": "6",
"chr_pos": "160713053",
"ref_nt": "C",
"alt_nt": "T",
"minor_allelic_frequency": "",
"site_lbl": "P159",
"disease": [
{
"disease_id": "DOID:4159",
"recommended_name": {
"id": "DOID:4159",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:4159",
"name": "skin cancer",
"description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells."
},
"synonyms": [
{
"id": "DOID:4159",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:4159",
"name": "CA - skin cancer",
"description": ""
},
{
"id": "DOID:4159",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:4159",
"name": "malignant neoplasm of skin",
"description": ""
},
{
"id": "DOID:4159",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:4159",
"name": "melanoma and Non-melanoma skin cancer",
"description": ""
}
]
}
],
"keywords": [
"biomuta",
"somatic",
"cancer",
"disease"
]
},
{
"evidence": [
{
"id": "rs1418948029",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1418948029"
},
{
"id": "rs1418948029",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs1418948029#frequency_tab"
}
],
"glycoeffect": [
"o-glyco-site-loss"
],
"start_pos": 263,
"end_pos": 263,
"sequence_org": "T",
"sequence_mut": "I",
"comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).",
"chr_id": "6",
"chr_pos": "160718294",
"ref_nt": "T",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "T263",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs771191021",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771191021"
},
{
"id": "rs771191021",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771191021"
},
{
"id": "rs771191021",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs771191021"
}
],
"glycoeffect": [
"o-glyco-site-loss"
],
"start_pos": 28,
"end_pos": 28,
"sequence_org": "T",
"sequence_mut": "I",
"comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).",
"chr_id": "6",
"chr_pos": "160706440",
"ref_nt": "T",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "T28",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs1228855762",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1228855762"
},
{
"id": "rs1228855762",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs1228855762#frequency_tab"
},
{
"id": "rs1228855762",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs1228855762"
}
],
"glycoeffect": [
"n-glyco-sequon-loss"
],
"start_pos": 308,
"end_pos": 308,
"sequence_org": "N",
"sequence_mut": "I",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->IRT).",
"chr_id": "6",
"chr_pos": "160718429",
"ref_nt": "T",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "N308",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs752244249",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752244249"
},
{
"id": "rs752244249",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752244249"
},
{
"id": "rs752244249",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs752244249"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 315,
"end_pos": 315,
"sequence_org": "P",
"sequence_mut": "S",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NFP->NFS).",
"chr_id": "6",
"chr_pos": "160718449",
"ref_nt": "T",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "P315",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "P00747",
"database": "BioMuta",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P00747"
},
{
"id": "rs961449882",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs961449882"
},
{
"id": "rs961449882",
"database": "NCI-TCGA",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs961449882"
},
{
"id": "rs961449882",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs961449882#frequency_tab"
}
],
"glycoeffect": [
"o-glyco-site-loss"
],
"start_pos": 358,
"end_pos": 358,
"subjects_tested": "0",
"subjects_positive": "0",
"frequency": "0.0",
"sequence_org": "S",
"sequence_mut": "F",
"comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->F).",
"chr_id": "6",
"chr_pos": "160718815",
"ref_nt": "C",
"alt_nt": "T",
"minor_allelic_frequency": "",
"site_lbl": "S358",
"disease": [
{
"disease_id": "DOID:4159",
"recommended_name": {
"id": "DOID:4159",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:4159",
"name": "skin cancer",
"description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells."
},
"synonyms": [
{
"id": "DOID:4159",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:4159",
"name": "CA - skin cancer",
"description": ""
},
{
"id": "DOID:4159",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:4159",
"name": "malignant neoplasm of skin",
"description": ""
},
{
"id": "DOID:4159",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:4159",
"name": "melanoma and Non-melanoma skin cancer",
"description": ""
}
]
}
],
"keywords": [
"biomuta",
"somatic",
"cancer",
"disease",
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs201973253",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201973253"
},
{
"id": "rs201973253",
"database": "1000Genomes",
"url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs201973253"
},
{
"id": "rs201973253",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201973253"
},
{
"id": "rs201973253",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs201973253"
}
],
"glycoeffect": [
"o-glyco-site-loss"
],
"start_pos": 359,
"end_pos": 359,
"sequence_org": "T",
"sequence_mut": "A",
"comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).",
"chr_id": "6",
"chr_pos": "160718817",
"ref_nt": "G",
"alt_nt": "null",
"minor_allelic_frequency": "0.0002",
"site_lbl": "T359",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs1459884645",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1459884645"
},
{
"id": "rs1459884645",
"database": "NCI-TCGA",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1459884645"
},
{
"id": "rs1459884645",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs1459884645#frequency_tab"
},
{
"id": "rs1459884645",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs1459884645"
}
],
"glycoeffect": [
"o-glyco-site-loss"
],
"start_pos": 359,
"end_pos": 359,
"sequence_org": "T",
"sequence_mut": "M",
"comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->M).",
"chr_id": "6",
"chr_pos": "160718818",
"ref_nt": "T",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "T359",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs1459884645",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1459884645"
},
{
"id": "rs1459884645",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs1459884645#frequency_tab"
},
{
"id": "rs1459884645",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs1459884645"
}
],
"glycoeffect": [
"o-glyco-site-loss"
],
"start_pos": 359,
"end_pos": 359,
"sequence_org": "T",
"sequence_mut": "R",
"comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->R).",
"chr_id": "6",
"chr_pos": "160718818",
"ref_nt": "G",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "T359",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs1342038607",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1342038607"
},
{
"id": "rs1342038607",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs1342038607"
}
],
"glycoeffect": [
"o-glyco-site-loss"
],
"start_pos": 365,
"end_pos": 365,
"sequence_org": "T",
"sequence_mut": "I",
"comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).",
"chr_id": "6",
"chr_pos": "160718836",
"ref_nt": "T",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "T365",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs1582938282",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1582938282"
},
{
"id": "rs1582938282",
"database": "ENSEMBL",
"url": "https://www.ensembl.org/id/rs1582938282"
}
],
"glycoeffect": [
"o-glyco-site-loss"
],
"start_pos": 365,
"end_pos": 365,
"sequence_org": "T",
"sequence_mut": "P",
"comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->P).",
"chr_id": "6",
"chr_pos": "160718835",
"ref_nt": "C",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "T365",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs780940385",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780940385"
},
{
"id": "rs780940385",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780940385"
},
{
"id": "rs780940385",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs780940385#frequency_tab"
},
{
"id": "rs780940385",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs780940385"
}
],
"glycoeffect": [
"o-glyco-site-loss"
],
"start_pos": 371,
"end_pos": 371,
"sequence_org": "T",
"sequence_mut": "I",
"comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).",
"chr_id": "6",
"chr_pos": "160722423",
"ref_nt": "T",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "T371",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs780940385",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780940385"
},
{
"id": "rs780940385",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780940385"
},
{
"id": "rs780940385",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs780940385#frequency_tab"
},
{
"id": "rs780940385",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs780940385"
}
],
"glycoeffect": [
"o-glyco-site-loss"
],
"start_pos": 371,
"end_pos": 371,
"sequence_org": "T",
"sequence_mut": "N",
"comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->N).",
"chr_id": "6",
"chr_pos": "160722423",
"ref_nt": "A",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "T371",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs780940385",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780940385"
},
{
"id": "rs780940385",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780940385"
},
{
"id": "rs780940385",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs780940385#frequency_tab"
},
{
"id": "rs780940385",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs780940385"
}
],
"glycoeffect": [
"n-glyco-sequon-gain",
"o-glyco-site-loss"
],
"start_pos": 388,
"end_pos": 388,
"sequence_org": "T",
"sequence_mut": "N",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TSS->NSS).",
"chr_id": "6",
"chr_pos": "160722423",
"ref_nt": "A",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "T388",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs1408106784",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1408106784"
},
{
"id": "rs1408106784",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs1408106784"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 420,
"end_pos": 420,
"sequence_org": "G",
"sequence_mut": "S",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NAG->NAS).",
"chr_id": "6",
"chr_pos": "160731052",
"ref_nt": "A",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "G420",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs773350034",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773350034"
},
{
"id": "rs773350034",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773350034"
},
{
"id": "rs773350034",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs773350034#frequency_tab"
},
{
"id": "rs773350034",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs773350034"
}
],
"glycoeffect": [
"o-glyco-site-loss"
],
"start_pos": 457,
"end_pos": 457,
"sequence_org": "T",
"sequence_mut": "A",
"comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).",
"chr_id": "6",
"chr_pos": "160731163",
"ref_nt": "G",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "T457",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs758250276",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758250276"
},
{
"id": "rs758250276",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758250276"
},
{
"id": "rs758250276",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs758250276"
}
],
"glycoeffect": [
"o-glyco-site-loss"
],
"start_pos": 457,
"end_pos": 457,
"sequence_org": "T",
"sequence_mut": "I",
"comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).",
"chr_id": "6",
"chr_pos": "160731113",
"ref_nt": "T",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "T457",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs1281388937",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1281388937"
},
{
"id": "rs1281388937",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs1281388937#frequency_tab"
}
],
"glycoeffect": [
"o-glyco-site-loss"
],
"start_pos": 460,
"end_pos": 460,
"sequence_org": "S",
"sequence_mut": "G",
"comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).",
"chr_id": "6",
"chr_pos": "160731121",
"ref_nt": "G",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "S460",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs746995108",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746995108"
},
{
"id": "rs746995108",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746995108"
},
{
"id": "rs746995108",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs746995108"
}
],
"glycoeffect": [
"o-glyco-site-loss"
],
"start_pos": 460,
"end_pos": 460,
"sequence_org": "S",
"sequence_mut": "N",
"comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->N).",
"chr_id": "6",
"chr_pos": "160731122",
"ref_nt": "A",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "S460",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs116573785",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs116573785"
},
{
"id": "rs116573785",
"database": "1000Genomes",
"url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs116573785"
},
{
"id": "rs116573785",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs116573785"
},
{
"id": "rs116573785",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs116573785#frequency_tab"
},
{
"id": "rs116573785",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs116573785"
},
{
"id": "rs756670030",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756670030"
},
{
"id": "rs756670030",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756670030"
},
{
"id": "rs756670030",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs756670030#frequency_tab"
},
{
"id": "rs756670030",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs756670030"
}
],
"glycoeffect": [
"o-glyco-site-loss"
],
"start_pos": 460,
"end_pos": 460,
"sequence_org": "S",
"sequence_mut": "R",
"comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->R).",
"chr_id": "6",
"chr_pos": "160731174",
"ref_nt": "A",
"alt_nt": "null",
"minor_allelic_frequency": "0.01418",
"site_lbl": "S460",
"keywords": [
"ebi",
"germline",
"disease"
],
"disease": [
{
"disease_id": "DOID:0111592",
"recommended_name": {
"id": "DOID:0111592",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0111592",
"name": "plasminogen deficiency type I",
"description": "A syndrome characterized by decreased serum plasminogen activity, decreased plasminogen antigen levels, and chronic mucosal pseudomembranous lesions typically manifesting as ligneous conjunctivitis that has_material_basis_in homozygous or compound heterozygous mutation in PLG on chromosome 6q26."
},
"synonyms": [
{
"id": "DOID:0111592",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0111592",
"name": "hypoplasminogenemia",
"description": ""
},
{
"id": "MONDO:0009009",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009009",
"name": "hypoplasminogenemia",
"description": "Severe hypoplasminogenemia (HPG) or type 1 plasminogen (plg) deficiency is a systemic disease characterized by markedly impaired extracellular fibrinolysis leading to the formation of ligneous (fibrin-rich) pseudomembranes on mucosae during wound healing."
},
{
"id": "MONDO:0009009",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009009",
"name": "hypoplasminogenemia",
"description": ""
},
{
"id": "MONDO:0009009",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009009",
"name": "plasminogen deficiency type 1",
"description": ""
},
{
"id": "MONDO:0009009",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009009",
"name": "Dysplasminogenemia",
"description": ""
},
{
"id": "MONDO:0009009",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009009",
"name": "ligneous conjunctivitis",
"description": ""
},
{
"id": "MONDO:0009009",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009009",
"name": "plasminogen deficiency, type 1",
"description": ""
},
{
"id": "MONDO:0009009",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009009",
"name": "plasminogen deficiency, type 2",
"description": ""
},
{
"id": "MONDO:0009009",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009009",
"name": "plasminogen deficiency, type I",
"description": ""
},
{
"id": "MONDO:0009009",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009009",
"name": "type 1 plasminogen deficiency",
"description": ""
},
{
"id": "MIM:217090",
"resource": "MIM",
"url": "https://www.omim.org/entry/217090",
"name": "Plasminogen deficiency",
"description": "Plasminogen deficiency"
}
]
}
]
},
{
"evidence": [
{
"id": "P00747",
"database": "BioMuta",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P00747"
}
],
"glycoeffect": [
"o-glyco-site-loss"
],
"start_pos": 500,
"end_pos": 500,
"subjects_tested": "0",
"subjects_positive": "0",
"frequency": "0.0",
"sequence_org": "T",
"sequence_mut": "M",
"comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).",
"chr_id": "6",
"chr_pos": "160731805",
"ref_nt": "C",
"alt_nt": "T",
"minor_allelic_frequency": "",
"site_lbl": "T500",
"disease": [
{
"disease_id": "DOID:9256",
"recommended_name": {
"id": "DOID:9256",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9256",
"name": "colorectal cancer",
"description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
},
"synonyms": [
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, advanced, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer with chromosomal instability, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectum cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectum neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "CRC",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "large intestine cancer",
"description": ""
},
{
"id": "MIM:114500",
"resource": "MIM",
"url": "https://www.omim.org/entry/114500",
"name": "Colorectal cancer",
"description": "Colorectal cancer"
}
]
},
{
"disease_id": "DOID:1319",
"recommended_name": {
"id": "DOID:1319",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1319",
"name": "brain cancer",
"description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain."
},
"synonyms": [
{
"id": "DOID:1319",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1319",
"name": "BT - Brain tumour",
"description": ""
},
{
"id": "DOID:1319",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1319",
"name": "adult brain tumor",
"description": ""
},
{
"id": "DOID:1319",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1319",
"name": "adult malignant brain neoplasm",
"description": ""
},
{
"id": "DOID:1319",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1319",
"name": "brain neoplasm",
"description": ""
},
{
"id": "DOID:1319",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1319",
"name": "brain neoplasm, adult",
"description": ""
},
{
"id": "DOID:1319",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1319",
"name": "malignant brain tumour",
"description": ""
},
{
"id": "DOID:1319",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1319",
"name": "malignant primary brain neoplasm",
"description": ""
},
{
"id": "DOID:1319",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1319",
"name": "malignant primary brain tumor",
"description": ""
},
{
"id": "DOID:1319",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1319",
"name": "malignant tumor of Brain",
"description": ""
},
{
"id": "DOID:1319",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1319",
"name": "malignant tumor of adult brain",
"description": ""
},
{
"id": "DOID:1319",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1319",
"name": "neoplasm of brain",
"description": ""
},
{
"id": "DOID:1319",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1319",
"name": "primary brain neoplasm",
"description": ""
},
{
"id": "DOID:1319",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1319",
"name": "primary brain tumor",
"description": ""
},
{
"id": "DOID:1319",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1319",
"name": "primary malignant neoplasm of brain",
"description": ""
},
{
"id": "DOID:1319",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1319",
"name": "tumor of the Brain",
"description": ""
}
]
},
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
],
"keywords": [
"biomuta",
"somatic",
"cancer",
"disease"
]
},
{
"evidence": [
{
"id": "P00747",
"database": "BioMuta",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P00747"
}
],
"glycoeffect": [],
"start_pos": 646,
"end_pos": 646,
"subjects_tested": "0",
"subjects_positive": "0",
"frequency": "0.0",
"sequence_org": "E",
"sequence_mut": "K",
"comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).",
"chr_id": "6",
"chr_pos": "160739126",
"ref_nt": "G",
"alt_nt": "A",
"minor_allelic_frequency": "",
"site_lbl": "E646",
"disease": [
{
"disease_id": "DOID:9256",
"recommended_name": {
"id": "DOID:9256",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9256",
"name": "colorectal cancer",
"description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
},
"synonyms": [
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, advanced, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer with chromosomal instability, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectum cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectum neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "CRC",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "large intestine cancer",
"description": ""
},
{
"id": "MIM:114500",
"resource": "MIM",
"url": "https://www.omim.org/entry/114500",
"name": "Colorectal cancer",
"description": "Colorectal cancer"
}
]
},
{
"disease_id": "DOID:11054",
"recommended_name": {
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "urinary bladder cancer",
"description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder."
},
"synonyms": [
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "bladder cancer",
"description": ""
},
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": "A primary or metastatic malignant neoplasm involving the bladder."
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "bladder cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "cancer of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumour",
"description": ""
},
{
"id": "MIM:109800",
"resource": "MIM",
"url": "https://www.omim.org/entry/109800",
"name": "Bladder cancer",
"description": "Bladder cancer"
}
]
},
{
"disease_id": "DOID:10534",
"recommended_name": {
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "stomach cancer",
"description": "A gastrointestinal system cancer that is located_in the stomach."
},
"synonyms": [
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric cancer",
"description": ""
},
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": "A primary or metastatic malignant neoplasm involving the stomach."
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca lesser curvature - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "cancer of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer risk after h. pylori infection",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumor",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumour",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant stomach neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "stomach cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca body - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "ca greater curvature of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, intestinal",
"description": ""
},
{
"id": "MIM:613659",
"resource": "MIM",
"url": "https://www.omim.org/entry/613659",
"name": "Gastric cancer",
"description": "Gastric cancer"
}
]
}
],
"keywords": [
"biomuta",
"somatic",
"cancer",
"disease"
]
},
{
"evidence": [
{
"id": "P00747",
"database": "BioMuta",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P00747"
}
],
"glycoeffect": [],
"start_pos": 663,
"end_pos": 663,
"subjects_tested": "0",
"subjects_positive": "0",
"frequency": "0.0",
"sequence_org": "R",
"sequence_mut": "Q",
"comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).",
"chr_id": "6",
"chr_pos": "160739178",
"ref_nt": "G",
"alt_nt": "A",
"minor_allelic_frequency": "",
"site_lbl": "R663",
"disease": [
{
"disease_id": "DOID:9256",
"recommended_name": {
"id": "DOID:9256",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9256",
"name": "colorectal cancer",
"description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
},
"synonyms": [
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, advanced, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer with chromosomal instability, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectum cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectum neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "CRC",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "large intestine cancer",
"description": ""
},
{
"id": "MIM:114500",
"resource": "MIM",
"url": "https://www.omim.org/entry/114500",
"name": "Colorectal cancer",
"description": "Colorectal cancer"
}
]
},
{
"disease_id": "DOID:4159",
"recommended_name": {
"id": "DOID:4159",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:4159",
"name": "skin cancer",
"description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells."
},
"synonyms": [
{
"id": "DOID:4159",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:4159",
"name": "CA - skin cancer",
"description": ""
},
{
"id": "DOID:4159",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:4159",
"name": "malignant neoplasm of skin",
"description": ""
},
{
"id": "DOID:4159",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:4159",
"name": "melanoma and Non-melanoma skin cancer",
"description": ""
}
]
},
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
],
"keywords": [
"biomuta",
"somatic",
"cancer",
"disease"
]
},
{
"evidence": [
{
"id": "rs181030365",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs181030365"
},
{
"id": "rs181030365",
"database": "1000Genomes",
"url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs181030365"
},
{
"id": "rs181030365",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs181030365"
},
{
"id": "rs181030365",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs181030365#frequency_tab"
},
{
"id": "rs181030365",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs181030365"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 695,
"end_pos": 695,
"sequence_org": "D",
"sequence_mut": "N",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DRT->NRT).",
"chr_id": "6",
"chr_pos": "160741375",
"ref_nt": "A",
"alt_nt": "null",
"minor_allelic_frequency": "0.0002",
"site_lbl": "D695",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "P00747",
"database": "BioMuta",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P00747"
}
],
"glycoeffect": [
"o-glyco-site-loss"
],
"start_pos": 710,
"end_pos": 710,
"subjects_tested": "0",
"subjects_positive": "0",
"frequency": "0.0",
"sequence_org": "T",
"sequence_mut": "N",
"comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->N).",
"chr_id": "6",
"chr_pos": "160752118",
"ref_nt": "C",
"alt_nt": "A",
"minor_allelic_frequency": "",
"site_lbl": "T710",
"disease": [
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
],
"keywords": [
"biomuta",
"somatic",
"cancer",
"disease"
]
},
{
"evidence": [
{
"id": "P00747",
"database": "BioMuta",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P00747"
}
],
"glycoeffect": [
"o-glyco-site-loss"
],
"start_pos": 742,
"end_pos": 742,
"subjects_tested": "0",
"subjects_positive": "0",
"frequency": "0.0",
"sequence_org": "T",
"sequence_mut": "A",
"comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->A).",
"chr_id": "6",
"chr_pos": "160752213",
"ref_nt": "A",
"alt_nt": "G",
"minor_allelic_frequency": "",
"site_lbl": "T742",
"disease": [
{
"disease_id": "DOID:11054",
"recommended_name": {
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "urinary bladder cancer",
"description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder."
},
"synonyms": [
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "bladder cancer",
"description": ""
},
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": "A primary or metastatic malignant neoplasm involving the bladder."
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "bladder cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "cancer of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumour",
"description": ""
},
{
"id": "MIM:109800",
"resource": "MIM",
"url": "https://www.omim.org/entry/109800",
"name": "Bladder cancer",
"description": "Bladder cancer"
}
]
}
],
"keywords": [
"biomuta",
"somatic",
"cancer",
"disease"
]
}
],
"mutagenesis": [
{
"start_pos": 741,
"end_pos": 741,
"sequence_org": "S",
"sequence_mut": "A",
"comment": "Proteolytically cleaved, but abolishes plasmin activity and cell detachment. Prevents invasion of the mosquito vector midgut by parasite P.falciparum ookinetes.",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
},
{
"database": "PubMed",
"id": "14699093",
"url": "https://glygen.org/publication/PubMed/14699093"
},
{
"database": "PubMed",
"id": "21949403",
"url": "https://glygen.org/publication/PubMed/21949403"
}
]
}
],
"expression_tissue": [
{
"tissue": {
"name": "Adult mammalian kidney",
"namespace": "UBERON",
"id": "0000082",
"url": "http://purl.obolibrary.org/obo/UBERON_0000082"
},
"score": "96.02",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000122194",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000122194"
}
]
},
{
"tissue": {
"name": "Oral cavity",
"namespace": "UBERON",
"id": "0000167",
"url": "http://purl.obolibrary.org/obo/UBERON_0000167"
},
"score": "42.15",
"present": "LOW",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000122194",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000122194"
}
]
},
{
"tissue": {
"name": "Stomach",
"namespace": "UBERON",
"id": "0000945",
"url": "http://purl.obolibrary.org/obo/UBERON_0000945"
},
"score": "60.19",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000122194",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000122194"
}
]
},
{
"tissue": {
"name": "Uterus",
"namespace": "UBERON",
"id": "0000995",
"url": "http://purl.obolibrary.org/obo/UBERON_0000995"
},
"score": "49.96",
"present": "LOW",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000122194",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000122194"
}
]
},
{
"tissue": {
"name": "Esophagus",
"namespace": "UBERON",
"id": "0001043",
"url": "http://purl.obolibrary.org/obo/UBERON_0001043"
},
"score": "74.79",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000122194",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000122194"
}
]
},
{
"tissue": {
"name": "Rectum",
"namespace": "UBERON",
"id": "0001052",
"url": "http://purl.obolibrary.org/obo/UBERON_0001052"
},
"score": "64.75",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000122194",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000122194"
}
]
},
{
"tissue": {
"name": "Colon",
"namespace": "UBERON",
"id": "0001155",
"url": "http://purl.obolibrary.org/obo/UBERON_0001155"
},
"score": "47.76",
"present": "LOW",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000122194",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000122194"
}
]
},
{
"tissue": {
"name": "Urinary bladder",
"namespace": "UBERON",
"id": "0001255",
"url": "http://purl.obolibrary.org/obo/UBERON_0001255"
},
"score": "60.21",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000122194",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000122194"
}
]
},
{
"tissue": {
"name": "Thyroid gland",
"namespace": "UBERON",
"id": "0002046",
"url": "http://purl.obolibrary.org/obo/UBERON_0002046"
},
"score": "63.66",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000122194",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000122194"
}
]
},
{
"tissue": {
"name": "Lung",
"namespace": "UBERON",
"id": "0002048",
"url": "http://purl.obolibrary.org/obo/UBERON_0002048"
},
"score": "47.6",
"present": "LOW",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000122194",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000122194"
}
]
},
{
"tissue": {
"name": "Liver",
"namespace": "UBERON",
"id": "0002107",
"url": "http://purl.obolibrary.org/obo/UBERON_0002107"
},
"score": "99.66",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000122194",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000122194"
}
]
},
{
"tissue": {
"name": "Prostate gland",
"namespace": "UBERON",
"id": "0002367",
"url": "http://purl.obolibrary.org/obo/UBERON_0002367"
},
"score": "79.14",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000122194",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000122194"
}
]
},
{
"tissue": {
"name": "Thoracic mammary gland",
"namespace": "UBERON",
"id": "0005200",
"url": "http://purl.obolibrary.org/obo/UBERON_0005200"
},
"score": "66.93",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000122194",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000122194"
}
]
}
],
"expression_disease": [
{
"significant": "No",
"trend": "up",
"name": "Prostate cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10283",
"evidence": [
{
"database": "BioXpress",
"id": "P00747",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00747"
}
],
"disease": [
{
"disease_id": "DOID:10283",
"recommended_name": {
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer",
"description": "A male reproductive organ cancer that is located_in the prostate."
},
"synonyms": [
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "NGP - new growth of prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "malignant tumor of the prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "tumor of the prostate",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, type 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "HPC9",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene."
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "EHBP1 familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "familial prostate cancer caused by mutation in EHBP1",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, type 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "HPC12",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, type 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "HPC5",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, type 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, susceptibility to, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "HPC3",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, type 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, susceptibility to, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "HPC4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, on chromosome 7",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene."
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "MSMB familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "familial prostate cancer caused by mutation in MSMB",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, type 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "HPC13",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, type 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "HPC8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "predisposing for prostate cancer",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, type 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "HPC6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "HPC10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate carcinoma",
"description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma."
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate carcinoma",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, somatic",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, hereditary",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "HPC7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer aggressiveness",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene."
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "RNASEL familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "familial prostate cancer caused by mutation in RNASEL",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, type 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "HPC1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "Prca1",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "HPC11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "HPC14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "HPC15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "HPCX1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer susceptibility, X-linked",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "HPCX2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MIM:611868",
"resource": "MIM",
"url": "https://www.omim.org/entry/611868",
"name": "Prostate cancer, hereditary, 12",
"description": "Prostate cancer, hereditary, 12"
},
{
"id": "MIM:611928",
"resource": "MIM",
"url": "https://www.omim.org/entry/611928",
"name": "Prostate cancer, hereditary, 13",
"description": "Prostate cancer, hereditary, 13"
},
{
"id": "MIM:176807",
"resource": "MIM",
"url": "https://www.omim.org/entry/176807",
"name": "Prostate cancer",
"description": "Prostate cancer"
},
{
"id": "MIM:601518",
"resource": "MIM",
"url": "https://www.omim.org/entry/601518",
"name": "Prostate cancer, hereditary, 1",
"description": "Prostate cancer, hereditary, 1"
},
{
"id": "MIM:611955",
"resource": "MIM",
"url": "https://www.omim.org/entry/611955",
"name": "Prostate cancer, hereditary, 11",
"description": "Prostate cancer, hereditary, 11"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Stomach cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10534",
"evidence": [
{
"database": "BioXpress",
"id": "P00747",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00747"
}
],
"disease": [
{
"disease_id": "DOID:10534",
"recommended_name": {
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "stomach cancer",
"description": "A gastrointestinal system cancer that is located_in the stomach."
},
"synonyms": [
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric cancer",
"description": ""
},
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": "A primary or metastatic malignant neoplasm involving the stomach."
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca lesser curvature - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "cancer of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer risk after h. pylori infection",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumor",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumour",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant stomach neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "stomach cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca body - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "ca greater curvature of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, intestinal",
"description": ""
},
{
"id": "MIM:613659",
"resource": "MIM",
"url": "https://www.omim.org/entry/613659",
"name": "Gastric cancer",
"description": "Gastric cancer"
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Urinary bladder cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11054",
"evidence": [
{
"database": "BioXpress",
"id": "P00747",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00747"
}
],
"disease": [
{
"disease_id": "DOID:11054",
"recommended_name": {
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "urinary bladder cancer",
"description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder."
},
"synonyms": [
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "bladder cancer",
"description": ""
},
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": "A primary or metastatic malignant neoplasm involving the bladder."
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "bladder cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "cancer of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumour",
"description": ""
},
{
"id": "MIM:109800",
"resource": "MIM",
"url": "https://www.omim.org/entry/109800",
"name": "Bladder cancer",
"description": "Bladder cancer"
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Head and neck cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11934",
"evidence": [
{
"database": "BioXpress",
"id": "P00747",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00747"
}
],
"disease": [
{
"disease_id": "DOID:11934",
"recommended_name": {
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck cancer",
"description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx."
},
"synonyms": [
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck tumours",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head/neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "tumor of head and neck",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "down",
"name": "Lung cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1324",
"evidence": [
{
"database": "BioXpress",
"id": "P00747",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00747"
}
],
"disease": [
{
"disease_id": "DOID:1324",
"recommended_name": {
"id": "DOID:1324",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1324",
"name": "lung cancer",
"description": "A respiratory system cancer that is located_in the lung."
},
"synonyms": [
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "LNCR1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "LNCR3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "adenocarcinoma of lung, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "LNCR4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "LNCR5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": "A malignant neoplasm involving the lung."
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "cancer of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung neoplasm",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumor",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumour",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "Nonsmall cell lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "alveolar cell carcinoma",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung neoplasm",
"description": ""
},
{
"id": "MIM:211980",
"resource": "MIM",
"url": "https://www.omim.org/entry/211980",
"name": "Lung cancer",
"description": "Lung cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Breast cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1612",
"evidence": [
{
"database": "BioXpress",
"id": "P00747",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00747"
}
],
"disease": [
{
"disease_id": "DOID:1612",
"recommended_name": {
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast cancer",
"description": "A thoracic cancer that originates in the mammary gland."
},
"synonyms": [
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant neoplasm of breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant tumor of the breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary cancer",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "primary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma."
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer susceptibility, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, lobular, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of the breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial Male",
"description": ""
},
{
"id": "MIM:114480",
"resource": "MIM",
"url": "https://www.omim.org/entry/114480",
"name": "Breast cancer",
"description": "Breast cancer"
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Thyroid cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1781",
"evidence": [
{
"database": "BioXpress",
"id": "P00747",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00747"
}
],
"disease": [
{
"disease_id": "DOID:1781",
"recommended_name": {
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid cancer",
"description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage."
},
"synonyms": [
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid gland cancer",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "Thyroid gland neoplasm",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant tumour of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Kidney cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:263",
"evidence": [
{
"database": "BioXpress",
"id": "P00747",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00747"
}
],
"disease": [
{
"disease_id": "DOID:263",
"recommended_name": {
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "kidney cancer",
"description": "A urinary system cancer that is located_in the kidney."
},
"synonyms": [
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant neoplasm of kidney except pelvis",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant tumour of kidney",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "renal cancer",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Liver cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:3571",
"evidence": [
{
"database": "BioXpress",
"id": "P00747",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00747"
}
],
"disease": [
{
"disease_id": "DOID:3571",
"recommended_name": {
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "liver cancer",
"description": "A hepatobiliary system cancer that is located_in the liver."
},
"synonyms": [
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Ca liver - primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Resectable malignant neoplasm of Liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant hepato-biliary neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant tumor of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "non-resectable primary hepatic malignant neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary liver cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "resectable malignant neoplasm of the liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, not specified as primary or secondary",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Uterine cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:363",
"evidence": [
{
"database": "BioXpress",
"id": "P00747",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00747"
}
],
"disease": [
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Esophageal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:5041",
"evidence": [
{
"database": "BioXpress",
"id": "P00747",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00747"
}
],
"disease": [
{
"disease_id": "DOID:5041",
"recommended_name": {
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophageal cancer",
"description": "A gastrointestinal system cancer that is located_in the esophagus."
},
"synonyms": [
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophagus cancer",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Distal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Proximal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of the middle Third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": "A primary or metastatic malignant neoplasm involving the esophagus."
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "oesophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the middle third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of abdominal oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the middle third of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Aerodigestive tract cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Escc, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "gastric cardia adenocarcinoma, susceptibility to",
"description": ""
},
{
"id": "MIM:133239",
"resource": "MIM",
"url": "https://www.omim.org/entry/133239",
"name": "Esophageal cancer",
"description": "Esophageal cancer"
}
]
}
]
},
{
"significant": "No",
"trend": "down",
"name": "Colorectal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:9256",
"evidence": [
{
"database": "BioXpress",
"id": "P00747",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00747"
}
],
"disease": [
{
"disease_id": "DOID:9256",
"recommended_name": {
"id": "DOID:9256",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9256",
"name": "colorectal cancer",
"description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
},
"synonyms": [
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, advanced, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer with chromosomal instability, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectum cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectum neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "CRC",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "large intestine cancer",
"description": ""
},
{
"id": "MIM:114500",
"resource": "MIM",
"url": "https://www.omim.org/entry/114500",
"name": "Colorectal cancer",
"description": "Colorectal cancer"
}
]
}
]
}
],
"species": [
{
"name": "Homo sapiens",
"taxid": 9606,
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"common_name": "Human"
}
],
"gene": [
{
"name": "PLG",
"url": "https://www.uniprot.org/uniprot/P00747",
"locus": {
"chromosome": "6",
"start_pos": 160754097,
"end_pos": 160702194,
"strand": "-",
"evidence": [
{
"database": "Ensembl Gene",
"id": "ENSG00000122194",
"url": "https://www.ensembl.org/id/ENSG00000122194"
}
]
}
}
],
"crossref": [
{
"id": "ENSG00000122194",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000122194",
"database": "Bgee",
"categories": [
"Gene Expression"
]
},
{
"id": "P00747",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P00747",
"database": "BioMuta",
"categories": [
"Variation"
]
},
{
"id": "3.4.21.7",
"url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.4.21.7&UniProtAcc=P00747",
"database": "BRENDA",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "cd00108",
"url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00108",
"database": "CDD",
"categories": [
"Protein Classification"
]
},
{
"id": "cd00190",
"url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00190",
"database": "CDD",
"categories": [
"Protein Classification"
]
},
{
"id": "cd01099",
"url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01099",
"database": "CDD",
"categories": [
"Protein Classification"
]
},
{
"id": "CHEMBL1801",
"url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL1801",
"database": "ChEMBL",
"categories": [
"Other"
]
},
{
"id": "PLG",
"url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=PLG",
"database": "GeneCards",
"categories": [
"Gene Annotation",
"Organism-specific"
]
},
{
"id": "5340",
"url": "https://www.ncbi.nlm.nih.gov/gene/5340",
"database": "GeneID",
"categories": [
"Genome Annotation"
]
},
{
"id": "502",
"url": "https://glyconnect.expasy.org/browser/proteins/502",
"database": "GlyConnect",
"categories": [
"Glycoproteomics",
"Glycan"
]
},
{
"id": "9071",
"url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=9071",
"database": "HGNC",
"categories": [
"Organism-specific"
]
},
{
"id": "P00747",
"url": "https://www.ebi.ac.uk/intact/interactors/id:P00747*",
"database": "IntAct",
"categories": [
"Other"
]
},
{
"id": "IPR000001",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR000001",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR001254",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR001254",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR001314",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR001314",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR003609",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR003609",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR009003",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR009003",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR013806",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR013806",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR018056",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR018056",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR018114",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR018114",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR023317",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR023317",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR033116",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR033116",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR038178",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR038178",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR043504",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR043504",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "hsa:5340",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5340",
"database": "KEGG Pathway",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "173350",
"url": "http://www.omim.org/entry/173350",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "217090",
"url": "http://www.omim.org/entry/217090",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "619360",
"url": "http://www.omim.org/entry/619360",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "NX_P00747",
"url": "https://www.nextprot.org/entry/NX_P00747",
"database": "neXtProt",
"categories": [
"Protein",
"Organism-specific"
]
},
{
"id": "NSQTPHA",
"url": "https://omabrowser.org/oma/group/NSQTPHA/",
"database": "OMA",
"categories": [
"Protein Classification"
]
},
{
"id": "211181at2759",
"url": "http://www.orthodb.org/?query=211181at2759",
"database": "OrthoDB",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR24261",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24261",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR24261:SF13",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24261:SF13",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR24261:SF7",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24261:SF7",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "1B2I",
"url": "https://www.rcsb.org/structure/1B2I",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1BML",
"url": "https://www.rcsb.org/structure/1BML",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1BUI",
"url": "https://www.rcsb.org/structure/1BUI",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1CEA",
"url": "https://www.rcsb.org/structure/1CEA",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1CEB",
"url": "https://www.rcsb.org/structure/1CEB",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1DDJ",
"url": "https://www.rcsb.org/structure/1DDJ",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1HPJ",
"url": "https://www.rcsb.org/structure/1HPJ",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1HPK",
"url": "https://www.rcsb.org/structure/1HPK",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1I5K",
"url": "https://www.rcsb.org/structure/1I5K",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1KI0",
"url": "https://www.rcsb.org/structure/1KI0",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1KRN",
"url": "https://www.rcsb.org/structure/1KRN",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1L4D",
"url": "https://www.rcsb.org/structure/1L4D",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1L4Z",
"url": "https://www.rcsb.org/structure/1L4Z",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1PK4",
"url": "https://www.rcsb.org/structure/1PK4",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1PKR",
"url": "https://www.rcsb.org/structure/1PKR",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1PMK",
"url": "https://www.rcsb.org/structure/1PMK",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1QRZ",
"url": "https://www.rcsb.org/structure/1QRZ",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1RJX",
"url": "https://www.rcsb.org/structure/1RJX",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2DOH",
"url": "https://www.rcsb.org/structure/2DOH",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2DOI",
"url": "https://www.rcsb.org/structure/2DOI",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2KNF",
"url": "https://www.rcsb.org/structure/2KNF",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2L0S",
"url": "https://www.rcsb.org/structure/2L0S",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2PK4",
"url": "https://www.rcsb.org/structure/2PK4",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3UIR",
"url": "https://www.rcsb.org/structure/3UIR",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4A5T",
"url": "https://www.rcsb.org/structure/4A5T",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4CIK",
"url": "https://www.rcsb.org/structure/4CIK",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4DCB",
"url": "https://www.rcsb.org/structure/4DCB",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4DUR",
"url": "https://www.rcsb.org/structure/4DUR",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4DUU",
"url": "https://www.rcsb.org/structure/4DUU",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5HPG",
"url": "https://www.rcsb.org/structure/5HPG",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5UGD",
"url": "https://www.rcsb.org/structure/5UGD",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5UGG",
"url": "https://www.rcsb.org/structure/5UGG",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6D3X",
"url": "https://www.rcsb.org/structure/6D3X",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6D3Y",
"url": "https://www.rcsb.org/structure/6D3Y",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6D3Z",
"url": "https://www.rcsb.org/structure/6D3Z",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6D40",
"url": "https://www.rcsb.org/structure/6D40",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6OG4",
"url": "https://www.rcsb.org/structure/6OG4",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6OQJ",
"url": "https://www.rcsb.org/structure/6OQJ",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6OQK",
"url": "https://www.rcsb.org/structure/6OQK",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6Q1U",
"url": "https://www.rcsb.org/structure/6Q1U",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6UZ4",
"url": "https://www.rcsb.org/structure/6UZ4",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6UZ5",
"url": "https://www.rcsb.org/structure/6UZ5",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7E50",
"url": "https://www.rcsb.org/structure/7E50",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7THS",
"url": "https://www.rcsb.org/structure/7THS",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7UAH",
"url": "https://www.rcsb.org/structure/7UAH",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "8F7U",
"url": "https://www.rcsb.org/structure/8F7U",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "8F7V",
"url": "https://www.rcsb.org/structure/8F7V",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "PF00024",
"url": "http://pfam.xfam.org/family/PF00024",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "PF00051",
"url": "http://pfam.xfam.org/family/PF00051",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "PF00089",
"url": "http://pfam.xfam.org/family/PF00089",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "P00747",
"url": "https://pharos.nih.gov/targets/P00747",
"database": "PHAROS",
"categories": [
"Organism-specific"
]
},
{
"id": "PR:000051203",
"url": "https://proconsortium.org/app/entry/PR:000051203",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000051204",
"url": "https://proconsortium.org/app/entry/PR:000051204",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000051205",
"url": "https://proconsortium.org/app/entry/PR:000051205",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000051206",
"url": "https://proconsortium.org/app/entry/PR:000051206",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000051207",
"url": "https://proconsortium.org/app/entry/PR:000051207",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000051208",
"url": "https://proconsortium.org/app/entry/PR:000051208",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000051209",
"url": "https://proconsortium.org/app/entry/PR:000051209",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000051210",
"url": "https://proconsortium.org/app/entry/PR:000051210",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000051211",
"url": "https://proconsortium.org/app/entry/PR:000051211",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000051212",
"url": "https://proconsortium.org/app/entry/PR:000051212",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000051213",
"url": "https://proconsortium.org/app/entry/PR:000051213",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000051214",
"url": "https://proconsortium.org/app/entry/PR:000051214",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000051215",
"url": "https://proconsortium.org/app/entry/PR:000051215",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000051216",
"url": "https://proconsortium.org/app/entry/PR:000051216",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000051217",
"url": "https://proconsortium.org/app/entry/PR:000051217",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000051218",
"url": "https://proconsortium.org/app/entry/PR:000051218",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000051219",
"url": "https://proconsortium.org/app/entry/PR:000051219",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000051220",
"url": "https://proconsortium.org/app/entry/PR:000051220",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000051221",
"url": "https://proconsortium.org/app/entry/PR:000051221",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000051222",
"url": "https://proconsortium.org/app/entry/PR:000051222",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000051223",
"url": "https://proconsortium.org/app/entry/PR:000051223",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000051224",
"url": "https://proconsortium.org/app/entry/PR:000051224",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000051225",
"url": "https://proconsortium.org/app/entry/PR:000051225",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000051226",
"url": "https://proconsortium.org/app/entry/PR:000051226",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000051227",
"url": "https://proconsortium.org/app/entry/PR:000051227",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000051228",
"url": "https://proconsortium.org/app/entry/PR:000051228",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000051229",
"url": "https://proconsortium.org/app/entry/PR:000051229",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000051230",
"url": "https://proconsortium.org/app/entry/PR:000051230",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000051231",
"url": "https://proconsortium.org/app/entry/PR:000051231",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000051232",
"url": "https://proconsortium.org/app/entry/PR:000051232",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000051233",
"url": "https://proconsortium.org/app/entry/PR:000051233",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000051234",
"url": "https://proconsortium.org/app/entry/PR:000051234",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000051235",
"url": "https://proconsortium.org/app/entry/PR:000051235",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000051236",
"url": "https://proconsortium.org/app/entry/PR:000051236",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR_P00747",
"url": "http://purl.obolibrary.org/obo/PR_P00747",
"database": "PRO",
"categories": [
"Protein"
]
},
{
"id": "R-HSA-114608",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-75205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "NP_000292",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000292",
"database": "RefSeq",
"categories": [
"Protein"
]
},
{
"id": "P00747",
"url": "DISABLED",
"database": "UniCarbKB",
"categories": [
"Glycoproteomics"
]
},
{
"id": "A0A9L9PXP2",
"url": "https://www.uniprot.org/uniprot/A0A9L9PXP2",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A9L9PXP2-1",
"url": "https://www.uniprot.org/uniprot/A0A9L9PXP2-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A9L9PY04",
"url": "https://www.uniprot.org/uniprot/A0A9L9PY04",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A9L9PY04-1",
"url": "https://www.uniprot.org/uniprot/A0A9L9PY04-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A9L9PYG2",
"url": "https://www.uniprot.org/uniprot/A0A9L9PYG2",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A9L9PYG2-1",
"url": "https://www.uniprot.org/uniprot/A0A9L9PYG2-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A6PVI2",
"url": "https://www.uniprot.org/uniprot/A6PVI2",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A6PVI2-1",
"url": "https://www.uniprot.org/uniprot/A6PVI2-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P00747-1",
"url": "https://www.uniprot.org/uniprot/P00747-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "Q5TEH5",
"url": "https://www.uniprot.org/uniprot/Q5TEH5",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "Q5TEH5-1",
"url": "https://www.uniprot.org/uniprot/Q5TEH5-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
}
],
"sequence": {
"sequence": "MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN",
"length": 810,
"header": "sp|P00747-1|PLMN_HUMAN Isoform 1 of Plasminogen OS=Homo sapiens OX=9606 GN=PLG PE=1 SV=2 CANONICAL=P00747-1"
},
"isoforms": [
{
"isoform_ac": "A0A9L9PXP2-1",
"url": "",
"sequence": {
"sequence": "MEHKEVVLLLLLFLKSAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN",
"length": 461,
"header": "tr|A0A9L9PXP2-1|A0A9L9PXP2_HUMAN Computationally mapped isoform of Plasminogen OS=Homo sapiens OX=9606 GN=PLG PE=1 SV=1 CANONICAL=P00747-1"
},
"locus": {
"chromosome": "6",
"start_pos": 160753058,
"end_pos": 160702305,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000297289.9",
"url": "https://www.ensembl.org/id/ENST00000297289.9"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000516619.1",
"url": "https://www.ensembl.org/id/ENSP00000516619.1"
}
]
}
},
{
"isoform_ac": "A0A9L9PY04-1",
"url": "",
"sequence": {
"sequence": "MAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPR",
"length": 61,
"header": "tr|A0A9L9PY04-1|A0A9L9PY04_HUMAN Computationally mapped isoform of Plasminogen OS=Homo sapiens OX=9606 GN=PLG PE=1 SV=1 CANONICAL=P00747-1"
},
"locus": {
"chromosome": "6",
"start_pos": 160711192,
"end_pos": 160707740,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000494325.2",
"url": "https://www.ensembl.org/id/ENST00000494325.2"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000516620.1",
"url": "https://www.ensembl.org/id/ENSP00000516620.1"
}
]
}
},
{
"isoform_ac": "A0A9L9PYG2-1",
"url": "",
"sequence": {
"sequence": "MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCEASWWHL",
"length": 567,
"header": "tr|A0A9L9PYG2-1|A0A9L9PYG2_HUMAN Computationally mapped isoform of Plasminogen OS=Homo sapiens OX=9606 GN=PLG PE=1 SV=1 CANONICAL=P00747-1"
},
"locus": {
"chromosome": "6",
"start_pos": 160735182,
"end_pos": 160702305,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000706906.1",
"url": "https://www.ensembl.org/id/ENST00000706906.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000516618.1",
"url": "https://www.ensembl.org/id/ENSP00000516618.1"
}
]
}
},
{
"isoform_ac": "A6PVI2-1",
"url": "",
"sequence": {
"sequence": "MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRYFHCRCTYAGICNSDGKAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN",
"length": 827,
"header": "tr|A6PVI2-1|A6PVI2_HUMAN Computationally mapped isoform of Plasminogen OS=Homo sapiens OX=9606 GN=PLG PE=1 SV=2 CANONICAL=P00747-1"
},
"locus": {
"chromosome": "6",
"start_pos": 160753058,
"end_pos": 160702305,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000418964.2",
"url": "https://www.ensembl.org/id/ENST00000418964.2"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000389424.2",
"url": "https://www.ensembl.org/id/ENSP00000389424.2"
}
]
}
},
{
"isoform_ac": "P00747-1",
"url": "",
"sequence": {
"sequence": "MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN",
"length": 810,
"header": "sp|P00747-1|PLMN_HUMAN Isoform 1 of Plasminogen OS=Homo sapiens OX=9606 GN=PLG PE=1 SV=2 CANONICAL=P00747-1"
},
"locus": {
"chromosome": "6",
"start_pos": 160753058,
"end_pos": 160702305,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000308192.14",
"url": "https://www.ensembl.org/id/ENST00000308192.14"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000308938.9",
"url": "https://www.ensembl.org/id/ENSP00000308938.9"
}
]
}
},
{
"isoform_ac": "Q5TEH5-1",
"url": "",
"sequence": {
"sequence": "MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPR",
"length": 136,
"header": "tr|Q5TEH5-1|Q5TEH5_HUMAN Computationally mapped isoform of Plasminogen OS=Homo sapiens OX=9606 GN=PLG PE=1 SV=1 CANONICAL=P00747-1"
},
"locus": {
"chromosome": "6",
"start_pos": 160711192,
"end_pos": 160702305,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000366924.6",
"url": "https://www.ensembl.org/id/ENST00000366924.6"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000355891.2",
"url": "https://www.ensembl.org/id/ENSP00000355891.2"
}
]
}
}
],
"glycosylation": [
{
"glytoucan_ac": "G33791AF",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 150,
"start_aa": "Asn",
"end_pos": 150,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn150",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "29391424",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/29391424"
}
]
},
{
"glytoucan_ac": "G48414YA",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 150,
"start_aa": "Asn",
"end_pos": 150,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn150",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "29391424",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/29391424"
}
]
},
{
"glytoucan_ac": "G52527GH",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 150,
"start_aa": "Asn",
"end_pos": 150,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn150",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "29391424",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/29391424"
}
]
},
{
"glytoucan_ac": "G57321FI",
"type": "O-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "CTTPPPSSGPTYQCLK",
"relation": "attached",
"comment": "",
"start_pos": 262,
"start_aa": "Cys",
"end_pos": 277,
"end_aa": "Lys",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "28035807",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/28035807"
},
{
"id": "10.1021/acs.analchem.6b02887",
"database": "DOI",
"url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.6b02887"
}
]
},
{
"glytoucan_ac": "G53434XO",
"type": "O-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "T",
"relation": "attached",
"comment": "",
"start_pos": 263,
"start_aa": "Thr",
"end_pos": 263,
"end_aa": "Thr",
"residue": "Thr",
"site_lbl": "Thr263",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "30459171",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/30459171"
}
]
},
{
"glytoucan_ac": "G43417UB",
"type": "O-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "T",
"relation": "attached",
"comment": "",
"start_pos": 264,
"start_aa": "Thr",
"end_pos": 264,
"end_aa": "Thr",
"residue": "Thr",
"site_lbl": "Thr264",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "30459171",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/30459171"
}
]
},
{
"glytoucan_ac": "G53434XO",
"type": "O-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "T",
"relation": "attached",
"comment": "",
"start_pos": 264,
"start_aa": "Thr",
"end_pos": 264,
"end_aa": "Thr",
"residue": "Thr",
"site_lbl": "Thr264",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "30459171",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/30459171"
}
]
},
{
"glytoucan_ac": "G01614ZM",
"type": "O-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "S",
"relation": "attached",
"comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-268, N-308, T-365",
"start_pos": 268,
"start_aa": "Ser",
"end_pos": 268,
"end_aa": "Ser",
"residue": "Ser",
"site_lbl": "Ser268",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "2065054",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2065054"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
},
{
"id": "2386787",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2386787"
}
]
},
{
"glytoucan_ac": "G29068FM",
"type": "O-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "S",
"relation": "attached",
"comment": "",
"start_pos": 268,
"start_aa": "Ser",
"end_pos": 268,
"end_aa": "Ser",
"residue": "Ser",
"site_lbl": "Ser268",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "30459171",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/30459171"
}
]
},
{
"glytoucan_ac": "G43417UB",
"type": "O-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "S",
"relation": "attached",
"comment": "",
"start_pos": 268,
"start_aa": "Ser",
"end_pos": 268,
"end_aa": "Ser",
"residue": "Ser",
"site_lbl": "Ser268",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "30459171",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/30459171"
}
]
},
{
"glytoucan_ac": "G65562ZE",
"type": "O-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "S",
"relation": "attached",
"comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-268, N-308, T-365",
"start_pos": 268,
"start_aa": "Ser",
"end_pos": 268,
"end_aa": "Ser",
"residue": "Ser",
"site_lbl": "Ser268",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
},
{
"id": "2386787",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2386787"
},
{
"id": "2065054",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2065054"
},
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "3356193",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/3356193"
},
{
"id": "9054441",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/9054441"
},
{
"id": "479158",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/479158"
}
]
},
{
"glytoucan_ac": "G74722FL",
"type": "O-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "S",
"relation": "attached",
"comment": "",
"start_pos": 268,
"start_aa": "Ser",
"end_pos": 268,
"end_aa": "Ser",
"residue": "Ser",
"site_lbl": "Ser268",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "3356193",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/3356193"
},
{
"id": "9054441",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/9054441"
},
{
"id": "479158",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/479158"
}
]
},
{
"glytoucan_ac": "",
"type": "O-linked",
"subtype": "O-GalNAcylation",
"site_category": "reported",
"site_seq": "S",
"relation": "attached",
"comment": "O-linked (GalNAc...) serine O-GalNAcylation",
"start_pos": 268,
"start_aa": "Ser",
"end_pos": 268,
"end_aa": "Ser",
"residue": "Ser",
"site_lbl": "Ser268",
"evidence": [
{
"id": "P00747",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00747#ptm_processing"
},
{
"id": "3356193",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/3356193"
},
{
"id": "9054441",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/9054441"
}
]
},
{
"glytoucan_ac": "G43417UB",
"type": "O-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "T",
"relation": "attached",
"comment": "",
"start_pos": 28,
"start_aa": "Thr",
"end_pos": 28,
"end_aa": "Thr",
"residue": "Thr",
"site_lbl": "Thr28",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "30459171",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/30459171"
}
]
},
{
"glytoucan_ac": "G00912UN",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 308,
"start_aa": "Asn",
"end_pos": 308,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn308",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "29671580",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/29671580"
},
{
"id": "P00747@N308",
"database": "GPTwiki",
"url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P00747@N308"
}
]
},
{
"glytoucan_ac": "G06356OH",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 308,
"start_aa": "Asn",
"end_pos": 308,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn308",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "3356193",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/3356193"
},
{
"id": "29671580",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/29671580"
}
]
},
{
"glytoucan_ac": "G11041DA",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: ASN-308 ; ASN-308",
"start_pos": 308,
"start_aa": "Asn",
"end_pos": 308,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn308",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "2065054",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2065054"
},
{
"id": "2386787",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2386787"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
},
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "3356193",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/3356193"
}
]
},
{
"glytoucan_ac": "G22310AV",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 308,
"start_aa": "Asn",
"end_pos": 308,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn308",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "3356193",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/3356193"
}
]
},
{
"glytoucan_ac": "G29068FM",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 308,
"start_aa": "Asn",
"end_pos": 308,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn308",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "29671580",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/29671580"
}
]
},
{
"glytoucan_ac": "G36191CD",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "ASN-308",
"start_pos": 308,
"start_aa": "Asn",
"end_pos": 308,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn308",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
},
{
"id": "2065054",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2065054"
},
{
"id": "2386787",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2386787"
},
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
}
]
},
{
"glytoucan_ac": "G48414YA",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 308,
"start_aa": "Asn",
"end_pos": 308,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn308",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "3356193",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/3356193"
},
{
"id": "2386787",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2386787"
},
{
"id": "29741879",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/29741879"
},
{
"id": "29671580",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/29671580"
}
]
},
{
"glytoucan_ac": "G50045TK",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 308,
"start_aa": "Asn",
"end_pos": 308,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn308",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "2386787",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2386787"
},
{
"id": "29741879",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/29741879"
}
]
},
{
"glytoucan_ac": "G56749GV",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: ASN-308 ; ASN-308",
"start_pos": 308,
"start_aa": "Asn",
"end_pos": 308,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn308",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
},
{
"id": "2386787",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2386787"
},
{
"id": "2065054",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2065054"
},
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "3356193",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/3356193"
}
]
},
{
"glytoucan_ac": "G59626AS",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 308,
"start_aa": "Asn",
"end_pos": 308,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn308",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "29671580",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/29671580"
},
{
"id": "P00747@N308",
"database": "GPTwiki",
"url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P00747@N308"
}
]
},
{
"glytoucan_ac": "G84452RH",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 308,
"start_aa": "Asn",
"end_pos": 308,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn308",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "3356193",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/3356193"
}
]
},
{
"glytoucan_ac": "G84467IZ",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: ASN-308 ; ASN-308",
"start_pos": 308,
"start_aa": "Asn",
"end_pos": 308,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn308",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
},
{
"id": "2386787",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2386787"
},
{
"id": "2065054",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2065054"
},
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "3356193",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/3356193"
}
]
},
{
"glytoucan_ac": "G91365ZQ",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-268, N-308, T-365",
"start_pos": 308,
"start_aa": "Asn",
"end_pos": 308,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn308",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "2065054",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2065054"
},
{
"id": "2386787",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2386787"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
},
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "3356193",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/3356193"
}
]
},
{
"glytoucan_ac": "",
"type": "N-linked",
"subtype": "",
"site_category": "reported",
"site_seq": "N",
"relation": "attached",
"comment": "N-linked (GlcNAc...) asparagine",
"start_pos": 308,
"start_aa": "Asn",
"end_pos": 308,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn308",
"evidence": [
{
"id": "P00747",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00747#ptm_processing"
},
{
"id": "3356193",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/3356193"
},
{
"id": "18780401",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/18780401"
},
{
"id": "23090970",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/23090970"
},
{
"id": "GLY_000143",
"database": "GlyGen",
"url": "https://data.glygen.org/GLY_000143"
}
]
},
{
"glytoucan_ac": "G57321FI",
"type": "O-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "IPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYR",
"relation": "attached",
"comment": "",
"start_pos": 349,
"start_aa": "Ile",
"end_pos": 386,
"end_aa": "Arg",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "28035807",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/28035807"
},
{
"id": "10.1021/acs.analchem.6b02887",
"database": "DOI",
"url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.6b02887"
}
]
},
{
"glytoucan_ac": "G43417UB",
"type": "O-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "S",
"relation": "attached",
"comment": "",
"start_pos": 358,
"start_aa": "Ser",
"end_pos": 358,
"end_aa": "Ser",
"residue": "Ser",
"site_lbl": "Ser358",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "30459171",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/30459171"
}
]
},
{
"glytoucan_ac": "G29068FM",
"type": "O-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "T",
"relation": "attached",
"comment": "",
"start_pos": 359,
"start_aa": "Thr",
"end_pos": 359,
"end_aa": "Thr",
"residue": "Thr",
"site_lbl": "Thr359",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "30459171",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/30459171"
}
]
},
{
"glytoucan_ac": "G00912UN",
"type": "O-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "T",
"relation": "attached",
"comment": "",
"start_pos": 365,
"start_aa": "Thr",
"end_pos": 365,
"end_aa": "Thr",
"residue": "Thr",
"site_lbl": "Thr365",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "26598643",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/26598643"
},
{
"id": "30459171",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/30459171"
}
]
},
{
"glytoucan_ac": "G01614ZM",
"type": "O-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "T",
"relation": "attached",
"comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-268, N-308, T-365",
"start_pos": 365,
"start_aa": "Thr",
"end_pos": 365,
"end_aa": "Thr",
"residue": "Thr",
"site_lbl": "Thr365",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
},
{
"id": "2386787",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2386787"
},
{
"id": "2065054",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2065054"
},
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "3356193",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/3356193"
},
{
"id": "479158",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/479158"
}
]
},
{
"glytoucan_ac": "G17015OC",
"type": "O-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "T",
"relation": "attached",
"comment": "",
"start_pos": 365,
"start_aa": "Thr",
"end_pos": 365,
"end_aa": "Thr",
"residue": "Thr",
"site_lbl": "Thr365",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "26598643",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/26598643"
},
{
"id": "30459171",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/30459171"
}
]
},
{
"glytoucan_ac": "G23729WG",
"type": "O-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "T",
"relation": "attached",
"comment": "",
"start_pos": 365,
"start_aa": "Thr",
"end_pos": 365,
"end_aa": "Thr",
"residue": "Thr",
"site_lbl": "Thr365",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "26598643",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/26598643"
},
{
"id": "30459171",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/30459171"
}
]
},
{
"glytoucan_ac": "G27391WQ",
"type": "O-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "T",
"relation": "attached",
"comment": "",
"start_pos": 365,
"start_aa": "Thr",
"end_pos": 365,
"end_aa": "Thr",
"residue": "Thr",
"site_lbl": "Thr365",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "30459171",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/30459171"
},
{
"id": "26598643",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/26598643"
}
]
},
{
"glytoucan_ac": "G29068FM",
"type": "O-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "T",
"relation": "attached",
"comment": "",
"start_pos": 365,
"start_aa": "Thr",
"end_pos": 365,
"end_aa": "Thr",
"residue": "Thr",
"site_lbl": "Thr365",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "26598643",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/26598643"
},
{
"id": "30459171",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/30459171"
}
]
},
{
"glytoucan_ac": "G43417UB",
"type": "O-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "T",
"relation": "attached",
"comment": "",
"start_pos": 365,
"start_aa": "Thr",
"end_pos": 365,
"end_aa": "Thr",
"residue": "Thr",
"site_lbl": "Thr365",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "26598643",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/26598643"
},
{
"id": "30459171",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/30459171"
}
]
},
{
"glytoucan_ac": "G58001LT",
"type": "O-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "T",
"relation": "attached",
"comment": "",
"start_pos": 365,
"start_aa": "Thr",
"end_pos": 365,
"end_aa": "Thr",
"residue": "Thr",
"site_lbl": "Thr365",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "30459171",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/30459171"
},
{
"id": "26598643",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/26598643"
}
]
},
{
"glytoucan_ac": "G65562ZE",
"type": "O-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "T",
"relation": "attached",
"comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-268, N-308, T-365",
"start_pos": 365,
"start_aa": "Thr",
"end_pos": 365,
"end_aa": "Thr",
"residue": "Thr",
"site_lbl": "Thr365",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "2065054",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2065054"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
},
{
"id": "2386787",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2386787"
},
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "3356193",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/3356193"
},
{
"id": "9054441",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/9054441"
},
{
"id": "479158",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/479158"
}
]
},
{
"glytoucan_ac": "G74722FL",
"type": "O-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "T",
"relation": "attached",
"comment": "",
"start_pos": 365,
"start_aa": "Thr",
"end_pos": 365,
"end_aa": "Thr",
"residue": "Thr",
"site_lbl": "Thr365",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "3356193",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/3356193"
},
{
"id": "9054441",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/9054441"
},
{
"id": "479158",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/479158"
}
]
},
{
"glytoucan_ac": "G81006GJ",
"type": "O-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "T",
"relation": "attached",
"comment": "",
"start_pos": 365,
"start_aa": "Thr",
"end_pos": 365,
"end_aa": "Thr",
"residue": "Thr",
"site_lbl": "Thr365",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "3356193",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/3356193"
},
{
"id": "479158",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/479158"
}
]
},
{
"glytoucan_ac": "",
"type": "O-linked",
"subtype": "O-GalNAcylation",
"site_category": "reported",
"site_seq": "T",
"relation": "attached",
"comment": "O-linked (GalNAc...) threonine O-GalNAcylation",
"start_pos": 365,
"start_aa": "Thr",
"end_pos": 365,
"end_aa": "Thr",
"residue": "Thr",
"site_lbl": "Thr365",
"evidence": [
{
"id": "P00747",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00747#ptm_processing"
},
{
"id": "3356193",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/3356193"
},
{
"id": "4A5T",
"database": "RCSB PDB",
"url": "https://www.rcsb.org/sequence/4A5T"
},
{
"id": "4DUR",
"database": "RCSB PDB",
"url": "https://www.rcsb.org/sequence/4DUR"
}
]
},
{
"glytoucan_ac": "G29068FM",
"type": "O-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "T",
"relation": "attached",
"comment": "",
"start_pos": 371,
"start_aa": "Thr",
"end_pos": 371,
"end_aa": "Thr",
"residue": "Thr",
"site_lbl": "Thr371",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "30459171",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/30459171"
}
]
},
{
"glytoucan_ac": "G43417UB",
"type": "O-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "T",
"relation": "attached",
"comment": "",
"start_pos": 371,
"start_aa": "Thr",
"end_pos": 371,
"end_aa": "Thr",
"residue": "Thr",
"site_lbl": "Thr371",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "30459171",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/30459171"
}
]
},
{
"glytoucan_ac": "G82463GQ",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 424,
"start_aa": "Asn",
"end_pos": 424,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn424",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "29391424",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/29391424"
}
]
},
{
"glytoucan_ac": "G43417UB",
"type": "O-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "T",
"relation": "attached",
"comment": "",
"start_pos": 457,
"start_aa": "Thr",
"end_pos": 457,
"end_aa": "Thr",
"residue": "Thr",
"site_lbl": "Thr457",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "30459171",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/30459171"
}
]
},
{
"glytoucan_ac": "G43417UB",
"type": "O-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "S",
"relation": "attached",
"comment": "",
"start_pos": 460,
"start_aa": "Ser",
"end_pos": 460,
"end_aa": "Ser",
"residue": "Ser",
"site_lbl": "Ser460",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "30459171",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/30459171"
}
]
},
{
"glytoucan_ac": "G29068FM",
"type": "O-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "T",
"relation": "attached",
"comment": "",
"start_pos": 710,
"start_aa": "Thr",
"end_pos": 710,
"end_aa": "Thr",
"residue": "Thr",
"site_lbl": "Thr710",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "30459171",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/30459171"
}
]
},
{
"glytoucan_ac": "G43417UB",
"type": "O-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "T",
"relation": "attached",
"comment": "",
"start_pos": 710,
"start_aa": "Thr",
"end_pos": 710,
"end_aa": "Thr",
"residue": "Thr",
"site_lbl": "Thr710",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "30459171",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/30459171"
}
]
},
{
"glytoucan_ac": "G43417UB",
"type": "O-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "T",
"relation": "attached",
"comment": "",
"start_pos": 742,
"start_aa": "Thr",
"end_pos": 742,
"end_aa": "Thr",
"residue": "Thr",
"site_lbl": "Thr742",
"evidence": [
{
"id": "P00747",
"database": "UniCarbKB",
"url": ""
},
{
"id": "30459171",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/30459171"
}
]
},
{
"glytoucan_ac": "G00776MW",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
}
]
},
{
"glytoucan_ac": "G03706EO",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
}
]
},
{
"glytoucan_ac": "G04689DA",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
}
]
},
{
"glytoucan_ac": "G05724UK",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
}
]
},
{
"glytoucan_ac": "G06110VR",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "2386787",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2386787"
},
{
"id": "2065054",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2065054"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
}
]
},
{
"glytoucan_ac": "G06356OH",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
}
]
},
{
"glytoucan_ac": "G11346GZ",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
}
]
},
{
"glytoucan_ac": "G12793SR",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
}
]
},
{
"glytoucan_ac": "G14669DU",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "2386787",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2386787"
},
{
"id": "2065054",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2065054"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
}
]
},
{
"glytoucan_ac": "G15956KF",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
}
]
},
{
"glytoucan_ac": "G20367UY",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
}
]
},
{
"glytoucan_ac": "G20425TQ",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
}
]
},
{
"glytoucan_ac": "G22310AV",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "2065054",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2065054"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
}
]
},
{
"glytoucan_ac": "G22768VO",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "2386787",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2386787"
},
{
"id": "2065054",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2065054"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
}
]
},
{
"glytoucan_ac": "G23863VK",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "2065054",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2065054"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
}
]
},
{
"glytoucan_ac": "G29857RC",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
}
]
},
{
"glytoucan_ac": "G36191CD",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "2065054",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2065054"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
}
]
},
{
"glytoucan_ac": "G39188ZX",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
}
]
},
{
"glytoucan_ac": "G42039DE",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
}
]
},
{
"glytoucan_ac": "G47012YE",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
}
]
},
{
"glytoucan_ac": "G47518TP",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
}
]
},
{
"glytoucan_ac": "G48414YA",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "2386787",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2386787"
},
{
"id": "2065054",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2065054"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
}
]
},
{
"glytoucan_ac": "G49874UX",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
}
]
},
{
"glytoucan_ac": "G50045TK",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "2065054",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2065054"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
}
]
},
{
"glytoucan_ac": "G55220VL",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "2386787",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2386787"
},
{
"id": "2065054",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2065054"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
}
]
},
{
"glytoucan_ac": "G55661CO",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
}
]
},
{
"glytoucan_ac": "G56014GC",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
}
]
},
{
"glytoucan_ac": "G56749GV",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "2065054",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2065054"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
}
]
},
{
"glytoucan_ac": "G60230HH",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "2386787",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2386787"
},
{
"id": "2065054",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2065054"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
}
]
},
{
"glytoucan_ac": "G60452UF",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
}
]
},
{
"glytoucan_ac": "G66088HZ",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
}
]
},
{
"glytoucan_ac": "G66538GV",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
}
]
},
{
"glytoucan_ac": "G70101JE",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "2386787",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2386787"
},
{
"id": "2065054",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2065054"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
}
]
},
{
"glytoucan_ac": "G74724QE",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
}
]
},
{
"glytoucan_ac": "G76675AB",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
}
]
},
{
"glytoucan_ac": "G78059CC",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "2065054",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2065054"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
}
]
},
{
"glytoucan_ac": "G80858MF",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
}
]
},
{
"glytoucan_ac": "G82348BZ",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
}
]
},
{
"glytoucan_ac": "G84467IZ",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "2386787",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2386787"
},
{
"id": "2065054",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2065054"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
}
]
},
{
"glytoucan_ac": "G85839YN",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
}
]
},
{
"glytoucan_ac": "G89186VO",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
}
]
},
{
"glytoucan_ac": "G90983OS",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "1899031",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1899031"
}
]
},
{
"glytoucan_ac": "G92089QC",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
}
]
},
{
"glytoucan_ac": "G93656SY",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
}
]
},
{
"glytoucan_ac": "G96622LK",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "502",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
},
{
"id": "2059624",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2059624"
}
]
}
],
"phosphorylation": [
{
"start_pos": 597,
"end_pos": 597,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "Phosphoserine",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
},
{
"database": "PubMed",
"id": "9201958",
"url": "https://glygen.org/publication/PubMed/9201958"
},
{
"database": "iPTMnet",
"id": "P00747",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00747"
},
{
"database": "phospho.ELM",
"id": "P00747",
"url": "http://phospho.elm.eu.org/byAccession/P00747.html"
}
],
"site_lbl": "Ser597"
},
{
"start_pos": 688,
"end_pos": 688,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "Phosphoserine",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
},
{
"database": "PubMed",
"id": "24275569",
"url": "https://glygen.org/publication/PubMed/24275569"
},
{
"database": "iPTMnet",
"id": "P00747",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00747"
}
],
"site_lbl": "Ser688"
}
],
"glycation": [],
"keywords": [
"enzyme",
"glycoprotein",
"glycoprotein_reported_with_glycan",
"glycoprotein_reported"
],
"publication": [
{
"title": "Proteomics Analysis of O-GalNAc Glycosylation in Human Serum by an Integrated Strategy",
"journal": "Anal. Chem.",
"date": "2017",
"authors": "Qin H., Cheng K., Zhu J., Mao J., Wang F., Dong M., Chen R., Guo Z., Liang X., Ye M., Zou H.",
"evidence": [
{
"database": "UniCarbKB",
"id": "P00747",
"url": ""
}
],
"reference": [
{
"type": "DOI",
"id": "10.1021/acs.analchem.6b02887",
"url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.6b02887"
}
]
},
{
"title": "N-Linked glycosylation and sialylation of the acid-labile subunit. Role in complex formation with insulin-like growth factor (IGF)-binding protein-3 and the IGFs.",
"journal": "The Journal of biological chemistry",
"date": "1999",
"authors": "Janosi JB, Firth SM, Bond JJ, Baxter RC, Delhanty PJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "10026136",
"url": "https://glygen.org/publication/PubMed/10026136"
}
]
},
{
"title": "Angiostatin binds ATP synthase on the surface of human endothelial cells.",
"journal": "Proc. Natl. Acad. Sci. U.S.A.",
"date": "1999",
"authors": "Moser T L, Stack M S, Asplin I, Enghild J J, H\u00f8jrup P, Everitt L, Hubchak S, Schnaper H W, Pizzo S V",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "10077593",
"url": "https://glygen.org/publication/PubMed/10077593"
}
]
},
{
"title": "The insulin-like growth factor (IGF)-dependent IGF binding protein-4 protease secreted by human fibroblasts is pregnancy-associated plasma protein-A.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1999",
"authors": "Lawrence JB, Oxvig C, Overgaard MT, Sottrup-Jensen L, Gleich GJ, Hays LG, Yates JR 3rd, Conover CA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "10077652",
"url": "https://glygen.org/publication/PubMed/10077652"
}
]
},
{
"title": "The cleavage site specificity of human prostate specific antigen for insulin-like growth factor binding protein-3.",
"journal": "FEBS letters",
"date": "1999",
"authors": "Okabe E, Kajihara J, Usami Y, Hirano K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "10218588",
"url": "https://glygen.org/publication/PubMed/10218588"
}
]
},
{
"title": "Fibrillin degradation by matrix metalloproteinases: implications for connective tissue remodelling.",
"journal": "The Biochemical journal",
"date": "1999",
"authors": "Ashworth JL, Murphy G, Rock MJ, Sherratt MJ, Shapiro SD, Shuttleworth CA, Kielty CM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "10229672",
"url": "https://glygen.org/publication/PubMed/10229672"
}
]
},
{
"title": "Compound-heterozygous mutations in the plasminogen gene predispose to the development of ligneous conjunctivitis.",
"journal": "Blood",
"date": "1999",
"authors": "Schuster V, Seidenspinner S, Zeitler P, Escher C, Pleyer U, Bernauer W, Stiehm ER, Isenberg S, Seregard S, Olsson T, Mingers AM, Schambeck C, Kreth HW",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "10233898",
"url": "https://glygen.org/publication/PubMed/10233898"
}
]
},
{
"title": "Fibrillin degradation by matrix metalloproteinases: identification of amino- and carboxy-terminal cleavage sites.",
"journal": "FEBS letters",
"date": "1999",
"authors": "Hindson VJ, Ashworth JL, Rock MJ, Cunliffe S, Shuttleworth CA, Kielty CM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "10386589",
"url": "https://glygen.org/publication/PubMed/10386589"
}
]
},
{
"title": "Mechanism of action and in vivo role of platelet-derived growth factor.",
"journal": "Physiological reviews",
"date": "1999",
"authors": "Heldin CH, Westermark B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797"
}
],
"reference": [
{
"type": "PubMed",
"id": "10508235",
"url": "https://glygen.org/publication/PubMed/10508235"
}
]
},
{
"title": "Inflammation-related neutrophil proteases, cathepsin G and elastase, function as insulin-like growth factor binding protein proteases.",
"journal": "Growth hormone & IGF research : official journal of the Growth Hormone Research Society and the International IGF Research Society",
"date": "1999",
"authors": "Gibson TL, Cohen P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "10512690",
"url": "https://glygen.org/publication/PubMed/10512690"
}
]
},
{
"title": "A central domain binding site in insulin-like growth factor binding protein-5 for the acid-labile subunit.",
"journal": "Endocrinology",
"date": "2000",
"authors": "Twigg SM, Kiefer MC, Zapf J, Baxter RC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "10614670",
"url": "https://glygen.org/publication/PubMed/10614670"
}
]
},
{
"title": "Human plasminogen catalytic domain undergoes an unusual conformational change upon activation.",
"journal": "J. Mol. Biol.",
"date": "2000",
"authors": "Wang X, Terzyan S, Tang J, Loy J A, Lin X, Zhang X C",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "10656799",
"url": "https://glygen.org/publication/PubMed/10656799"
}
]
},
{
"title": "Insulin-like growth factor binding protein (IGFBP)-3-bound IGF-I and IGFBP-3-bound IGF-II in growth hormone deficiency.",
"journal": "Hormone research",
"date": "1999",
"authors": "Belgorosky A, Rivarola MA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "10681634",
"url": "https://glygen.org/publication/PubMed/10681634"
}
]
},
{
"title": "EMMPRIN (CD147), an inducer of matrix metalloproteinase synthesis, also binds interstitial collagenase to the tumor cell surface.",
"journal": "Cancer research",
"date": "2000",
"authors": "Guo H, Li R, Zucker S, Toole BP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "10706100",
"url": "https://glygen.org/publication/PubMed/10706100"
}
]
},
{
"title": "Biochemical characterization of the catalytic domain of human matrix metalloproteinase 19. Evidence for a role as a potent basement membrane degrading enzyme.",
"journal": "The Journal of biological chemistry",
"date": "2000",
"authors": "Stracke JO, Hutton M, Stewart M, Pendas AM, Smith B, Lopez-Otin C, Murphy G, Knauper V",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "10809722",
"url": "https://glygen.org/publication/PubMed/10809722"
}
]
},
{
"title": "Binding characteristics of pro-insulin-like growth factor-II from cancer patients: binary and ternary complex formation with IGF binding proteins-1 to -6.",
"journal": "The Journal of endocrinology",
"date": "2000",
"authors": "Bond JJ, Meka S, Baxter RC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "10810289",
"url": "https://glygen.org/publication/PubMed/10810289"
}
]
},
{
"title": "Binding of the NG2 proteoglycan to kringle domains modulates the functional properties of angiostatin and plasmin(ogen).",
"journal": "J. Biol. Chem.",
"date": "2000",
"authors": "Goretzki L, Lombardo C R, Stallcup W B",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "10889192",
"url": "https://glygen.org/publication/PubMed/10889192"
}
]
},
{
"title": "Evidence that the interaction between insulin-like growth factor (IGF)-II and IGF binding protein (IGFBP)-4 is essential for the action of the IGF-II-dependent IGFBP-4 protease.",
"journal": "Archives of biochemistry and biophysics",
"date": "2000",
"authors": "Qin X, Byun D, Lau KH, Baylink DJ, Mohan S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "10898936",
"url": "https://glygen.org/publication/PubMed/10898936"
}
]
},
{
"title": "Effects of IGFBP-2 overexpression in vitro and in vivo.",
"journal": "Pediatric nephrology (Berlin, Germany)",
"date": "2000",
"authors": "Wolf E, Lahm H, Wu M, Wanke R, Hoeflich A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "10912521",
"url": "https://glygen.org/publication/PubMed/10912521"
}
]
},
{
"title": "O-glycosylation of insulin-like growth factor (IGF) binding protein-6 maintains high IGF-II binding affinity by decreasing binding to glycosaminoglycans and susceptibility to proteolysis.",
"journal": "European journal of biochemistry",
"date": "2000",
"authors": "Marinaro JA, Neumann GM, Russo VC, Leeding KS, Bach LA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "10951195",
"url": "https://glygen.org/publication/PubMed/10951195"
}
]
},
{
"title": "Brevican is degraded by matrix metalloproteinases and aggrecanase-1 (ADAMTS4) at different sites.",
"journal": "The Journal of biological chemistry",
"date": "2000",
"authors": "Nakamura H, Fujii Y, Inoki I, Sugimoto K, Tanzawa K, Matsuki H, Miura R, Yamaguchi Y, Okada Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "10986281",
"url": "https://glygen.org/publication/PubMed/10986281"
}
]
},
{
"title": "Prostate carcinoma (PC-3) cell proliferation is stimulated by the 22-25-kDa proteolytic fragment (1-160) and inhibited by the 16-kDa fragment (1-95) of recombinant human insulin-like growth factor binding protein-3.",
"journal": "Growth hormone & IGF research : official journal of the Growth Hormone Research Society and the International IGF Research Society",
"date": "1998",
"authors": "Angelloz-Nicoud P, Lalou C, Binoux M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "10990447",
"url": "https://glygen.org/publication/PubMed/10990447"
}
]
},
{
"title": "Pregnancy-associated plasma protein-A accounts for the insulin-like growth factor (IGF)-binding protein-4 (IGFBP-4) proteolytic activity in human pregnancy serum and enhances the mitogenic activity of IGF by degrading IGFBP-4 in vitro.",
"journal": "The Journal of clinical endocrinology and metabolism",
"date": "2001",
"authors": "Byun D, Mohan S, Yoo M, Sexton C, Baylink DJ, Qin X",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "11158056",
"url": "https://glygen.org/publication/PubMed/11158056"
}
]
},
{
"title": "Ligand-binding characteristics of recombinant amino- and carboxyl-terminal fragments of human insulin-like growth factor-binding protein-3.",
"journal": "The Journal of endocrinology",
"date": "2001",
"authors": "Galanis M, Firth SM, Bond J, Nathanielsz A, Kortt AA, Hudson PJ, Baxter RC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "11250653",
"url": "https://glygen.org/publication/PubMed/11250653"
}
]
},
{
"title": "Pregnancy-associated plasma protein-A2 (PAPP-A2), a novel insulin-like growth factor-binding protein-5 proteinase.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Overgaard MT, Boldt HB, Laursen LS, Sottrup-Jensen L, Conover CA, Oxvig C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "11264294",
"url": "https://glygen.org/publication/PubMed/11264294"
}
]
},
{
"title": "Mutagenesis of basic amino acids in the carboxyl-terminal region of insulin-like growth factor binding protein-5 affects acid-labile subunit binding.",
"journal": "Endocrinology",
"date": "2001",
"authors": "Firth SM, Clemmons DR, Baxter RC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "11316783",
"url": "https://glygen.org/publication/PubMed/11316783"
}
]
},
{
"title": "Structure and binding determinants of the recombinant kringle-2 domain of human plasminogen to an internal peptide from a group A Streptococcal surface protein.",
"journal": "J. Mol. Biol.",
"date": "2001",
"authors": "Rios-Steiner J L, Schenone M, Mochalkin I, Tulinsky A, Castellino F J",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "11350170",
"url": "https://glygen.org/publication/PubMed/11350170"
}
]
},
{
"title": "Osteopontin, a novel substrate for matrix metalloproteinase-3 (stromelysin-1) and matrix metalloproteinase-7 (matrilysin).",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Agnihotri R, Crawford HC, Haro H, Matrisian LM, Havrda MC, Liaw L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "11375993",
"url": "https://glygen.org/publication/PubMed/11375993"
}
]
},
{
"title": "Pregnancy-associated plasma protein-A (PAPP-A) cleaves insulin-like growth factor binding protein (IGFBP)-5 independent of IGF: implications for the mechanism of IGFBP-4 proteolysis by PAPP-A.",
"journal": "FEBS letters",
"date": "2001",
"authors": "Laursen LS, Overgaard MT, Soe R, Boldt HB, Sottrup-Jensen L, Giudice LC, Conover CA, Oxvig C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "11522292",
"url": "https://glygen.org/publication/PubMed/11522292"
}
]
},
{
"title": "Insulin-like growth factor-binding protein-5 inhibits growth and induces differentiation of mouse osteosarcoma cells.",
"journal": "Biochemical and biophysical research communications",
"date": "2001",
"authors": "Schneider MR, Zhou R, Hoeflich A, Krebs O, Schmidt J, Mohan S, Wolf E, Lahm H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "11606061",
"url": "https://glygen.org/publication/PubMed/11606061"
}
]
},
{
"title": "IGFBP-3 binding to endothelial cells inhibits plasmin and thrombin proteolysis.",
"journal": "American journal of physiology. Endocrinology and metabolism",
"date": "2002",
"authors": "Booth BA, Boes M, Dake BL, Knudtson KL, Bar RS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "11739083",
"url": "https://glygen.org/publication/PubMed/11739083"
}
]
},
{
"title": "Insulin-like growth factor-binding protein 2 in tumorigenesis: protector or promoter?",
"journal": "Cancer research",
"date": "2001",
"authors": "Hoeflich A, Reisinger R, Lahm H, Kiess W, Blum WF, Kolb HJ, Weber MM, Wolf E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "11751371",
"url": "https://glygen.org/publication/PubMed/11751371"
}
]
},
{
"title": "Molecular distribution of IGF binding protein-5 in human serum.",
"journal": "The Journal of clinical endocrinology and metabolism",
"date": "2002",
"authors": "Baxter RC, Meka S, Firth SM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "11788658",
"url": "https://glygen.org/publication/PubMed/11788658"
}
]
},
{
"title": "Activation of membrane-type matrix metalloproteinase 3 zymogen by the proprotein convertase furin in the trans-Golgi network.",
"journal": "Cancer research",
"date": "2002",
"authors": "Kang T, Nagase H, Pei D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "11830519",
"url": "https://glygen.org/publication/PubMed/11830519"
}
]
},
{
"title": "Overexpression of alpha(v)beta6 integrin in serous epithelial ovarian cancer regulates extracellular matrix degradation via the plasminogen activation cascade.",
"journal": "Carcinogenesis",
"date": "2002",
"authors": "Ahmed N, Pansino F, Clyde R, Murthi P, Quinn MA, Rice GE, Agrez MV, Mok S, Baker MS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "11872628",
"url": "https://glygen.org/publication/PubMed/11872628"
}
]
},
{
"title": "The blockage of the high-affinity lysine binding sites of plasminogen by EACA significantly inhibits prourokinase-induced plasminogen activation.",
"journal": "Biochimica et biophysica acta",
"date": "2002",
"authors": "Sun Z, Chen YH, Wang P, Zhang J, Gurewich V, Zhang P, Liu JN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-75205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205"
}
],
"reference": [
{
"type": "PubMed",
"id": "12007600",
"url": "https://glygen.org/publication/PubMed/12007600"
}
]
},
{
"title": "The X-ray crystallographic structure of the angiogenesis inhibitor angiostatin.",
"journal": "J. Mol. Biol.",
"date": "2002",
"authors": "Abad Marta C, Arni R K, Grella Davida K, Castellino Francis J, Tulinsky Alexander, Geiger James H",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "12054798",
"url": "https://glygen.org/publication/PubMed/12054798"
}
]
},
{
"title": "Matriptase-2, a membrane-bound mosaic serine proteinase predominantly expressed in human liver and showing degrading activity against extracellular matrix proteins.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Velasco G, Cal S, Quesada V, Sanchez LM, Lopez-Otin C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "12149247",
"url": "https://glygen.org/publication/PubMed/12149247"
}
]
},
{
"title": "Substrate specificity of the metalloproteinase pregnancy-associated plasma protein-A (PAPP-A) assessed by mutagenesis and analysis of synthetic peptides: substrate residues distant from the scissile bond are critical for proteolysis.",
"journal": "The Biochemical journal",
"date": "2002",
"authors": "Laursen LS, Overgaard MT, Nielsen CG, Boldt HB, Hopmann KH, Conover CA, Sottrup-Jensen L, Giudice LC, Oxvig C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "12241545",
"url": "https://glygen.org/publication/PubMed/12241545"
}
]
},
{
"title": "Structural relationship between 'glutamic acid' and 'lysine' forms of human plasminogen and their interaction with the NH2-terminal activation peptide as studied by affinity chromatography.",
"journal": "Eur. J. Biochem.",
"date": "1975",
"authors": "Wiman B, Wallen P",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "122932",
"url": "https://glygen.org/publication/PubMed/122932"
}
]
},
{
"title": "BAY 43-9006: preclinical data.",
"journal": "Current pharmaceutical design",
"date": "2002",
"authors": "Wilhelm S, Chien DS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797"
}
],
"reference": [
{
"type": "PubMed",
"id": "12369853",
"url": "https://glygen.org/publication/PubMed/12369853"
}
]
},
{
"title": "IGF-binding proteins are multifunctional and act via IGF-dependent and -independent mechanisms.",
"journal": "The Journal of endocrinology",
"date": "2002",
"authors": "Mohan S, Baylink DJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "12379487",
"url": "https://glygen.org/publication/PubMed/12379487"
}
]
},
{
"title": "Effects of deletion of streptokinase residues 48-59 on plasminogen activation.",
"journal": "Protein Eng.",
"date": "2002",
"authors": "Wakeham N, Terzyan S, Zhai P, Loy J A, Tang J, Zhang X C",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "12456874",
"url": "https://glygen.org/publication/PubMed/12456874"
}
]
},
{
"title": "Cellular actions of the insulin-like growth factor binding proteins.",
"journal": "Endocrine reviews",
"date": "2002",
"authors": "Firth SM, Baxter RC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "12466191",
"url": "https://glygen.org/publication/PubMed/12466191"
}
]
},
{
"title": "In vivo antitumor activity of SU11248, a novel tyrosine kinase inhibitor targeting vascular endothelial growth factor and platelet-derived growth factor receptors: determination of a pharmacokinetic/pharmacodynamic relationship.",
"journal": "Clinical cancer research : an official journal of the American Association for Cancer Research",
"date": "2003",
"authors": "Mendel DB, Laird AD, Xin X, Louie SG, Christensen JG, Li G, Schreck RE, Abrams TJ, Ngai TJ, Lee LB, Murray LJ, Carver J, Chan E, Moss KG, Haznedar JO, Sukbuntherng J, Blake RA, Sun L, Tang C, Miller T, Shirazian S, McMahon G, Cherrington JM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797"
}
],
"reference": [
{
"type": "PubMed",
"id": "12538485",
"url": "https://glygen.org/publication/PubMed/12538485"
}
]
},
{
"title": "Amino-acid sequence of the cyanogen-bromide fragment from human plasminogen that forms the linkage between the plasmin chains.",
"journal": "Eur. J. Biochem.",
"date": "1975",
"authors": "Wiman B, Wallen P",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "126863",
"url": "https://glygen.org/publication/PubMed/126863"
}
]
},
{
"title": "Membrane type-1-matrix metalloproteinase expressed by prostate carcinoma cells cleaves human laminin-5 beta3 chain and induces cell migration.",
"journal": "Cancer research",
"date": "2003",
"authors": "Udayakumar TS, Chen ML, Bair EL, Von Bredow DC, Cress AE, Nagle RB, Bowden GT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "12727852",
"url": "https://glygen.org/publication/PubMed/12727852"
}
]
},
{
"title": "Amino- and carboxyl-terminal fragments of insulin-like growth factor (IGF) binding protein-3 cooperate to bind IGFs with high affinity and inhibit IGF receptor interactions.",
"journal": "Endocrinology",
"date": "2003",
"authors": "Payet LD, Wang XH, Baxter RC, Firth SM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "12810533",
"url": "https://glygen.org/publication/PubMed/12810533"
}
]
},
{
"title": "The calpain system.",
"journal": "Physiological reviews",
"date": "2003",
"authors": "Goll DE, Thompson VF, Li H, Wei W, Cong J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "12843408",
"url": "https://glygen.org/publication/PubMed/12843408"
}
]
},
{
"title": "IGF-binding protein-4: biochemical characteristics and functional consequences.",
"journal": "The Journal of endocrinology",
"date": "2003",
"authors": "Zhou R, Diehl D, Hoeflich A, Lahm H, Wolf E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "12904166",
"url": "https://glygen.org/publication/PubMed/12904166"
}
]
},
{
"title": "The extracellular glycoprotein SPARC interacts with platelet-derived growth factor (PDGF)-AB and -BB and inhibits the binding of PDGF to its receptors.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1992",
"authors": "Raines EW, Lane TF, Iruela-Arispe ML, Ross R, Sage EH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797"
}
],
"reference": [
{
"type": "PubMed",
"id": "1311092",
"url": "https://glygen.org/publication/PubMed/1311092"
}
]
},
{
"title": "Interaction of 92-kDa type IV collagenase with the tissue inhibitor of metalloproteinases prevents dimerization, complex formation with interstitial collagenase, and activation of the proenzyme with stromelysin.",
"journal": "The Journal of biological chemistry",
"date": "1992",
"authors": "Goldberg GI, Strongin A, Collier IE, Genrich LT, Marmer BL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "1311314",
"url": "https://glygen.org/publication/PubMed/1311314"
}
]
},
{
"title": "Isolation and characterization of alpha2-plasmin inhibitor from human plasma. A novel proteinase inhibitor which inhibits activator-induced clot lysis.",
"journal": "The Journal of biological chemistry",
"date": "1976",
"authors": "Moroi M, Aoki N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-75205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205"
}
],
"reference": [
{
"type": "PubMed",
"id": "134998",
"url": "https://glygen.org/publication/PubMed/134998"
}
]
},
{
"title": "Structural determinants for binary and ternary complex formation between insulin-like growth factor-I (IGF-I) and IGF binding protein-3.",
"journal": "The Journal of biological chemistry",
"date": "1992",
"authors": "Baxter RC, Bayne ML, Cascieri MA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "1370451",
"url": "https://glygen.org/publication/PubMed/1370451"
}
]
},
{
"title": "Matrix metalloproteinase 3 (stromelysin) activates the precursor for the human matrix metalloproteinase 9.",
"journal": "The Journal of biological chemistry",
"date": "1992",
"authors": "Ogata Y, Enghild JJ, Nagase H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "1371271",
"url": "https://glygen.org/publication/PubMed/1371271"
}
]
},
{
"title": "Prostate-specific antigen (PSA) is an insulin-like growth factor binding protein-3 protease found in seminal plasma.",
"journal": "The Journal of clinical endocrinology and metabolism",
"date": "1992",
"authors": "Cohen P, Graves HC, Peehl DM, Kamarei M, Giudice LC, Rosenfeld RG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "1383255",
"url": "https://glygen.org/publication/PubMed/1383255"
}
]
},
{
"title": "Biochemical characterization of matrilysin. Activation conforms to the stepwise mechanisms proposed for other matrix metalloproteinases.",
"journal": "Biochemistry",
"date": "1992",
"authors": "Crabbe T, Willenbrock F, Eaton D, Hynds P, Carne AF, Murphy G, Docherty AJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "1390635",
"url": "https://glygen.org/publication/PubMed/1390635"
}
]
},
{
"title": "Primary structure of the B-chain of human plasmin.",
"journal": "Eur. J. Biochem.",
"date": "1977",
"authors": "Wiman B",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "142009",
"url": "https://glygen.org/publication/PubMed/142009"
}
]
},
{
"title": "Plasminogen with type-I mutation is polymorphic in the Japanese population.",
"journal": "Human genetics",
"date": "1992",
"authors": "Kikuchi S, Yamanouchi Y, Li L, Kobayashi K, Ijima H, Miyazaki R, Tsuchiya S, Hamaguchi H",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "1427790",
"url": "https://glygen.org/publication/PubMed/1427790"
}
]
},
{
"title": "Isolation of dense granules from human platelets.",
"journal": "Methods in enzymology",
"date": "1992",
"authors": "Fukami MH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-114608",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608"
}
],
"reference": [
{
"type": "PubMed",
"id": "1435334",
"url": "https://glygen.org/publication/PubMed/1435334"
}
]
},
{
"title": "Characterization of the proteins released from activated platelets leads to localization of novel platelet proteins in human atherosclerotic lesions.",
"journal": "Blood",
"date": "2004",
"authors": "Coppinger JA, Cagney G, Toomey S, Kislinger T, Belton O, McRedmond JP, Cahill DJ, Emili A, Fitzgerald DJ, Maguire PB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-114608",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608"
}
],
"reference": [
{
"type": "PubMed",
"id": "14630798",
"url": "https://glygen.org/publication/PubMed/14630798"
}
]
},
{
"title": "Protease nexin-1 inhibits plasminogen activation-induced apoptosis of adherent cells.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Rossignol P, Ho-Tin-Noe B, Vranckx R, Bouton MC, Meilhac O, Lijnen HR, Guillin MC, Michel JB, Angles-Cano E",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "14699093",
"url": "https://glygen.org/publication/PubMed/14699093"
}
]
},
{
"title": "Activation mechanisms of the precursors of matrix metalloproteinases 1, 2 and 3.",
"journal": "Matrix (Stuttgart, Germany). Supplement",
"date": "1992",
"authors": "Nagase H, Suzuki K, Morodomi T, Enghild JJ, Salvesen G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "1480033",
"url": "https://glygen.org/publication/PubMed/1480033"
}
]
},
{
"title": "HtrA1 serine protease inhibits signaling mediated by Tgfbeta family proteins.",
"journal": "Development (Cambridge, England)",
"date": "2004",
"authors": "Oka C, Tsujimoto R, Kajikawa M, Koshiba-Takeuchi K, Ina J, Yano M, Tsuchiya A, Ueta Y, Soma A, Kanda H, Matsumoto M, Kawaichi M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "14973287",
"url": "https://glygen.org/publication/PubMed/14973287"
}
]
},
{
"title": "Cell surface adenosine deaminase binds and stimulates plasminogen activation on 1-LN human prostate cancer cells.",
"journal": "J. Biol. Chem.",
"date": "2004",
"authors": "Gonzalez-Gronow Mario, Hershfield Michael S, Arredondo-Vega Francisco X, Pizzo Salvatore V",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "15016824",
"url": "https://glygen.org/publication/PubMed/15016824"
}
]
},
{
"title": "The role of the acid-labile subunit in regulating insulin-like growth factor transport across human umbilical vein endothelial cell monolayers.",
"journal": "The Journal of clinical endocrinology and metabolism",
"date": "2004",
"authors": "Payet LD, Firth SM, Baxter RC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "15126567",
"url": "https://glygen.org/publication/PubMed/15126567"
}
]
},
{
"title": "The PDGF family: four gene products form five dimeric isoforms.",
"journal": "Cytokine & growth factor reviews",
"date": "2004",
"authors": "Fredriksson L, Li H, Eriksson U",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797"
}
],
"reference": [
{
"type": "PubMed",
"id": "15207811",
"url": "https://glygen.org/publication/PubMed/15207811"
}
]
},
{
"title": "Characterization of Lys-698-to-Met substitution in human plasminogen catalytic domain.",
"journal": "Proteins",
"date": "2004",
"authors": "Terzyan Simon, Wakeham Nancy, Zhai Peng, Rodgers Karla, Zhang Xuejun C",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "15211511",
"url": "https://glygen.org/publication/PubMed/15211511"
}
]
},
{
"title": "A novel secreted, cell-surface glycoprotein containing multiple epidermal growth factor-like repeats and one CUB domain is highly expressed in primary osteoblasts and bones.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Wu BT, Su YH, Tsai MT, Wasserman SM, Topper JN, Yang RB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "15234972",
"url": "https://glygen.org/publication/PubMed/15234972"
}
]
},
{
"title": "The nucleotide transporter MRP4 (ABCC4) is highly expressed in human platelets and present in dense granules, indicating a role in mediator storage.",
"journal": "Blood",
"date": "2004",
"authors": "Jedlitschky G, Tirschmann K, Lubenow LE, Nieuwenhuis HK, Akkerman JW, Greinacher A, Kroemer HK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-114608",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608"
}
],
"reference": [
{
"type": "PubMed",
"id": "15297306",
"url": "https://glygen.org/publication/PubMed/15297306"
}
]
},
{
"title": "Structure of human plasminogen kringle 4 at 1.68 Angstrom and 277 K. A possible structural role of disordered residues.",
"journal": "Acta Crystallogr. D",
"date": "1997",
"authors": "Stec B, Yamano A, Whitlow M, Teeter M M",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "15299951",
"url": "https://glygen.org/publication/PubMed/15299951"
}
]
},
{
"title": "C-terminal domain of insulin-like growth factor (IGF) binding protein-6: structure and interaction with IGF-II.",
"journal": "Molecular endocrinology (Baltimore, Md.)",
"date": "2004",
"authors": "Headey SJ, Keizer DW, Yao S, Brasier G, Kantharidis P, Bach LA, Norton RS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "15308688",
"url": "https://glygen.org/publication/PubMed/15308688"
}
]
},
{
"title": "Characterization of insulin-like growth factor-free interaction between insulin-like growth factor binding protein 3 and acid labile subunit expressed from Xenopus oocytes.",
"journal": "Journal of biochemistry and molecular biology",
"date": "2004",
"authors": "Choi KY, Kyung YJ, Lee CY, Lee DH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "15469690",
"url": "https://glygen.org/publication/PubMed/15469690"
}
]
},
{
"title": "Role of N- and C-terminal residues of insulin-like growth factor (IGF)-binding protein-3 in regulating IGF complex formation and receptor activation.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Yan X, Forbes BE, McNeil KA, Baxter RC, Firth SM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "15485880",
"url": "https://glygen.org/publication/PubMed/15485880"
}
]
},
{
"title": "Contributions of the N- and C-terminal domains of IGF binding protein-6 to IGF binding.",
"journal": "Journal of molecular endocrinology",
"date": "2004",
"authors": "Headey SJ, Leeding KS, Norton RS, Bach LA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "15525596",
"url": "https://glygen.org/publication/PubMed/15525596"
}
]
},
{
"title": "BMP-1/Tolloid-like metalloproteases process endorepellin, the angiostatic C-terminal fragment of perlecan.",
"journal": "The Journal of biological chemistry",
"date": "2005",
"authors": "Gonzalez EM, Reed CC, Bix G, Fu J, Zhang Y, Gopalakrishnan B, Greenspan DS, Iozzo RV",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "15591058",
"url": "https://glygen.org/publication/PubMed/15591058"
}
]
},
{
"title": "Discovery of N-(2-chloro-6-methyl- phenyl)-2-(6-(4-(2-hydroxyethyl)- piperazin-1-yl)-2-methylpyrimidin-4- ylamino)thiazole-5-carboxamide (BMS-354825), a dual Src/Abl kinase inhibitor with potent antitumor activity in preclinical assays.",
"journal": "Journal of medicinal chemistry",
"date": "2004",
"authors": "Lombardo LJ, Lee FY, Chen P, Norris D, Barrish JC, Behnia K, Castaneda S, Cornelius LA, Das J, Doweyko AM, Fairchild C, Hunt JT, Inigo I, Johnston K, Kamath A, Kan D, Klei H, Marathe P, Pang S, Peterson R, Pitt S, Schieven GL, Schmidt RJ, Tokarski J, Wen ML, Wityak J, Borzilleri RM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797"
}
],
"reference": [
{
"type": "PubMed",
"id": "15615512",
"url": "https://glygen.org/publication/PubMed/15615512"
}
]
},
{
"title": "Structural basis for the regulation of insulin-like growth factors by IGF binding proteins.",
"journal": "Structure (London, England : 1993)",
"date": "2005",
"authors": "Siwanowicz I, Popowicz GM, Wisniewska M, Huber R, Kuenkele KP, Lang K, Engh RA, Holak TA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "15642270",
"url": "https://glygen.org/publication/PubMed/15642270"
}
]
},
{
"title": "Targeting the platelet-derived growth factor receptor alpha with a neutralizing human monoclonal antibody inhibits the growth of tumor xenografts: implications as a potential therapeutic target.",
"journal": "Molecular cancer therapeutics",
"date": "2005",
"authors": "Loizos N, Xu Y, Huber J, Liu M, Lu D, Finnerty B, Rolser R, Malikzay A, Persaud A, Corcoran E, Deevi DS, Balderes P, Bassi R, Jimenez X, Joynes CJ, Mangalampalli VR, Steiner P, Tonra JR, Wu Y, Pereira DS, Zhu Z, Ludwig DL, Hicklin DJ, Bohlen P, Witte L, Kussie P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797"
}
],
"reference": [
{
"type": "PubMed",
"id": "15767546",
"url": "https://glygen.org/publication/PubMed/15767546"
}
]
},
{
"title": "ADAM10 mediates E-cadherin shedding and regulates epithelial cell-cell adhesion, migration, and beta-catenin translocation.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2005",
"authors": "Maretzky T, Reiss K, Ludwig A, Buchholz J, Scholz F, Proksch E, de Strooper B, Hartmann D, Saftig P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "15958533",
"url": "https://glygen.org/publication/PubMed/15958533"
}
]
},
{
"title": "Angiomotin regulates endothelial cell-cell junctions and cell motility.",
"journal": "J. Biol. Chem.",
"date": "2005",
"authors": "Bratt Anders, Birot Olivier, Sinha Indranil, Veitonm\u00e4ki Niina, Aase Karin, Ernkvist Mira, Holmgren Lars",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "16043488",
"url": "https://glygen.org/publication/PubMed/16043488"
}
]
},
{
"title": "Human glioblastomas overexpress ADAMTS-5 that degrades brevican.",
"journal": "Acta neuropathologica",
"date": "2005",
"authors": "Nakada M, Miyamori H, Kita D, Takahashi T, Yamashita J, Sato H, Miura R, Yamaguchi Y, Okada Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "16133547",
"url": "https://glygen.org/publication/PubMed/16133547"
}
]
},
{
"title": "Autocrine activation of PDGFRalpha promotes the progression of ovarian cancer.",
"journal": "Oncogene",
"date": "2006",
"authors": "Matei D, Emerson RE, Lai YC, Baldridge LA, Rao J, Yiannoutsos C, Donner DD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797"
}
],
"reference": [
{
"type": "PubMed",
"id": "16331269",
"url": "https://glygen.org/publication/PubMed/16331269"
}
]
},
{
"title": "PDGF-AA and PDGF-BB biosynthesis: proprotein processing in the Golgi complex and lysosomal degradation of PDGF-BB retained intracellularly.",
"journal": "The Journal of cell biology",
"date": "1992",
"authors": "Ostman A, Thyberg J, Westermark B, Heldin CH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797"
}
],
"reference": [
{
"type": "PubMed",
"id": "1639841",
"url": "https://glygen.org/publication/PubMed/1639841"
}
]
},
{
"title": "Potent inhibition of platelet-derived growth factor-induced responses in vascular smooth muscle cells by BMS-354825 (dasatinib).",
"journal": "Molecular pharmacology",
"date": "2006",
"authors": "Chen Z, Lee FY, Bhalla KN, Wu J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797"
}
],
"reference": [
{
"type": "PubMed",
"id": "16436588",
"url": "https://glygen.org/publication/PubMed/16436588"
}
]
},
{
"title": "Preclinical and clinical development of the oral multikinase inhibitor sorafenib in cancer treatment.",
"journal": "Drugs of today (Barcelona, Spain : 1998)",
"date": "2005",
"authors": "Strumberg D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797"
}
],
"reference": [
{
"type": "PubMed",
"id": "16474853",
"url": "https://glygen.org/publication/PubMed/16474853"
}
]
},
{
"title": "Matrix metalloproteinase degradation of elastin, type IV collagen and proteoglycan. A quantitative comparison of the activities of 95 kDa and 72 kDa gelatinases, stromelysins-1 and -2 and punctuated metalloproteinase (PUMP).",
"journal": "The Biochemical journal",
"date": "1991",
"authors": "Murphy G, Cockett MI, Ward RV, Docherty AJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "1649600",
"url": "https://glygen.org/publication/PubMed/1649600"
}
]
},
{
"title": "Crystal and molecular structure of human plasminogen kringle 4 refined at 1.9-A resolution.",
"journal": "Biochemistry",
"date": "1991",
"authors": "Mulichak A M, Tulinsky A, Ravichandran K G",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "1657148",
"url": "https://glygen.org/publication/PubMed/1657148"
}
]
},
{
"title": "The refined structure of the epsilon-aminocaproic acid complex of human plasminogen kringle 4.",
"journal": "Biochemistry",
"date": "1991",
"authors": "Wu T P, Padmanabhan K, Tulinsky A, Mulichak A M",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "1657149",
"url": "https://glygen.org/publication/PubMed/1657149"
}
]
},
{
"title": "Alpha-V-dependent outside-in signaling is required for the regulation of CD44 surface expression, MMP-2 secretion, and cell migration by osteopontin in human melanoma cells.",
"journal": "Experimental cell research",
"date": "2006",
"authors": "Samanna V, Wei H, Ego-Osuala D, Chellaiah MA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "16631740",
"url": "https://glygen.org/publication/PubMed/16631740"
}
]
},
{
"title": "Cathepsin s promotes human preadipocyte differentiation: possible involvement of fibronectin degradation.",
"journal": "Endocrinology",
"date": "2006",
"authors": "Taleb S, Cancello R, Clement K, Lacasa D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "16825321",
"url": "https://glygen.org/publication/PubMed/16825321"
}
]
},
{
"title": "Sequence identity between the alpha 2-macroglobulin receptor and low density lipoprotein receptor-related protein suggests that this molecule is a multifunctional receptor.",
"journal": "The Journal of biological chemistry",
"date": "1990",
"authors": "Strickland DK, Ashcom JD, Williams S, Burgess WH, Migliorini M, Argraves WS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "1698775",
"url": "https://glygen.org/publication/PubMed/1698775"
}
]
},
{
"title": "The role of insulin-like growth factor binding proteins.",
"journal": "Neuroendocrinology",
"date": "2006",
"authors": "Holly J, Perks C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "17047378",
"url": "https://glygen.org/publication/PubMed/17047378"
}
]
},
{
"title": "Hyaluronan and its binding proteins, the hyaladherins.",
"journal": "Current opinion in cell biology",
"date": "1990",
"authors": "Toole BP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "1707285",
"url": "https://glygen.org/publication/PubMed/1707285"
}
]
},
{
"title": "Quantitative analysis of insulin-like growth factor-modulated proteolysis of insulin-like growth factor binding protein-4 and -5 by pregnancy-associated plasma protein-A.",
"journal": "Biochemistry",
"date": "2007",
"authors": "Gyrup C, Oxvig C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "17249697",
"url": "https://glygen.org/publication/PubMed/17249697"
}
]
},
{
"title": "Regulation of insulin-like growth factor (IGF) bioactivity by sequential proteolytic cleavage of IGF binding protein-4 and -5.",
"journal": "Molecular endocrinology (Baltimore, Md.)",
"date": "2007",
"authors": "Laursen LS, Kjaer-Sorensen K, Andersen MH, Oxvig C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "17312271",
"url": "https://glygen.org/publication/PubMed/17312271"
}
]
},
{
"title": "Engagement of collagen-binding integrins promotes matrix metalloproteinase-9-dependent E-cadherin ectodomain shedding in ovarian carcinoma cells.",
"journal": "Cancer research",
"date": "2007",
"authors": "Symowicz J, Adley BP, Gleason KJ, Johnson JJ, Ghosh S, Fishman DA, Hudson LG, Stack MS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "17332331",
"url": "https://glygen.org/publication/PubMed/17332331"
}
]
},
{
"title": "Kallikrein 7 enhances pancreatic cancer cell invasion by shedding E-cadherin.",
"journal": "Cancer",
"date": "2007",
"authors": "Johnson SK, Ramani VC, Hennings L, Haun RS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "17354228",
"url": "https://glygen.org/publication/PubMed/17354228"
}
]
},
{
"title": "Sunitinib: a VEGF and PDGF receptor protein kinase and angiogenesis inhibitor.",
"journal": "Biochemical and biophysical research communications",
"date": "2007",
"authors": "Roskoski R Jr",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797"
}
],
"reference": [
{
"type": "PubMed",
"id": "17367763",
"url": "https://glygen.org/publication/PubMed/17367763"
}
]
},
{
"title": "Platelet-derived growth factor receptor-alpha: a novel therapeutic target in human hepatocellular cancer.",
"journal": "Molecular cancer therapeutics",
"date": "2007",
"authors": "Stock P, Monga D, Tan X, Micsenyi A, Loizos N, Monga SP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797"
}
],
"reference": [
{
"type": "PubMed",
"id": "17604334",
"url": "https://glygen.org/publication/PubMed/17604334"
}
]
},
{
"title": "The calpains: modular designs and functional diversity.",
"journal": "Genome biology",
"date": "2007",
"authors": "Croall DE, Ersfeld K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "17608959",
"url": "https://glygen.org/publication/PubMed/17608959"
}
]
},
{
"title": "Evaluation of aprotinin and tranexamic acid in different in vitro and in vivo models of fibrinolysis, coagulation and thrombus formation.",
"journal": "Journal of thrombosis and haemostasis : JTH",
"date": "2007",
"authors": "Sperzel M, Huetter J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-75205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205"
}
],
"reference": [
{
"type": "PubMed",
"id": "17666018",
"url": "https://glygen.org/publication/PubMed/17666018"
}
]
},
{
"title": "Substrate specificities and activation mechanisms of matrix metalloproteinases.",
"journal": "Biochemical Society transactions",
"date": "1991",
"authors": "Nagase H, Ogata Y, Suzuki K, Enghild JJ, Salvesen G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "1783204",
"url": "https://glygen.org/publication/PubMed/1783204"
}
]
},
{
"title": "E7080, a novel inhibitor that targets multiple kinases, has potent antitumor activities against stem cell factor producing human small cell lung cancer H146, based on angiogenesis inhibition.",
"journal": "International journal of cancer",
"date": "2008",
"authors": "Matsui J, Yamamoto Y, Funahashi Y, Tsuruoka A, Watanabe T, Wakabayashi T, Uenaka T, Asada M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797"
}
],
"reference": [
{
"type": "PubMed",
"id": "17943726",
"url": "https://glygen.org/publication/PubMed/17943726"
}
]
},
{
"title": "Cooperativity of the N- and C-terminal domains of insulin-like growth factor (IGF) binding protein 2 in IGF binding.",
"journal": "Biochemistry",
"date": "2007",
"authors": "Kuang Z, Yao S, McNeil KA, Thompson JA, Bach LA, Forbes BE, Wallace JC, Norton RS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "17985932",
"url": "https://glygen.org/publication/PubMed/17985932"
}
]
},
{
"title": "Plasminogen activation by receptor-bound urokinase. A kinetic study with both cell-associated and isolated receptor.",
"journal": "The Journal of biological chemistry",
"date": "1991",
"authors": "Ellis V, Behrendt N, Dano K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-75205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205"
}
],
"reference": [
{
"type": "PubMed",
"id": "1829461",
"url": "https://glygen.org/publication/PubMed/1829461"
}
]
},
{
"title": "The ectodomain shedding of E-cadherin by ADAM15 supports ErbB receptor activation.",
"journal": "The Journal of biological chemistry",
"date": "2008",
"authors": "Najy AJ, Day KC, Day ML",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "18434311",
"url": "https://glygen.org/publication/PubMed/18434311"
}
]
},
{
"title": "Cellular receptor for urokinase plasminogen activator. Carboxyl-terminal processing and membrane anchoring by glycosyl-phosphatidylinositol.",
"journal": "The Journal of biological chemistry",
"date": "1991",
"authors": "Ploug M, Ronne E, Behrendt N, Jensen AL, Blasi F, Dano K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-75205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205"
}
],
"reference": [
{
"type": "PubMed",
"id": "1846368",
"url": "https://glygen.org/publication/PubMed/1846368"
}
]
},
{
"title": "BIBF 1120: triple angiokinase inhibitor with sustained receptor blockade and good antitumor efficacy.",
"journal": "Cancer research",
"date": "2008",
"authors": "Hilberg F, Roth GJ, Krssak M, Kautschitsch S, Sommergruber W, Tontsch-Grunt U, Garin-Chesa P, Bader G, Zoephel A, Quant J, Heckel A, Rettig WJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797"
}
],
"reference": [
{
"type": "PubMed",
"id": "18559524",
"url": "https://glygen.org/publication/PubMed/18559524"
}
]
},
{
"title": "Caspase-3 activation triggers extracellular cathepsin L release and endorepellin proteolysis.",
"journal": "The Journal of biological chemistry",
"date": "2008",
"authors": "Cailhier JF, Sirois I, Laplante P, Lepage S, Raymond MA, Brassard N, Prat A, Iozzo RV, Pshezhetsky AV, Hebert MJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "18658137",
"url": "https://glygen.org/publication/PubMed/18658137"
}
]
},
{
"title": "Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry.",
"journal": "Proteomics",
"date": "2008",
"authors": "Picariello G, Ferranti P, Mamone G, Roepstorff P, Addeo F",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747#ptm_processing"
},
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "18780401",
"url": "https://glygen.org/publication/PubMed/18780401"
}
]
},
{
"title": "Oligosaccharide structures present on asparagine-289 of recombinant human plasminogen expressed in a Chinese hamster ovary cell line.",
"journal": "Biochemistry",
"date": "1991",
"authors": "Davidson DJ, Castellino FJ",
"evidence": [
{
"database": "UniCarbKB",
"id": "P00747",
"url": ""
},
{
"database": "GlyConnect",
"id": "502",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
}
],
"reference": [
{
"type": "PubMed",
"id": "1899031",
"url": "https://glygen.org/publication/PubMed/1899031"
}
]
},
{
"title": "Membrane-type 1 matrix metalloproteinase regulates macrophage-dependent elastolytic activity and aneurysm formation in vivo.",
"journal": "The Journal of biological chemistry",
"date": "2009",
"authors": "Xiong W, Knispel R, MacTaggart J, Greiner TC, Weiss SJ, Baxter BT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "19010778",
"url": "https://glygen.org/publication/PubMed/19010778"
}
]
},
{
"title": "Response to a novel multitargeted tyrosine kinase inhibitor pazopanib in metastatic Merkel cell carcinoma.",
"journal": "Journal of clinical oncology : official journal of the American Society of Clinical Oncology",
"date": "2009",
"authors": "Davids MS, Charlton A, Ng SS, Chong ML, Laubscher K, Dar M, Hodge J, Soong R, Goh BC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797"
}
],
"reference": [
{
"type": "PubMed",
"id": "19564526",
"url": "https://glygen.org/publication/PubMed/19564526"
}
]
},
{
"title": "MT1-MMP-mediated cleavage of decorin in corneal angiogenesis.",
"journal": "Journal of vascular research",
"date": "2009",
"authors": "Mimura T, Han KY, Onguchi T, Chang JH, Kim TI, Kojima T, Zhou Z, Azar DT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "19571574",
"url": "https://glygen.org/publication/PubMed/19571574"
}
]
},
{
"title": "Identification of a novel HtrA1-susceptible cleavage site in human aggrecan: evidence for the involvement of HtrA1 in aggrecan proteolysis in vivo.",
"journal": "The Journal of biological chemistry",
"date": "2009",
"authors": "Chamberland A, Wang E, Jones AR, Collins-Racie LA, LaVallie ER, Huang Y, Liu L, Morris EA, Flannery CR, Yang Z",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "19657146",
"url": "https://glygen.org/publication/PubMed/19657146"
}
]
},
{
"title": "Regulation of histidine-rich glycoprotein (HRG) function via plasmin-mediated proteolytic cleavage.",
"journal": "Biochem. J.",
"date": "2009",
"authors": "Poon IK, Olsson AK, Hulett MD, Parish CR",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "19712047",
"url": "https://glygen.org/publication/PubMed/19712047"
}
]
},
{
"title": "ADAM-8 isolated from human osteoarthritic chondrocytes cleaves fibronectin at Ala(271).",
"journal": "Arthritis and rheumatism",
"date": "2009",
"authors": "Zack MD, Malfait AM, Skepner AP, Yates MP, Griggs DW, Hall T, Hills RL, Alston JT, Nemirovskiy OV, Radabaugh MR, Leone JW, Arner EC, Tortorella MD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "19714641",
"url": "https://glygen.org/publication/PubMed/19714641"
}
]
},
{
"title": "Two types of abnormal genes for plasminogen in families with a predisposition for thrombosis.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1991",
"authors": "Ichinose A, Espling ES, Takamatsu J, Saito H, Shinmyozu K, Maruyama I, Petersen TE, Davie EW",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "1986355",
"url": "https://glygen.org/publication/PubMed/1986355"
}
]
},
{
"title": "Matrix metalloproteinase-19 is highly expressed in astroglial tumors and promotes invasion of glioma cells.",
"journal": "Journal of neuropathology and experimental neurology",
"date": "2010",
"authors": "Lettau I, Hattermann K, Held-Feindt J, Brauer R, Sedlacek R, Mentlein R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "20142769",
"url": "https://glygen.org/publication/PubMed/20142769"
}
]
},
{
"title": "Asparagine-linked oligosaccharide processing in lepidopteran insect cells. Temporal dependence of the nature of the oligosaccharides assembled on asparagine-289 of recombinant human plasminogen produced in baculovirus vector infected Spodoptera frugiperda (IPLB-SF-21AE) cells.",
"journal": "Biochemistry",
"date": "1991",
"authors": "Davidson DJ, Castellino FJ",
"evidence": [
{
"database": "UniCarbKB",
"id": "P00747",
"url": ""
},
{
"database": "GlyConnect",
"id": "502",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
}
],
"reference": [
{
"type": "PubMed",
"id": "2059624",
"url": "https://glygen.org/publication/PubMed/2059624"
}
]
},
{
"title": "Structures of the asparagine-289-linked oligosaccharides assembled on recombinant human plasminogen expressed in a Mamestra brassicae cell line (IZD-MBO503).",
"journal": "Biochemistry",
"date": "1991",
"authors": "Davidson DJ, Castellino FJ",
"evidence": [
{
"database": "UniCarbKB",
"id": "P00747",
"url": ""
},
{
"database": "GlyConnect",
"id": "502",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
}
],
"reference": [
{
"type": "PubMed",
"id": "2065054",
"url": "https://glygen.org/publication/PubMed/2065054"
}
]
},
{
"title": "Targeting the {alpha} receptor for platelet-derived growth factor as a primary or combination therapy in a preclinical model of prostate cancer skeletal metastasis.",
"journal": "Clinical cancer research : an official journal of the American Association for Cancer Research",
"date": "2010",
"authors": "Russell MR, Liu Q, Fatatis A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797"
}
],
"reference": [
{
"type": "PubMed",
"id": "20813817",
"url": "https://glygen.org/publication/PubMed/20813817"
}
]
},
{
"title": "Expanding members and roles of the calpain superfamily and their genetically modified animals.",
"journal": "Experimental animals",
"date": "2010",
"authors": "Sorimachi H, Hata S, Ono Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "21030783",
"url": "https://glygen.org/publication/PubMed/21030783"
}
]
},
{
"title": "Inhibition of PDGF, TGF-beta, and Abl signaling and reduction of liver fibrosis by the small molecule Bcr-Abl tyrosine kinase antagonist Nilotinib.",
"journal": "Journal of hepatology",
"date": "2011",
"authors": "Liu Y, Wang Z, Kwong SQ, Lui ELH, Friedman SL, Li FR, Lam RWC, Zhang GC, Zhang H, Ye T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797"
}
],
"reference": [
{
"type": "PubMed",
"id": "21251937",
"url": "https://glygen.org/publication/PubMed/21251937"
}
]
},
{
"title": "Substrate-induced remodeling of the active site regulates human HTRA1 activity.",
"journal": "Nature structural & molecular biology",
"date": "2011",
"authors": "Truebestein L, Tennstaedt A, Monig T, Krojer T, Canellas F, Kaiser M, Clausen T, Ehrmann M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "21297635",
"url": "https://glygen.org/publication/PubMed/21297635"
}
]
},
{
"title": "Activation of multiple proto-oncogenic tyrosine kinases in breast cancer via loss of the PTPN12 phosphatase.",
"journal": "Cell",
"date": "2011",
"authors": "Sun T, Aceto N, Meerbrey KL, Kessler JD, Zhou C, Migliaccio I, Nguyen DX, Pavlova NN, Botero M, Huang J, Bernardi RJ, Schmitt E, Hu G, Li MZ, Dephoure N, Gygi SP, Rao M, Creighton CJ, Hilsenbeck SG, Shaw CA, Muzny D, Gibbs RA, Wheeler DA, Osborne CK, Schiff R, Bentires-Alj M, Elledge SJ, Westbrook TF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797"
}
],
"reference": [
{
"type": "PubMed",
"id": "21376233",
"url": "https://glygen.org/publication/PubMed/21376233"
}
]
},
{
"title": "A unique proteolytic fragment of human fibrinogen containing the A alpha COOH-terminal domain of the native molecule.",
"journal": "J. Biol. Chem.",
"date": "1990",
"authors": "Kirschbaum NE, Budzynski AZ",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "2143188",
"url": "https://glygen.org/publication/PubMed/2143188"
}
]
},
{
"title": "SCUBE3 is an endogenous TGF-beta receptor ligand and regulates the epithelial-mesenchymal transition in lung cancer.",
"journal": "Oncogene",
"date": "2011",
"authors": "Wu YY, Peck K, Chang YL, Pan SH, Cheng YF, Lin JC, Yang RB, Hong TM, Yang PC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "21441952",
"url": "https://glygen.org/publication/PubMed/21441952"
}
]
},
{
"title": "The human receptor for urokinase plasminogen activator. NH2-terminal amino acid sequence and glycosylation variants.",
"journal": "The Journal of biological chemistry",
"date": "1990",
"authors": "Behrendt N, Ronne E, Ploug M, Petri T, Lober D, Nielsen LS, Schleuning WD, Blasi F, Appella E, Dano K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-75205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205"
}
],
"reference": [
{
"type": "PubMed",
"id": "2156852",
"url": "https://glygen.org/publication/PubMed/2156852"
}
]
},
{
"title": "Solution structure of the kringle 4 domain from human plasminogen by 1H nuclear magnetic resonance spectroscopy and distance geometry.",
"journal": "J. Mol. Biol.",
"date": "1990",
"authors": "Atkinson R A, Williams R J",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "2157850",
"url": "https://glygen.org/publication/PubMed/2157850"
}
]
},
{
"title": "Characterization and activation of procollagenase from human polymorphonuclear leucocytes. N-terminal sequence determination of the proenzyme and various proteolytically activated forms.",
"journal": "European journal of biochemistry",
"date": "1990",
"authors": "Knauper V, Kramer S, Reinke H, Tschesche H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "2159879",
"url": "https://glygen.org/publication/PubMed/2159879"
}
]
},
{
"title": "The receptor for urokinase type plasminogen activator polarizes expression of the protease to the leading edge of migrating monocytes and promotes degradation of enzyme inhibitor complexes.",
"journal": "The Journal of cell biology",
"date": "1990",
"authors": "Estreicher A, Muhlhauser J, Carpentier JL, Orci L, Vassalli JD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-75205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205"
}
],
"reference": [
{
"type": "PubMed",
"id": "2166055",
"url": "https://glygen.org/publication/PubMed/2166055"
}
]
},
{
"title": "Calpain chronicle--an enzyme family under multidisciplinary characterization.",
"journal": "Proceedings of the Japan Academy. Series B, Physical and biological sciences",
"date": "2011",
"authors": "Sorimachi H, Hata S, Ono Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "21670566",
"url": "https://glygen.org/publication/PubMed/21670566"
}
]
},
{
"title": "The role of matrix metalloproteinase 3 in the stepwise activation of human rheumatoid synovial procollagenase.",
"journal": "Biological chemistry Hoppe-Seyler",
"date": "1990",
"authors": "Suzuki K, Nagase H, Ito A, Enghild JJ, Salvesen G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "2169257",
"url": "https://glygen.org/publication/PubMed/2169257"
}
]
},
{
"title": "Mechanisms of activation of tissue procollagenase by matrix metalloproteinase 3 (stromelysin).",
"journal": "Biochemistry",
"date": "1990",
"authors": "Suzuki K, Enghild JJ, Morodomi T, Salvesen G, Nagase H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "2176865",
"url": "https://glygen.org/publication/PubMed/2176865"
}
]
},
{
"title": "Classical and neonatal Marfan syndrome mutations in fibrillin-1 cause differential protease susceptibilities and protein function.",
"journal": "The Journal of biological chemistry",
"date": "2011",
"authors": "Kirschner R, Hubmacher D, Iyengar G, Kaur J, Fagotto-Kaufmann C, Bromme D, Bartels R, Reinhardt DP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "21784848",
"url": "https://glygen.org/publication/PubMed/21784848"
}
]
},
{
"title": "Calpains: an elaborate proteolytic system.",
"journal": "Biochimica et biophysica acta",
"date": "2012",
"authors": "Ono Y, Sorimachi H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "21864727",
"url": "https://glygen.org/publication/PubMed/21864727"
}
]
},
{
"title": "Plasmodium ookinetes coopt mammalian plasminogen to invade the mosquito midgut.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2011",
"authors": "Ghosh AK, Coppens I, Gardsvoll H, Ploug M, Jacobs-Lorena M",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "21949403",
"url": "https://glygen.org/publication/PubMed/21949403"
}
]
},
{
"title": "MT1-MMP regulates the turnover and endocytosis of extracellular matrix fibronectin.",
"journal": "Journal of cell science",
"date": "2011",
"authors": "Shi F, Sottile J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "22159414",
"url": "https://glygen.org/publication/PubMed/22159414"
}
]
},
{
"title": "OspC is potent plasminogen receptor on surface of Borrelia burgdorferi.",
"journal": "The Journal of biological chemistry",
"date": "2012-05-11",
"authors": "\u00d6nder \u00d6zlem, Humphrey Parris T, McOmber Brian, Korobova Farida, Francella Nicholas, Greenbaum Doron C, Brisson Dustin",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "22433849",
"url": "https://glygen.org/publication/PubMed/22433849"
}
]
},
{
"title": "Matrix metalloproteinase 2 from human rheumatoid synovial fibroblasts. Purification and activation of the precursor and enzymic properties.",
"journal": "European journal of biochemistry",
"date": "1990",
"authors": "Okada Y, Morodomi T, Enghild JJ, Suzuki K, Yasui A, Nakanishi I, Salvesen G, Nagase H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "2269296",
"url": "https://glygen.org/publication/PubMed/2269296"
}
]
},
{
"title": "Stromal platelet-derived growth factor receptor alpha (PDGFRalpha) provides a therapeutic target independent of tumor cell PDGFRalpha expression in lung cancer xenografts.",
"journal": "Molecular cancer therapeutics",
"date": "2012",
"authors": "Gerber DE, Gupta P, Dellinger MT, Toombs JE, Peyton M, Duignan I, Malaby J, Bailey T, Burns C, Brekken RA, Loizos N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797"
}
],
"reference": [
{
"type": "PubMed",
"id": "22933705",
"url": "https://glygen.org/publication/PubMed/22933705"
}
]
},
{
"title": "Structure-function relationships in calpains.",
"journal": "The Biochemical journal",
"date": "2012",
"authors": "Campbell RL, Davies PL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "23035980",
"url": "https://glygen.org/publication/PubMed/23035980"
}
]
},
{
"title": "Quantification of the N-glycosylated secretome by super-SILAC during breast cancer progression and in human blood samples.",
"journal": "Molecular & cellular proteomics : MCP",
"date": "2013",
"authors": "Boersema PJ, Geiger T, Wisniewski JR, Mann M",
"evidence": [
{
"database": "GlyGen",
"id": "GLY_000143",
"url": "https://data.glygen.org/GLY_000143"
}
],
"reference": [
{
"type": "PubMed",
"id": "23090970",
"url": "https://glygen.org/publication/PubMed/23090970"
}
]
},
{
"title": "Characterization of the gene for human plasminogen, a key proenzyme in the fibrinolytic system.",
"journal": "J. Biol. Chem.",
"date": "1990",
"authors": "Petersen TE, Martzen MR, Ichinose A, Davie EW",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
},
{
"database": "Reactome",
"id": "R-HSA-75205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205"
}
],
"reference": [
{
"type": "PubMed",
"id": "2318848",
"url": "https://glygen.org/publication/PubMed/2318848"
}
]
},
{
"title": "The annexin A2/S100A10 system in health and disease: emerging paradigms.",
"journal": "Journal of biomedicine & biotechnology",
"date": "2012",
"authors": "Hedhli N, Falcone DJ, Huang B, Cesarman-Maus G, Kraemer R, Zhai H, Tsirka SE, Santambrogio L, Hajjar KA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-75205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205"
}
],
"reference": [
{
"type": "PubMed",
"id": "23193360",
"url": "https://glygen.org/publication/PubMed/23193360"
}
]
},
{
"title": "Glycerol-3-phosphate dehydrogenase 2 is a novel factor H-, factor H-like protein 1-, and plasminogen-binding surface protein of Candida albicans.",
"journal": "J. Infect. Dis.",
"date": "2013",
"authors": "Luo Shanshan, Hoffmann Ralf, Skerka Christine, Zipfel Peter F",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "23204165",
"url": "https://glygen.org/publication/PubMed/23204165"
}
]
},
{
"title": "The structure of human microplasmin in complex with textilinin-1, an aprotinin-like inhibitor from the Australian brown snake.",
"journal": "PLoS ONE",
"date": "2013",
"authors": "Millers Emma-Karin I, Johnson Lambro A, Birrell Geoff W, Masci Paul P, Lavin Martin F, de Jersey John, Guddat Luke W",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "23335990",
"url": "https://glygen.org/publication/PubMed/23335990"
}
]
},
{
"title": "Annexin A2 system in human biology: cell surface and beyond.",
"journal": "Seminars in thrombosis and hemostasis",
"date": "2013",
"authors": "Luo M, Hajjar KA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-75205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205"
}
],
"reference": [
{
"type": "PubMed",
"id": "23483454",
"url": "https://glygen.org/publication/PubMed/23483454"
}
]
},
{
"title": "Pazopanib inhibits the activation of PDGFRbeta-expressing astrocytes in the brain metastatic microenvironment of breast cancer cells.",
"journal": "The American journal of pathology",
"date": "2013",
"authors": "Gril B, Palmieri D, Qian Y, Anwar T, Liewehr DJ, Steinberg SM, Andreu Z, Masana D, Fernandez P, Steeg PS, Vidal-Vanaclocha F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797"
}
],
"reference": [
{
"type": "PubMed",
"id": "23583652",
"url": "https://glygen.org/publication/PubMed/23583652"
}
]
},
{
"title": "High precision platelet releasate definition by quantitative reversed protein profiling--brief report.",
"journal": "Arteriosclerosis, thrombosis, and vascular biology",
"date": "2013",
"authors": "Wijten P, van Holten T, Woo LL, Bleijerveld OB, Roest M, Heck AJ, Scholten A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-114608",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608"
}
],
"reference": [
{
"type": "PubMed",
"id": "23640497",
"url": "https://glygen.org/publication/PubMed/23640497"
}
]
},
{
"title": "Stepwise activation mechanisms of the precursor of matrix metalloproteinase 3 (stromelysin) by proteinases and (4-aminophenyl)mercuric acetate.",
"journal": "Biochemistry",
"date": "1990",
"authors": "Nagase H, Enghild JJ, Suzuki K, Salvesen G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "2383557",
"url": "https://glygen.org/publication/PubMed/2383557"
}
]
},
{
"title": "Characterization of opticin digestion by proteases involved in osteoarthritis development.",
"journal": "Joint, bone, spine : revue du rhumatisme",
"date": "2014",
"authors": "Tio L, Martel-Pelletier J, Pelletier JP, Bishop PN, Roughley P, Farran A, Benito P, Monfort J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "23845380",
"url": "https://glygen.org/publication/PubMed/23845380"
}
]
},
{
"title": "Oligosaccharide processing in the expression of human plasminogen cDNA by lepidopteran insect (Spodoptera frugiperda) cells.",
"journal": "Biochemistry",
"date": "1990",
"authors": "Davidson DJ, Fraser MJ, Castellino FJ",
"evidence": [
{
"database": "UniCarbKB",
"id": "P00747",
"url": ""
},
{
"database": "GlyConnect",
"id": "502",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
}
],
"reference": [
{
"type": "PubMed",
"id": "2386787",
"url": "https://glygen.org/publication/PubMed/2386787"
}
]
},
{
"title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.",
"journal": "Journal of proteomics",
"date": "2014",
"authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
},
{
"database": "iPTMnet",
"id": "P00747",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "24275569",
"url": "https://glygen.org/publication/PubMed/24275569"
}
]
},
{
"title": "Amino-acid sequence of human alpha 2-antiplasmin.",
"journal": "European journal of biochemistry",
"date": "1987",
"authors": "Lijnen HR, Holmes WE, van Hoef B, Wiman B, Rodriguez H, Collen D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-75205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205"
}
],
"reference": [
{
"type": "PubMed",
"id": "2440681",
"url": "https://glygen.org/publication/PubMed/2440681"
}
]
},
{
"title": "Structure of the Mr 140,000 growth hormone-dependent insulin-like growth factor binding protein complex: determination by reconstitution and affinity-labeling.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1989",
"authors": "Baxter RC, Martin JL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "2476804",
"url": "https://glygen.org/publication/PubMed/2476804"
}
]
},
{
"title": "Cloning, sequence analysis and expression of a cDNA encoding a novel insulin-like growth factor binding protein (IGFBP-2).",
"journal": "The EMBO journal",
"date": "1989",
"authors": "Binkert C, Landwehr J, Mary JL, Schwander J, Heinrich G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "2479552",
"url": "https://glygen.org/publication/PubMed/2479552"
}
]
},
{
"title": "Discovery of the Fibrinolysis Inhibitor AZD6564, Acting via Interference of a Protein-Protein Interaction.",
"journal": "ACS medicinal chemistry letters",
"date": "2014",
"authors": "Cheng L, Pettersen D, Ohlsson B, Schell P, Karle M, Evertsson E, Pahlen S, Jonforsen M, Plowright AT, Bostrom J, Fex T, Thelin A, Hilgendorf C, Xue Y, Wahlund G, Lindberg W, Larsson LO, Gustafsson D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-75205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205"
}
],
"reference": [
{
"type": "PubMed",
"id": "24900876",
"url": "https://glygen.org/publication/PubMed/24900876"
}
]
},
{
"title": "The single-chain form of tissue-type plasminogen activator has catalytic activity: studies with a mutant enzyme that lacks the cleavage site.",
"journal": "Biochemistry",
"date": "1989",
"authors": "Boose JA, Kuismanen E, Gerard R, Sambrook J, Gething MJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-75205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205"
}
],
"reference": [
{
"type": "PubMed",
"id": "2496749",
"url": "https://glygen.org/publication/PubMed/2496749"
}
]
},
{
"title": "Interaction between plasminogen activator inhibitor type 1 (PAI-1) bound to fibrin and either tissue-type plasminogen activator (t-PA) or urokinase-type plasminogen activator (u-PA). Binding of t-PA/PAI-1 complexes to fibrin mediated by both the finger and the kringle-2 domain of t-PA.",
"journal": "The Journal of clinical investigation",
"date": "1989",
"authors": "Wagner OF, de Vries C, Hohmann C, Veerman H, Pannekoek H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-75205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205"
}
],
"reference": [
{
"type": "PubMed",
"id": "2503541",
"url": "https://glygen.org/publication/PubMed/2503541"
}
]
},
{
"title": "Plasminogen activation initiated by single-chain urokinase-type plasminogen activator. Potentiation by U937 monocytes.",
"journal": "The Journal of biological chemistry",
"date": "1989",
"authors": "Ellis V, Scully MF, Kakkar VV",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-75205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205"
}
],
"reference": [
{
"type": "PubMed",
"id": "2521625",
"url": "https://glygen.org/publication/PubMed/2521625"
}
]
},
{
"title": "Crenolanib, a PDGFR inhibitor, suppresses lung cancer cell proliferation and inhibits tumor growth in vivo.",
"journal": "OncoTargets and therapy",
"date": "2014",
"authors": "Wang P, Song L, Ge H, Jin P, Jiang Y, Hu W, Geng N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797"
}
],
"reference": [
{
"type": "PubMed",
"id": "25328409",
"url": "https://glygen.org/publication/PubMed/25328409"
}
]
},
{
"title": "Accessibility of receptor-bound urokinase to type-1 plasminogen activator inhibitor.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1989",
"authors": "Cubellis MV, Andreasen P, Ragno P, Mayer M, Dano K, Blasi F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-75205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205"
}
],
"reference": [
{
"type": "PubMed",
"id": "2544876",
"url": "https://glygen.org/publication/PubMed/2544876"
}
]
},
{
"title": "Activation of neutrophil collagenase by cathepsin G.",
"journal": "Inflammation",
"date": "1989",
"authors": "Capodici C, Muthukumaran G, Amoruso MA, Berg RA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "2546891",
"url": "https://glygen.org/publication/PubMed/2546891"
}
]
},
{
"title": "SV40-transformed human lung fibroblasts secrete a 92-kDa type IV collagenase which is identical to that secreted by normal human macrophages.",
"journal": "The Journal of biological chemistry",
"date": "1989",
"authors": "Wilhelm SM, Collier IE, Marmer BL, Eisen AZ, Grant GA, Goldberg GI",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "2551898",
"url": "https://glygen.org/publication/PubMed/2551898"
}
]
},
{
"title": "Tissue kallikrein effectively activates latent matrix degrading metalloenzymes.",
"journal": "Advances in experimental medicine and biology",
"date": "1989",
"authors": "Tschesche H, Michaelis J, Kohnert U, Fedrowitz J, Oberhoff R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "2557753",
"url": "https://glygen.org/publication/PubMed/2557753"
}
]
},
{
"title": "The FLT3 and PDGFR inhibitor crenolanib is a substrate of the multidrug resistance protein ABCB1 but does not inhibit transport function at pharmacologically relevant concentrations.",
"journal": "Investigational new drugs",
"date": "2015",
"authors": "Mathias TJ, Natarajan K, Shukla S, Doshi KA, Singh ZN, Ambudkar SV, Baer MR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797"
}
],
"reference": [
{
"type": "PubMed",
"id": "25597754",
"url": "https://glygen.org/publication/PubMed/25597754"
}
]
},
{
"title": "A Single Kinase Generates the Majority of the Secreted Phosphoproteome.",
"journal": "Cell",
"date": "2015",
"authors": "Tagliabracci VS, Wiley SE, Guo X, Kinch LN, Durrant E, Wen J, Xiao J, Cui J, Nguyen KB, Engel JL, Coon JJ, Grishin N, Pinna LA, Pagliarini DJ, Dixon JE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "26091039",
"url": "https://glygen.org/publication/PubMed/26091039"
}
]
},
{
"title": "Site-specific O-Glycosylation Analysis of Human Blood Plasma Proteins.",
"journal": "Molecular & cellular proteomics : MCP",
"date": "2016",
"authors": "Hoffmann M, Marx K, Reichl U, Wuhrer M, Rapp E",
"evidence": [
{
"database": "UniCarbKB",
"id": "P00747",
"url": ""
}
],
"reference": [
{
"type": "PubMed",
"id": "26598643",
"url": "https://glygen.org/publication/PubMed/26598643"
}
]
},
{
"title": "Molecular Interactions of human plasminogen with fibronectin-binding Protein B (FnBPB), a fibrinogen/fibronectin-binding protein from Staphylococcus aureus.",
"journal": "J. Biol. Chem.",
"date": "2016",
"authors": "Pietrocola Giampiero, Nobile Giulia, Gianotti Valentina, Zapotoczna Marta, Foster Timothy J, Geoghegan Joan A, Speziale Pietro",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "27387503",
"url": "https://glygen.org/publication/PubMed/27387503"
}
]
},
{
"title": "Plasmin(ogen) serves as a favorable biomarker for prediction of survival in advanced high-grade serous ovarian cancer.",
"journal": "Biological chemistry",
"date": "2017",
"authors": "Zhao S, Dorn J, Napieralski R, Walch A, Diersch S, Kotzsch M, Ahmed N, Hooper JD, Kiechle M, Schmitt M, Magdolen V",
"evidence": [
{
"database": "GlyGen",
"id": "A0310",
"url": "https://data.glygen.org/GLY_000625"
}
],
"reference": [
{
"type": "PubMed",
"id": "27935848",
"url": "https://glygen.org/publication/PubMed/27935848"
}
]
},
{
"title": "Proteomics Analysis of O-GalNAc Glycosylation in Human Serum by an Integrated Strategy.",
"journal": "Analytical chemistry",
"date": "2017",
"authors": "Qin H, Cheng K, Zhu J, Mao J, Wang F, Dong M, Chen R, Guo Z, Liang X, Ye M, Zou H",
"evidence": [
{
"database": "UniCarbKB",
"id": "P00747",
"url": ""
}
],
"reference": [
{
"type": "PubMed",
"id": "28035807",
"url": "https://glygen.org/publication/PubMed/28035807"
}
]
},
{
"title": "Inhibition of the platelet-derived growth factor receptor beta (PDGFRB) using gene silencing, crenolanib besylate, or imatinib mesylate hampers the malignant phenotype of mesothelioma cell lines.",
"journal": "Genes & cancer",
"date": "2017",
"authors": "Melaiu O, Catalano C, De Santi C, Cipollini M, Figlioli G, Pelle L, Barone E, Evangelista M, Guazzelli A, Boldrini L, Sensi E, Bonotti A, Foddis R, Cristaudo A, Mutti L, Fontanini G, Gemignani F, Landi S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797"
}
],
"reference": [
{
"type": "PubMed",
"id": "28435517",
"url": "https://glygen.org/publication/PubMed/28435517"
}
]
},
{
"title": "Hereditary angioedema with a mutation in the plasminogen gene.",
"journal": "Allergy",
"date": "2018",
"authors": "Bork K, Wulff K, Steinmuller-Magin L, Braenne I, Staubach-Renz P, Witzke G, Hardt J",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "28795768",
"url": "https://glygen.org/publication/PubMed/28795768"
}
]
},
{
"title": "A precision therapy against cancers driven by KIT/PDGFRA mutations.",
"journal": "Science translational medicine",
"date": "2017",
"authors": "Evans EK, Gardino AK, Kim JL, Hodous BL, Shutes A, Davis A, Zhu XJ, Schmidt-Kittler O, Wilson D, Wilson K, DiPietro L, Zhang Y, Brooijmans N, LaBranche TP, Wozniak A, Gebreyohannes YK, Schoffski P, Heinrich MC, DeAngelo DJ, Miller S, Wolf B, Kohl N, Guzi T, Lydon N, Boral A, Lengauer C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797"
}
],
"reference": [
{
"type": "PubMed",
"id": "29093181",
"url": "https://glygen.org/publication/PubMed/29093181"
}
]
},
{
"title": "The PDGF/PDGFR pathway as a drug target.",
"journal": "Molecular aspects of medicine",
"date": "2018",
"authors": "Papadopoulos N, Lennartsson J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797"
}
],
"reference": [
{
"type": "PubMed",
"id": "29137923",
"url": "https://glygen.org/publication/PubMed/29137923"
}
]
},
{
"title": "Triple Angiokinase Inhibitor Nintedanib Directly Inhibits Tumor Cell Growth and Induces Tumor Shrinkage via Blocking Oncogenic Receptor Tyrosine Kinases.",
"journal": "The Journal of pharmacology and experimental therapeutics",
"date": "2018",
"authors": "Hilberg F, Tontsch-Grunt U, Baum A, Le AT, Doebele RC, Lieb S, Gianni D, Voss T, Garin-Chesa P, Haslinger C, Kraut N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797"
}
],
"reference": [
{
"type": "PubMed",
"id": "29263244",
"url": "https://glygen.org/publication/PubMed/29263244"
}
]
},
{
"title": "Activation of plasminogen by pro-urokinase. I. Mechanism.",
"journal": "The Journal of biological chemistry",
"date": "1986",
"authors": "Lijnen HR, Zamarron C, Blaber M, Winkler ME, Collen D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-75205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205"
}
],
"reference": [
{
"type": "PubMed",
"id": "2935528",
"url": "https://glygen.org/publication/PubMed/2935528"
}
]
},
{
"title": "Large-scale intact glycopeptide identification by Mascot database search.",
"journal": "Scientific reports",
"date": "2018",
"authors": "Bollineni RC, Koehler CJ, Gislefoss RE, Anonsen JH, Thiede B",
"evidence": [
{
"database": "GlyConnect",
"id": "502",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
}
],
"reference": [
{
"type": "PubMed",
"id": "29391424",
"url": "https://glygen.org/publication/PubMed/29391424"
}
]
},
{
"title": "The role of small molecule platelet-derived growth factor receptor (PDGFR) inhibitors in the treatment of neoplastic disorders.",
"journal": "Pharmacological research",
"date": "2018",
"authors": "Roskoski R Jr",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797"
}
],
"reference": [
{
"type": "PubMed",
"id": "29408302",
"url": "https://glygen.org/publication/PubMed/29408302"
}
]
},
{
"title": "A missense mutation in the plasminogen gene, within the plasminogen kringle 3 domain, in hereditary angioedema with normal C1 inhibitor.",
"journal": "Biochemical and biophysical research communications",
"date": "2018",
"authors": "Dewald G",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "29548426",
"url": "https://glygen.org/publication/PubMed/29548426"
}
]
},
{
"title": "Interaction of one-chain and two-chain tissue plasminogen activator with intact and plasmin-degraded fibrin.",
"journal": "Biochemistry",
"date": "1987",
"authors": "Higgins DL, Vehar GA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-75205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205"
}
],
"reference": [
{
"type": "PubMed",
"id": "2962641",
"url": "https://glygen.org/publication/PubMed/2962641"
}
]
},
{
"title": "Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and alpha-1B-Glycoprotein.",
"journal": "Analytical chemistry",
"date": "2018",
"authors": "Sun S, Hu Y, Jia L, Eshghi ST, Liu Y, Shah P, Zhang H",
"evidence": [
{
"database": "UniCarbKB",
"id": "P00747",
"url": ""
},
{
"database": "GlyConnect",
"id": "502",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
}
],
"reference": [
{
"type": "PubMed",
"id": "29671580",
"url": "https://glygen.org/publication/PubMed/29671580"
}
]
},
{
"title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.",
"journal": "Analytical chemistry",
"date": "2018",
"authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H",
"evidence": [
{
"database": "GlyConnect",
"id": "502",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
}
],
"reference": [
{
"type": "PubMed",
"id": "29741879",
"url": "https://glygen.org/publication/PubMed/29741879"
}
]
},
{
"title": "Plasminogen gene mutation with normal C1 inhibitor hereditary angioedema: Three additional French families.",
"journal": "Allergy",
"date": "2018",
"authors": "Belbezier A, Hardy G, Marlu R, Defendi F, Dumestre Perard C, Boccon-Gibod I, Launay D, Bouillet L",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "29952006",
"url": "https://glygen.org/publication/PubMed/29952006"
}
]
},
{
"title": "Structural and clinical consequences of activation loop mutations in class III receptor tyrosine kinases.",
"journal": "Pharmacology & therapeutics",
"date": "2018",
"authors": "Klug LR, Kent JD, Heinrich MC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797"
}
],
"reference": [
{
"type": "PubMed",
"id": "29964125",
"url": "https://glygen.org/publication/PubMed/29964125"
}
]
},
{
"title": "A missense mutation of the plasminogen gene in hereditary angioedema with normal C1 inhibitor in Japan.",
"journal": "Allergy",
"date": "2018",
"authors": "Yakushiji H, Hashimura C, Fukuoka K, Kaji A, Miyahara H, Kaname S, Horiuchi T",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "29987869",
"url": "https://glygen.org/publication/PubMed/29987869"
}
]
},
{
"title": "Amino acid sequence of human histidine-rich glycoprotein derived from the nucleotide sequence of its cDNA.",
"journal": "Biochemistry",
"date": "1986",
"authors": "Koide T, Foster D, Yoshitake S, Davie EW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-75205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205"
}
],
"reference": [
{
"type": "PubMed",
"id": "3011081",
"url": "https://glygen.org/publication/PubMed/3011081"
}
]
},
{
"title": "Binding of single-chain prourokinase to the urokinase receptor of human U937 cells.",
"journal": "The Journal of biological chemistry",
"date": "1986",
"authors": "Cubellis MV, Nolli ML, Cassani G, Blasi F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-75205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205"
}
],
"reference": [
{
"type": "PubMed",
"id": "3023326",
"url": "https://glygen.org/publication/PubMed/3023326"
}
]
},
{
"title": "Molecular cloning and characterization of a full-length cDNA clone for human plasminogen.",
"journal": "FEBS Lett.",
"date": "1987",
"authors": "Forsgren M, R\u00e5den B, Israelsson M, Larsson K, Hed\u00e9n L O",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "3030813",
"url": "https://glygen.org/publication/PubMed/3030813"
}
]
},
{
"title": "Neomorphic PDGFRA extracellular domain driver mutations are resistant to PDGFRA targeted therapies.",
"journal": "Nature communications",
"date": "2018",
"authors": "Ip CKM, Ng PKS, Jeong KJ, Shao SH, Ju Z, Leonard PG, Hua X, Vellano CP, Woessner R, Sahni N, Scott KL, Mills GB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797"
}
],
"reference": [
{
"type": "PubMed",
"id": "30389923",
"url": "https://glygen.org/publication/PubMed/30389923"
}
]
},
{
"title": "Mapping the O-glycoproteome using site-specific extraction of O-linked glycopeptides (EXoO).",
"journal": "Molecular systems biology",
"date": "2018",
"authors": "Yang W, Ao M, Hu Y, Li QK, Zhang H",
"evidence": [
{
"database": "UniCarbKB",
"id": "P00747",
"url": ""
}
],
"reference": [
{
"type": "PubMed",
"id": "30459171",
"url": "https://glygen.org/publication/PubMed/30459171"
}
]
},
{
"title": "The precursor of a metalloendopeptidase from human rheumatoid synovial fibroblasts. Purification and mechanisms of activation by endopeptidases and 4-aminophenylmercuric acetate.",
"journal": "The Biochemical journal",
"date": "1988",
"authors": "Okada Y, Harris ED Jr, Nagase H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "3058116",
"url": "https://glygen.org/publication/PubMed/3058116"
}
]
},
{
"title": "Purification and characterization of a plasminogen activator inhibitor from the histiocytic lymphoma cell line U-937.",
"journal": "The Journal of biological chemistry",
"date": "1986",
"authors": "Kruithof EK, Vassalli JD, Schleuning WD, Mattaliano RJ, Bachmann F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-75205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205"
}
],
"reference": [
{
"type": "PubMed",
"id": "3090045",
"url": "https://glygen.org/publication/PubMed/3090045"
}
]
},
{
"title": "Ripretinib (DCC-2618) Is a Switch Control Kinase Inhibitor of a Broad Spectrum of Oncogenic and Drug-Resistant KIT and PDGFRA Variants.",
"journal": "Cancer cell",
"date": "2019",
"authors": "Smith BD, Kaufman MD, Lu WP, Gupta A, Leary CB, Wise SC, Rutkoski TJ, Ahn YM, Al-Ani G, Bulfer SL, Caldwell TM, Chun L, Ensinger CL, Hood MM, McKinley A, Patt WC, Ruiz-Soto R, Su Y, Telikepalli H, Town A, Turner BA, Vogeti L, Vogeti S, Yates K, Janku F, Abdul Razak AR, Rosen O, Heinrich MC, Flynn DL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797"
}
],
"reference": [
{
"type": "PubMed",
"id": "31085175",
"url": "https://glygen.org/publication/PubMed/31085175"
}
]
},
{
"title": "Deciphering the Genetics of Primary Angioedema with Normal Levels of C1 Inhibitor.",
"journal": "Journal of clinical medicine",
"date": "2020",
"authors": "Loules G, Parsopoulou F, Zamanakou M, Csuka D, Bova M, Gonzalez-Quevedo T, Psarros F, Porebski G, Speletas M, Firinu D, Del Giacco S, Suffritti C, Makris M, Vatsiou S, Zanichelli A, Farkas H, Germenis AE",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "33114181",
"url": "https://glygen.org/publication/PubMed/33114181"
}
]
},
{
"title": "The N- and O-linked carbohydrate chains of human, bovine and porcine plasminogen. Species specificity in relation to sialylation and fucosylation patterns.",
"journal": "European journal of biochemistry",
"date": "1988",
"authors": "Marti T, Schaller J, Rickli EE, Schmid K, Kamerling JP, Gerwig GJ, van Halbeek H, Vliegenthart JF",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747#ptm_processing"
},
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
},
{
"database": "GlyConnect",
"id": "502",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
}
],
"reference": [
{
"type": "PubMed",
"id": "3356193",
"url": "https://glygen.org/publication/PubMed/3356193"
}
]
},
{
"title": "Screening for Plasminogen Mutations in Hereditary Angioedema Patients.",
"journal": "Genes",
"date": "2021",
"authors": "Farkas H, Doczy A, Szabo E, Varga L, Csuka D",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "33799813",
"url": "https://glygen.org/publication/PubMed/33799813"
}
]
},
{
"title": "The Role of the Plasminogen/Plasmin System in Inflammation of the Oral Cavity.",
"journal": "Cells",
"date": "2023-01-30",
"authors": "Yatsenko Tetiana, Skrypnyk Maksym, Troyanovska Olga, Tobita Morikuni, Osada Taro, Takahashi Satoshi, Hattori Koichi, Heissig Beate",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000292",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000292"
}
],
"reference": [
{
"type": "PubMed",
"id": "36766787",
"url": "https://glygen.org/publication/PubMed/36766787"
}
]
},
{
"title": "Increased glutamate in type 2 diabetes in the Korean population is associated with increased plasminogen levels.",
"journal": "Journal of diabetes",
"date": "2023-09",
"authors": "Lee Hyo Jung, Yeom Jeong Won, Yun Ji Ho, Jang Han Byul, Yoo Min-Gyu, Kim Hyo-Jin, Koo Soo Kyung, Lee Hye-Ja",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000292",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000292"
}
],
"reference": [
{
"type": "PubMed",
"id": "37314019",
"url": "https://glygen.org/publication/PubMed/37314019"
}
]
},
{
"title": "Crosstalk between the plasminogen/plasmin system and inflammation resolution.",
"journal": "Journal of thrombosis and haemostasis : JTH",
"date": "2023-10",
"authors": "Perucci Luiza O, Vago Juliana P, Miles Lindsey A, Sousa Lirl\u00e2ndia P",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000292",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000292"
}
],
"reference": [
{
"type": "PubMed",
"id": "37495082",
"url": "https://glygen.org/publication/PubMed/37495082"
}
]
},
{
"title": "A dual role for ERK-1/2 in the regulation of plasmin activity and cell migration in metastatic NSCLC-H1299 cells.",
"journal": "Archives of toxicology",
"date": "2023-12",
"authors": "Zeitlmayr Sarah, Cami Ditila, Selmani Belinda, Gudermann Thomas, Breit Andreas",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000292",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000292"
}
],
"reference": [
{
"type": "PubMed",
"id": "37712947",
"url": "https://glygen.org/publication/PubMed/37712947"
}
]
},
{
"title": "Plasminogen deficiency suppresses pancreatic ductal adenocarcinoma disease progression.",
"journal": "Molecular oncology",
"date": "2024-01",
"authors": "Chowdhury Nayela N, Yang Yi, Dutta Ananya, Luo Michelle, Wei Zimu, Abrahams Sara R, Revenko Alexey S, Shah Fenil, Miles Lindsey A, Parmer Robert J, de Laat Bas, Wolberg Alisa S, Luyendyk James P, Fishel Melissa L, Flick Matthew J",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000292",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000292"
}
],
"reference": [
{
"type": "PubMed",
"id": "37971174",
"url": "https://glygen.org/publication/PubMed/37971174"
}
]
},
{
"title": "Presence of a gelatin-specific proteinase and its latent form in human leucocytes.",
"journal": "Biochimica et biophysica acta",
"date": "1974",
"authors": "Sopata I, Dancewicz AM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "4216367",
"url": "https://glygen.org/publication/PubMed/4216367"
}
]
},
{
"title": "Studies on the active center of human plasmin. Partial amino acid sequence of a peptide containing the active center serine residue.",
"journal": "J. Biol. Chem.",
"date": "1969",
"authors": "Groskopf W R, Summaria L, Robbins K C",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "4240117",
"url": "https://glygen.org/publication/PubMed/4240117"
}
]
},
{
"title": "The primary structure of human plasminogen. II. The histidine loop of human plasmin: light (B) chain active center histidine sequence.",
"journal": "J. Biol. Chem.",
"date": "1973",
"authors": "Robbins K C, Bernabe P, Arzadon L, Summaria L",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "4694729",
"url": "https://glygen.org/publication/PubMed/4694729"
}
]
},
{
"title": "Carbohydrate of the human plasminogen variants. III. Structure of the O-glycosidically linked oligosaccharide unit.",
"journal": "The Journal of biological chemistry",
"date": "1979",
"authors": "Hayes ML, Castellino FJ",
"evidence": [
{
"database": "GlyConnect",
"id": "502",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
}
],
"reference": [
{
"type": "PubMed",
"id": "479158",
"url": "https://glygen.org/publication/PubMed/479158"
}
]
},
{
"title": "The fibrin-binding site of human plasminogen. Arginines 32 and 34 are essential for fibrin affinity of the kringle 1 domain.",
"journal": "J. Biol. Chem.",
"date": "1984",
"authors": "V\u00e1li Z, Patthy L",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "6094526",
"url": "https://glygen.org/publication/PubMed/6094526"
}
]
},
{
"title": "Characterization of a complementary deoxyribonucleic acid coding for human and bovine plasminogen.",
"journal": "Biochemistry",
"date": "1984",
"authors": "Malinowski D P, Sadler J E, Davie E W",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "6148961",
"url": "https://glygen.org/publication/PubMed/6148961"
}
]
},
{
"title": "Plasminogen Tochigi: inactive plasmin resulting from replacement of alanine-600 by threonine in the active site.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1982",
"authors": "Miyata T, Iwanaga S, Sakata Y, Aoki N",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "6216475",
"url": "https://glygen.org/publication/PubMed/6216475"
}
]
},
{
"title": "Plasminogens Tochigi II and Nagoya: two additional molecular defects with Ala-600----Thr replacement found in plasmin light chain variants.",
"journal": "Journal of biochemistry",
"date": "1984",
"authors": "Miyata T, Iwanaga S, Sakata Y, Aoki N, Takamatsu J, Kamiya T",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "6238949",
"url": "https://glygen.org/publication/PubMed/6238949"
}
]
},
{
"title": "The latent collagenase and gelatinase of human polymorphonuclear neutrophil leucocytes.",
"journal": "The Biochemical journal",
"date": "1980",
"authors": "Murphy G, Bretz U, Baggiolini M, Reynolds JJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "6263256",
"url": "https://glygen.org/publication/PubMed/6263256"
}
]
},
{
"title": "Tissue plasminogen activator: peptide analyses confirm an indirectly derived amino acid sequence, identify the active site serine residue, establish glycosylation sites, and localize variant differences.",
"journal": "Biochemistry",
"date": "1984",
"authors": "Pohl G, Kallstrom M, Bergsdorf N, Wallen P, Jornvall H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-75205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205"
}
],
"reference": [
{
"type": "PubMed",
"id": "6433976",
"url": "https://glygen.org/publication/PubMed/6433976"
}
]
},
{
"title": "Isolation and characterization of a human plasma protein with affinity for the lysine binding sites in plasminogen. Role in the regulation of fibrinolysis and identification as histidine-rich glycoprotein.",
"journal": "The Journal of biological chemistry",
"date": "1980",
"authors": "Lijnen HR, Hoylaerts M, Collen D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-75205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205"
}
],
"reference": [
{
"type": "PubMed",
"id": "6448849",
"url": "https://glygen.org/publication/PubMed/6448849"
}
]
},
{
"title": "Characterization of the proteins of isolated human platelet alpha-granules. Evidence for a separate alpha-granule-pool of the glycoproteins IIb and IIIa.",
"journal": "Biochimica et biophysica acta",
"date": "1981",
"authors": "Gogstad GO, Hagen I, Korsmo R, Solum NO",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-114608",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608"
}
],
"reference": [
{
"type": "PubMed",
"id": "6457647",
"url": "https://glygen.org/publication/PubMed/6457647"
}
]
},
{
"title": "Structure of the omega-aminocarboxylic acid-binding sites of human plasminogen. Arginine 70 and aspartic acid 56 are essential for binding of ligand by kringle 4.",
"journal": "J. Biol. Chem.",
"date": "1982",
"authors": "Trexler M, V\u00e1li Z, Patthy L",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "6919539",
"url": "https://glygen.org/publication/PubMed/6919539"
}
]
},
{
"title": "Characterization of the binding domains in the fragments cleaved by cathepsin G from human plasma fibronectin.",
"journal": "European journal of biochemistry",
"date": "1982",
"authors": "Vartio T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "7075587",
"url": "https://glygen.org/publication/PubMed/7075587"
}
]
},
{
"title": "Kinetics of the activation of plasminogen by human tissue plasminogen activator. Role of fibrin.",
"journal": "The Journal of biological chemistry",
"date": "1982",
"authors": "Hoylaerts M, Rijken DC, Lijnen HR, Collen D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-75205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205"
}
],
"reference": [
{
"type": "PubMed",
"id": "7199524",
"url": "https://glygen.org/publication/PubMed/7199524"
}
]
},
{
"title": "Heparin, heparan sulfate, and dermatan sulfate regulate formation of the insulin-like growth factor-I and insulin-like growth factor-binding protein complexes.",
"journal": "The Journal of biological chemistry",
"date": "1994",
"authors": "Arai T, Parker A, Busby W Jr, Clemmons DR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "7519608",
"url": "https://glygen.org/publication/PubMed/7519608"
}
]
},
{
"title": "Matrix metalloproteinases degrade insulin-like growth factor-binding protein-3 in dermal fibroblast cultures.",
"journal": "The Journal of biological chemistry",
"date": "1994",
"authors": "Fowlkes JL, Enghild JJ, Suzuki K, Nagase H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "7523391",
"url": "https://glygen.org/publication/PubMed/7523391"
}
]
},
{
"title": "Angiostatin: a novel angiogenesis inhibitor that mediates the suppression of metastases by a Lewis lung carcinoma.",
"journal": "Cell",
"date": "1994",
"authors": "O'Reilly M S, Holmgren L, Shing Y, Chen C, Rosenthal R A, Moses M, Lane W S, Cao Y, Sage E H, Folkman J",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "7525077",
"url": "https://glygen.org/publication/PubMed/7525077"
}
]
},
{
"title": "Recombinant human insulin-like growth factor (IGF)-binding protein-6 inhibits IGF-II-induced differentiation of L6A1 myoblasts.",
"journal": "Endocrinology",
"date": "1994",
"authors": "Bach LA, Hsieh S, Brown AL, Rechler MM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "7525263",
"url": "https://glygen.org/publication/PubMed/7525263"
}
]
},
{
"title": "Identification of insulin-like growth factor-binding protein-3 (IGFBP-3) fragments and IGFBP-5 proteolytic activity in human seminal plasma: a comparison of normal and vasectomized patients.",
"journal": "The Journal of clinical endocrinology and metabolism",
"date": "1994",
"authors": "Lee KO, Oh Y, Giudice LC, Cohen P, Peehl DM, Rosenfeld RG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "7525634",
"url": "https://glygen.org/publication/PubMed/7525634"
}
]
},
{
"title": "Biological effects of prostate specific antigen as an insulin-like growth factor binding protein-3 protease.",
"journal": "The Journal of endocrinology",
"date": "1994",
"authors": "Cohen P, Peehl DM, Graves HC, Rosenfeld RG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "7525824",
"url": "https://glygen.org/publication/PubMed/7525824"
}
]
},
{
"title": "Interactions between insulin-like growth factor-I (IGF-I) and the system of plasminogen activators and their inhibitors in the control of IGF-binding protein-3 production and proteolysis in human osteosarcoma cells.",
"journal": "Endocrinology",
"date": "1994",
"authors": "Lalou C, Silve C, Rosato R, Segovia B, Binoux M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "7527330",
"url": "https://glygen.org/publication/PubMed/7527330"
}
]
},
{
"title": "Biochemical analysis of prostate specific antigen-proteolyzed insulin-like growth factor binding protein-3.",
"journal": "Growth regulation",
"date": "1994",
"authors": "Fielder PJ, Rosenfeld RG, Graves HC, Grandbois K, Maack CA, Sawamura S, Ogawa Y, Sommer A, Cohen P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "7538844",
"url": "https://glygen.org/publication/PubMed/7538844"
}
]
},
{
"title": "Serum levels of insulin-like growth factor (IGF)-binding protein-3 (IGFBP-3) in healthy infants, children, and adolescents: the relation to IGF-I, IGF-II, IGFBP-1, IGFBP-2, age, sex, body mass index, and pubertal maturation.",
"journal": "The Journal of clinical endocrinology and metabolism",
"date": "1995",
"authors": "Juul A, Dalgaard P, Blum WF, Bang P, Hall K, Michaelsen KF, Muller J, Skakkebaek NE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "7543116",
"url": "https://glygen.org/publication/PubMed/7543116"
}
]
},
{
"title": "Release of biological activities from quiescent fibronectin by a conformational change and limited proteolysis by matrix metalloproteinases.",
"journal": "Biochemistry",
"date": "1995",
"authors": "Fukai F, Ohtaki M, Fujii N, Yajima H, Ishii T, Nishizawa Y, Miyazaki K, Katayama T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "7547873",
"url": "https://glygen.org/publication/PubMed/7547873"
}
]
},
{
"title": "Autocrine regulation of cell proliferation by the insulin-like growth factor (IGF) and IGF binding protein-3 protease system in a human prostate carcinoma cell line (PC-3).",
"journal": "Endocrinology",
"date": "1995",
"authors": "Angelloz-Nicoud P, Binoux M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "7588299",
"url": "https://glygen.org/publication/PubMed/7588299"
}
]
},
{
"title": "Proteolytic and non-proteolytic activation of human neutrophil progelatinase B.",
"journal": "Biochimica et biophysica acta",
"date": "1995",
"authors": "Sang QX, Birkedal-Hansen H, Van Wart HE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "7669817",
"url": "https://glygen.org/publication/PubMed/7669817"
}
]
},
{
"title": "Binding of mutants of human insulin-like growth factor II to insulin-like growth factor binding proteins 1-6.",
"journal": "The Journal of biological chemistry",
"date": "1993",
"authors": "Bach LA, Hsieh S, Sakano K, Fujiwara H, Perdue JF, Rechler MM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "7683646",
"url": "https://glygen.org/publication/PubMed/7683646"
}
]
},
{
"title": "Glucose does not influence the insulin-like growth factor (JGF) binding to carrier proteins (IGFBPs): analysis of rat and human serum by western ligand blotting.",
"journal": "Experientia",
"date": "1993",
"authors": "Cianfarani S, Frost VJ, Savage MO, Holly JM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "7689487",
"url": "https://glygen.org/publication/PubMed/7689487"
}
]
},
{
"title": "Furin-dependent intracellular activation of the human stromelysin-3 zymogen.",
"journal": "Nature",
"date": "1995",
"authors": "Pei D, Weiss SJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "7746327",
"url": "https://glygen.org/publication/PubMed/7746327"
}
]
},
{
"title": "Activation of progelatinase B (MMP-9) by gelatinase A (MMP-2).",
"journal": "Cancer research",
"date": "1995",
"authors": "Fridman R, Toth M, Pena D, Mobashery S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "7780967",
"url": "https://glygen.org/publication/PubMed/7780967"
}
]
},
{
"title": "Activation of precursors for matrix metalloproteinases 1 (interstitial collagenase) and 3 (stromelysin) by rat mast-cell proteinases I and II.",
"journal": "The Biochemical journal",
"date": "1995",
"authors": "Suzuki K, Lees M, Newlands GF, Nagase H, Woolley DE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "7826345",
"url": "https://glygen.org/publication/PubMed/7826345"
}
]
},
{
"title": "Mechanism of cell surface activation of 72-kDa type IV collagenase. Isolation of the activated form of the membrane metalloprotease.",
"journal": "The Journal of biological chemistry",
"date": "1995",
"authors": "Strongin AY, Collier I, Bannikov G, Marmer BL, Grant GA, Goldberg GI",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "7890645",
"url": "https://glygen.org/publication/PubMed/7890645"
}
]
},
{
"title": "Matrix metalloproteinase 7 (matrilysin) from human rectal carcinoma cells. Activation of the precursor, interaction with other matrix metalloproteinases and enzymic properties.",
"journal": "The Journal of biological chemistry",
"date": "1995",
"authors": "Imai K, Yokohama Y, Nakanishi I, Ohuchi E, Fujii Y, Nakai N, Okada Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "7896811",
"url": "https://glygen.org/publication/PubMed/7896811"
}
]
},
{
"title": "Reciprocated matrix metalloproteinase activation: a process performed by interstitial collagenase and progelatinase A.",
"journal": "Biochemistry",
"date": "1994",
"authors": "Crabbe T, O'Connell JP, Smith BJ, Docherty AJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "7981201",
"url": "https://glygen.org/publication/PubMed/7981201"
}
]
},
{
"title": "A matrix metalloproteinase expressed on the surface of invasive tumour cells.",
"journal": "Nature",
"date": "1994",
"authors": "Sato H, Takino T, Okada Y, Cao J, Shinagawa A, Yamamoto E, Seiki M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "8015608",
"url": "https://glygen.org/publication/PubMed/8015608"
}
]
},
{
"title": "The structure of recombinant plasminogen kringle 1 and the fibrin binding site.",
"journal": "Blood Coagul. Fibrinolysis",
"date": "1994",
"authors": "Wu T P, Padmanabhan K P, Tulinsky A",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "8054447",
"url": "https://glygen.org/publication/PubMed/8054447"
}
]
},
{
"title": "1H-NMR assignments and secondary structure of human plasminogen kringle 1.",
"journal": "Eur. J. Biochem.",
"date": "1994",
"authors": "Rejante M R, Llin\u00e1s M",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "8181475",
"url": "https://glygen.org/publication/PubMed/8181475"
}
]
},
{
"title": "Solution structure of the epsilon-aminohexanoic acid complex of human plasminogen kringle 1.",
"journal": "Eur. J. Biochem.",
"date": "1994",
"authors": "Rejante M R, Llin\u00e1s M",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "8181476",
"url": "https://glygen.org/publication/PubMed/8181476"
}
]
},
{
"title": "Human progelatinase A can be activated by matrilysin.",
"journal": "FEBS letters",
"date": "1994",
"authors": "Crabbe T, Smith B, O'Connell J, Docherty A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "8194591",
"url": "https://glygen.org/publication/PubMed/8194591"
}
]
},
{
"title": "Cloning and characterization of a unique elastolytic metalloproteinase produced by human alveolar macrophages.",
"journal": "The Journal of biological chemistry",
"date": "1993",
"authors": "Shapiro SD, Kobayashi DK, Ley TJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "8226919",
"url": "https://glygen.org/publication/PubMed/8226919"
}
]
},
{
"title": "Plasma membrane-dependent activation of the 72-kDa type IV collagenase is prevented by complex formation with TIMP-2.",
"journal": "The Journal of biological chemistry",
"date": "1993",
"authors": "Strongin AY, Marmer BL, Grant GA, Goldberg GI",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "8314771",
"url": "https://glygen.org/publication/PubMed/8314771"
}
]
},
{
"title": "Congenital plasminogen deficiency caused by a Ser572 to Pro mutation.",
"journal": "Blood",
"date": "1993",
"authors": "Azuma H, Uno Y, Shigekiyo T, Saito S",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "8392398",
"url": "https://glygen.org/publication/PubMed/8392398"
}
]
},
{
"title": "Platelet alpha-granules.",
"journal": "Blood reviews",
"date": "1993",
"authors": "Harrison P, Cramer EM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-114608",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608"
}
],
"reference": [
{
"type": "PubMed",
"id": "8467233",
"url": "https://glygen.org/publication/PubMed/8467233"
}
]
},
{
"title": "Intermolecular autolytic cleavage can contribute to the activation of progelatinase A by cell membranes.",
"journal": "The Journal of biological chemistry",
"date": "1995",
"authors": "Atkinson SJ, Crabbe T, Cowell S, Ward RV, Butler MJ, Sato H, Seiki M, Reynolds JJ, Murphy G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "8530478",
"url": "https://glygen.org/publication/PubMed/8530478"
}
]
},
{
"title": "Biochemical characterization of human collagenase-3.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Knauper V, Lopez-Otin C, Smith B, Knight G, Murphy G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "8576151",
"url": "https://glygen.org/publication/PubMed/8576151"
}
]
},
{
"title": "Crystal structures of the recombinant kringle 1 domain of human plasminogen in complexes with the ligands epsilon-aminocaproic acid and trans-4-(aminomethyl)cyclohexane-1-carboxylic Acid.",
"journal": "Biochemistry",
"date": "1996",
"authors": "Mathews I I, Vanderhoff-Hanaver P, Castellino F J, Tulinsky A",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "8611560",
"url": "https://glygen.org/publication/PubMed/8611560"
}
]
},
{
"title": "Transmembrane-deletion mutants of the membrane-type matrix metalloproteinase-1 process progelatinase A and express intrinsic matrix-degrading activity.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Pei D, Weiss SJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "8621565",
"url": "https://glygen.org/publication/PubMed/8621565"
}
]
},
{
"title": "The degradation of human endothelial cell-derived perlecan and release of bound basic fibroblast growth factor by stromelysin, collagenase, plasmin, and heparanases.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Whitelock JM, Murdoch AD, Iozzo RV, Underwood PA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "8626565",
"url": "https://glygen.org/publication/PubMed/8626565"
}
]
},
{
"title": "Characterization of structural determinants and molecular mechanisms involved in pro-stromelysin-3 activation by 4-aminophenylmercuric acetate and furin-type convertases.",
"journal": "The Biochemical journal",
"date": "1996",
"authors": "Santavicca M, Noel A, Angliker H, Stoll I, Segain JP, Anglard P, Chretien M, Seidah N, Basset P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "8645182",
"url": "https://glygen.org/publication/PubMed/8645182"
}
]
},
{
"title": "Recombinant gene expression and 1H NMR characteristics of the kringle (2 + 3) supermodule: spectroscopic/functional individuality of plasminogen kringle domains.",
"journal": "Biochemistry",
"date": "1996",
"authors": "S\u00f6hndel S, Hu C K, Marti D, Affolter M, Schaller J, Llin\u00e1s M, Rickli E E",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "8652577",
"url": "https://glygen.org/publication/PubMed/8652577"
}
]
},
{
"title": "Cellular mechanisms for human procollagenase-3 (MMP-13) activation. Evidence that MT1-MMP (MMP-14) and gelatinase a (MMP-2) are able to generate active enzyme.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Knauper V, Will H, Lopez-Otin C, Smith B, Atkinson SJ, Stanton H, Hembry RM, Murphy G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "8663255",
"url": "https://glygen.org/publication/PubMed/8663255"
}
]
},
{
"title": "Measurement of insulin-like growth factor (IGF)-II binding to purified IGF binding proteins 1-6: comparison of charcoal adsorption and high performance size exclusion chromatography.",
"journal": "Biochimica et biophysica acta",
"date": "1996",
"authors": "Bach LA, Rechler MM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "8781553",
"url": "https://glygen.org/publication/PubMed/8781553"
}
]
},
{
"title": "Activation of a recombinant membrane type 1-matrix metalloproteinase (MT1-MMP) by furin and its interaction with tissue inhibitor of metalloproteinases (TIMP)-2.",
"journal": "FEBS letters",
"date": "1996",
"authors": "Sato H, Kinoshita T, Takino T, Nakayama K, Seiki M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "8804434",
"url": "https://glygen.org/publication/PubMed/8804434"
}
]
},
{
"title": "Insulin-like growth factor binding protein (IGFBP) proteases: functional regulators of cell growth.",
"journal": "Progress in growth factor research",
"date": "1995",
"authors": "Rajah R, Katz L, Nunn S, Solberg P, Beers T, Cohen P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "8817670",
"url": "https://glygen.org/publication/PubMed/8817670"
}
]
},
{
"title": "Recombinant human insulin-like growth factor (IGF) binding protein-3 stimulates prostate carcinoma cell proliferation via an IGF-dependent mechanism. Role of serine proteases.",
"journal": "Growth regulation",
"date": "1996",
"authors": "Angelloz-Nicoud P, Harel L, Binoux M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "8894645",
"url": "https://glygen.org/publication/PubMed/8894645"
}
]
},
{
"title": "Type I, II, III, IV, V, and VI collagens serve as extracellular ligands for the isoforms of platelet-derived growth factor (AA, BB, and AB).",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Somasundaram R, Schuppan D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797"
}
],
"reference": [
{
"type": "PubMed",
"id": "8900172",
"url": "https://glygen.org/publication/PubMed/8900172"
}
]
},
{
"title": "Isolation and characterization of proteolytic fragments of insulin-like growth factor-binding protein-3.",
"journal": "Hormone research",
"date": "1996",
"authors": "Lalou C, Lassarre C, Binoux M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "8964575",
"url": "https://glygen.org/publication/PubMed/8964575"
}
]
},
{
"title": "Evidence for a novel O-linked sialylated trisaccharide on Ser-248 of human plasminogen 2.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Pirie-Shepherd SR, Stevens RD, Andon NL, Enghild JJ, Pizzo SV",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747#ptm_processing"
},
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
},
{
"database": "GlyConnect",
"id": "502",
"url": "https://glyconnect.expasy.org/browser/proteins/502"
}
],
"reference": [
{
"type": "PubMed",
"id": "9054441",
"url": "https://glygen.org/publication/PubMed/9054441"
}
]
},
{
"title": "The role of the C-terminal domain of human collagenase-3 (MMP-13) in the activation of procollagenase-3, substrate specificity, and tissue inhibitor of metalloproteinase interaction.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Knauper V, Cowell S, Smith B, Lopez-Otin C, O'Shea M, Morris H, Zardi L, Murphy G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "9065415",
"url": "https://glygen.org/publication/PubMed/9065415"
}
]
},
{
"title": "A recombinant human angiostatin protein inhibits experimental primary and metastatic cancer.",
"journal": "Cancer Res.",
"date": "1997",
"authors": "Sim B K, O'Reilly M S, Liang H, Fortier A H, He W, Madsen J W, Lapcevich R, Nacy C A",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "9102221",
"url": "https://glygen.org/publication/PubMed/9102221"
}
]
},
{
"title": "Acceleration of plasminogen activation by tissue plasminogen activator on surface-bound histidine-proline-rich glycoprotein.",
"journal": "J. Biol. Chem.",
"date": "1997",
"authors": "Borza D B, Morgan W T",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "9102401",
"url": "https://glygen.org/publication/PubMed/9102401"
}
]
},
{
"title": "Hydrolysis of a broad spectrum of extracellular matrix proteins by human macrophage elastase.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Gronski TJ Jr, Martin RL, Kobayashi DK, Walsh BC, Holman MC, Huber M, Van Wart HE, Shapiro SD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "9115292",
"url": "https://glygen.org/publication/PubMed/9115292"
}
]
},
{
"title": "Degradation of decorin by matrix metalloproteinases: identification of the cleavage sites, kinetic analyses and transforming growth factor-beta1 release.",
"journal": "The Biochemical journal",
"date": "1997",
"authors": "Imai K, Hiramatsu A, Fukushima D, Pierschbacher MD, Okada Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "9148753",
"url": "https://glygen.org/publication/PubMed/9148753"
}
]
},
{
"title": "Serine-578 is a major phosphorylation locus in human plasma plasminogen.",
"journal": "Biochemistry",
"date": "1997",
"authors": "Wang H, Prorok M, Bretthauer RK, Castellino FJ",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
},
{
"database": "iPTMnet",
"id": "P00747",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "9201958",
"url": "https://glygen.org/publication/PubMed/9201958"
}
]
},
{
"title": "Homozygous mutations in the plasminogen gene of two unrelated girls with ligneous conjunctivitis.",
"journal": "Blood",
"date": "1997",
"authors": "Schuster V, Mingers AM, Seidenspinner S, Nussgens Z, Pukrop T, Kreth HW",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "9242524",
"url": "https://glygen.org/publication/PubMed/9242524"
}
]
},
{
"title": "Activation of type IV procollagenases by human tumor-associated trypsin-2.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Sorsa T, Salo T, Koivunen E, Tyynela J, Konttinen YT, Bergmann U, Tuuttila A, Niemi E, Teronen O, Heikkila P, Tschesche H, Leinonen J, Osman S, Stenman UH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "9261109",
"url": "https://glygen.org/publication/PubMed/9261109"
}
]
},
{
"title": "Ligand preferences of kringle 2 and homologous domains of human plasminogen: canvassing weak, intermediate, and high-affinity binding sites by 1H-NMR.",
"journal": "Biochemistry",
"date": "1997",
"authors": "Marti D N, Hu C K, An S S, von Haller P, Schaller J, Llin\u00e1s M",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "9305949",
"url": "https://glygen.org/publication/PubMed/9305949"
}
]
},
{
"title": "Interaction of platelet-derived growth factor with thrombospondin 1.",
"journal": "The Biochemical journal",
"date": "1997",
"authors": "Hogg PJ, Hotchkiss KA, Jimenez BM, Stathakis P, Chesterman CN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797"
}
],
"reference": [
{
"type": "PubMed",
"id": "9334164",
"url": "https://glygen.org/publication/PubMed/9334164"
}
]
},
{
"title": "Activation of progelatinase B (proMMP-9) by active collagenase-3 (MMP-13).",
"journal": "European journal of biochemistry",
"date": "1997",
"authors": "Knauper V, Smith B, Lopez-Otin C, Murphy G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "9346290",
"url": "https://glygen.org/publication/PubMed/9346290"
}
]
},
{
"title": "HRG Tokushima: molecular and cellular characterization of histidine-rich glycoprotein (HRG) deficiency.",
"journal": "Blood",
"date": "1998",
"authors": "Shigekiyo T, Yoshida H, Matsumoto K, Azuma H, Wakabayashi S, Saito S, Fujikawa K, Koide T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-75205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205"
}
],
"reference": [
{
"type": "PubMed",
"id": "9414276",
"url": "https://glygen.org/publication/PubMed/9414276"
}
]
},
{
"title": "The TIMP2 membrane type 1 metalloproteinase `receptor` regulates the concentration and efficient activation of progelatinase A. A kinetic study.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Butler GS, Butler MJ, Atkinson SJ, Will H, Tamura T, Schade van Westrum S, Crabbe T, Clements J, d'Ortho MP, Murphy G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "9422744",
"url": "https://glygen.org/publication/PubMed/9422744"
}
]
},
{
"title": "Membrane-type matrix metalloproteinases 1 and 2 exhibit broad-spectrum proteolytic capacities comparable to many matrix metalloproteinases.",
"journal": "European journal of biochemistry",
"date": "1997",
"authors": "d'Ortho MP, Will H, Atkinson S, Butler G, Messent A, Gavrilovic J, Smith B, Timpl R, Zardi L, Murphy G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "9461298",
"url": "https://glygen.org/publication/PubMed/9461298"
}
]
},
{
"title": "Insulin-like growth factor (IGF)-binding protein 5 forms an alternative ternary complex with IGFs and the acid-labile subunit.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Twigg SM, Baxter RC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "9497324",
"url": "https://glygen.org/publication/PubMed/9497324"
}
]
},
{
"title": "Structure and ligand binding determinants of the recombinant kringle 5 domain of human plasminogen.",
"journal": "Biochemistry",
"date": "1998",
"authors": "Chang Y, Mochalkin I, McCance S G, Cheng B, Tulinsky A, Castellino F J",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "9521645",
"url": "https://glygen.org/publication/PubMed/9521645"
}
]
},
{
"title": "Generation of an angiostatin-like fragment from plasminogen by stromelysin-1 (MMP-3).",
"journal": "Biochemistry",
"date": "1998",
"authors": "Lijnen HR, Ugwu F, Bini A, Collen D",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "9548733",
"url": "https://glygen.org/publication/PubMed/9548733"
}
]
},
{
"title": "Activation of the precursor of human stromelysin 2 and its interactions with other matrix metalloproteinases.",
"journal": "European journal of biochemistry",
"date": "1998",
"authors": "Nakamura H, Fujii Y, Ohuchi E, Yamamoto E, Okada Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "9578462",
"url": "https://glygen.org/publication/PubMed/9578462"
}
]
},
{
"title": "TIMP-2 promotes activation of progelatinase A by membrane-type 1 matrix metalloproteinase immobilized on agarose beads.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Kinoshita T, Sato H, Okada A, Ohuchi E, Imai K, Okada Y, Seiki M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "9632662",
"url": "https://glygen.org/publication/PubMed/9632662"
}
]
},
{
"title": "Identification of novel high molecular weight insulin-like growth factor-binding protein-3 association proteins in human serum.",
"journal": "The Journal of clinical endocrinology and metabolism",
"date": "1998",
"authors": "Collett-Solberg PF, Nunn SE, Gibson TB, Cohen P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "9709957",
"url": "https://glygen.org/publication/PubMed/9709957"
}
]
},
{
"title": "The insulin-like growth factor (IGF)binding protein 1 binding epitope on IGF-I probed by heteronuclear NMR spectroscopy and mutational analysis.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Jansson M, Andersson G, Uhlen M, Nilsson B, Kordel J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "9733769",
"url": "https://glygen.org/publication/PubMed/9733769"
}
]
},
{
"title": "Signal transduction via platelet-derived growth factor receptors.",
"journal": "Biochimica et biophysica acta",
"date": "1998",
"authors": "Heldin CH, Ostman A, Ronnstrand L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-186797",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797"
}
],
"reference": [
{
"type": "PubMed",
"id": "9739761",
"url": "https://glygen.org/publication/PubMed/9739761"
}
]
},
{
"title": "The ternary microplasmin-staphylokinase-microplasmin complex is a proteinase-cofactor-substrate complex in action.",
"journal": "Nat. Struct. Biol.",
"date": "1998",
"authors": "Parry M A, Fernandez-Catalan C, Bergner A, Huber R, Hopfner K P, Schlott B, G\u00fchrs K H, Bode W",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "9783753",
"url": "https://glygen.org/publication/PubMed/9783753"
}
]
},
{
"title": "Insulin-like growth factor-binding protein 5 complexes with the acid-labile subunit. Role of the carboxyl-terminal domain.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Twigg SM, Kiefer MC, Zapf J, Baxter RC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "9786878",
"url": "https://glygen.org/publication/PubMed/9786878"
}
]
},
{
"title": "Human HtrA, an evolutionarily conserved serine protease identified as a differentially expressed gene product in osteoarthritic cartilage.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Hu SI, Carozza M, Klein M, Nantermet P, Luk D, Crowl RM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "9852107",
"url": "https://glygen.org/publication/PubMed/9852107"
}
]
},
{
"title": "Plasminogen Kanagawa-I, a novel missense mutation, is caused by the amino acid substitution G732R.",
"journal": "British journal of haematology",
"date": "1998",
"authors": "Higuchi Y, Furihata K, Ueno I, Ishikawa S, Okumura N, Tozuka M, Sakurai N",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"reference": [
{
"type": "PubMed",
"id": "9858247",
"url": "https://glygen.org/publication/PubMed/9858247"
}
]
},
{
"title": "The crystal structure of a complex of p11 with the annexin II N-terminal peptide.",
"journal": "Nature structural biology",
"date": "1999",
"authors": "Rety S, Sopkova J, Renouard M, Osterloh D, Gerke V, Tabaries S, Russo-Marie F, Lewit-Bentley A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-75205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205"
}
],
"reference": [
{
"type": "PubMed",
"id": "9886297",
"url": "https://glygen.org/publication/PubMed/9886297"
}
]
},
{
"title": "Elevated levels of the IGF-binding protein protease MMP-1 in asthmatic airway smooth muscle.",
"journal": "American journal of respiratory cell and molecular biology",
"date": "1999",
"authors": "Rajah R, Nachajon RV, Collins MH, Hakonarson H, Grunstein MM, Cohen P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "9922210",
"url": "https://glygen.org/publication/PubMed/9922210"
}
]
}
],
"pathway": [
{
"id": "hsa:5340",
"name": "",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5340",
"resource": "KEGG Pathway"
},
{
"id": "R-HSA-114608",
"name": "Platelet degranulation",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608",
"resource": "Reactome",
"description": "Platelet degranulation"
},
{
"id": "R-HSA-1474228",
"name": "Degradation of the extracellular matrix",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228",
"resource": "Reactome",
"description": "Degradation of the extracellular matrix"
},
{
"id": "R-HSA-1592389",
"name": "Activation of Matrix Metalloproteinases",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389",
"resource": "Reactome",
"description": "Activation of Matrix Metalloproteinases"
},
{
"id": "R-HSA-186797",
"name": "Signaling by PDGF",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797",
"resource": "Reactome",
"description": "Signaling by PDGF"
},
{
"id": "R-HSA-381426",
"name": "Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426",
"resource": "Reactome",
"description": "Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)"
},
{
"id": "R-HSA-75205",
"name": "Dissolution of Fibrin Clot",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205",
"resource": "Reactome",
"description": "Dissolution of Fibrin Clot"
}
],
"orthologs": [
{
"uniprot_canonical_ac": "P20918-1",
"protein_name": "Plasminogen",
"gene_name": "Plg",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MDHKEVILLFLLLLKPGQGDSLDGYISTQGASLFSLTKKQLAAGGVSDCLAKCEGETDFVCRSFQYHSKEQQCVIMAENSKTSSIIRMRDVILFEKRVYLSECKTGIGNGYRGTMSRTKSGVACQKWGATFPHVPNYSPSTHPNEGLEENYCRNPDNDEQGPWCYTTDPDKRYDYCNIPECEEECMYCSGEKYEGKISKTMSGLDCQAWDSQSPHAHGYIPAKFPSKNLKMNYCRNPDGEPRPWCFTTDPTKRWEYCDIPRCTTPPPPPSPTYQCLKGRGENYRGTVSVTVSGKTCQRWSEQTPHRHNRTPENFPCKNLEENYCRNPDGETAPWCYTTDSQLRWEYCEIPSCESSASPDQSDSSVPPEEQTPVVQECYQSDGQSYRGTSSTTITGKKCQSWAAMFPHRHSKTPENFPDAGLEMNYCRNPDGDKGPWCYTTDPSVRWEYCNLKRCSETGGSVVELPTVSQEPSGPSDSETDCMYGNGKDYRGKTAVTAAGTPCQGWAAQEPHRHSIFTPQTNPRAGLEKNYCRNPDGDVNGPWCYTTNPRKLYDYCDIPLCASASSFECGKPQVEPKKCPGRVVGGCVANPHSWPWQISLRTRFTGQHFCGGTLIAPEWVLTAAHCLEKSSRPEFYKVILGAHEEYIRGLDVQEISVAKLILEPNNRDIALLKLSRPATITDKVIPACLPSPNYMVADRTICYITGWGETQGTFGAGRLKEAQLPVIENKVCNRVEYLNNRVKSTELCAGQLAGGVDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVDWIEREMRNN",
"length": 812
},
"evidence": [
{
"id": "45917873",
"url": "http://www.informatics.jax.org/homology/45917873",
"database": "MGI"
},
{
"id": "P00747",
"url": "https://omabrowser.org/oma/group/P00747/",
"database": "OMA"
}
],
"common_name": "Mouse"
},
{
"uniprot_canonical_ac": "Q01177-1",
"protein_name": "Plasminogen",
"gene_name": "Plg",
"tax_id": 10116,
"organism": "Rattus norvegicus",
"sequence": {
"sequence": "MDHKEIILLFLLFLKPGQGDSLDGYVSTQGASLHSLTKKQLAAGSIADCLAKCEGETDFICRSFQYHSKEQQCVIMAENSKTSSIIRMRDVILFEKRVYLSECKTGIGKGYRGTMSKTKTGVTCQKWSDTSPHVPKYSPSTHPSEGLEENYCRNPDNDEQGPWCYTTDPDQRYEYCNIPECEEECMYCSGEKYEGKISKTMSGLDCQSWDSQSPHAHGYIPAKFPSKNLKMNYCRNPDGEPRPWCFTTDPNKRWEYCDIPRCTTPPPPPGPTYQCLKGRGENYRGTVSVTASGKTCQRWSEQTPHRHNRTPENFPCKNLEENYCRNPDGETAPWCYTTDSQLRWEYCEIPSCGSSVSPDQSDSSVLPEQTPVVQECYQGNGKSYRGTSSTTNTGKKCQSWVSMTPHSHSKTPANFPDAGLEMNYCRNPDNDQRGPWCFTTDPSVRWEYCNLKRCSETGGGVAESAIVPQVPSAPGTSETDCMYGNGKEYRGKTAVTAAGTPCQEWAAQEPHSHRIFTPQTNPRAGLEKNYCRNPDGDVNGPWCYTMNPRKLYDYCNIPLCASLSSFECGKPQVEPKKCPGRVVGGCVANPHSWPWQISLRTRFSGQHFCGGTLISPEWVLTAAHCLEKSSRPEFYKVILGAHEERILGSDVQQIAVTKLVLEPNDADIALLKLSRPATITDNVIPACLPSPNYVVADRTLCYITGWGETKGTPGAGRLKEAQLPVIENKVCNRAEYLNNRVKSTELCAGHLAGGIDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRYVNWIEREMRND",
"length": 812
},
"evidence": [
{
"id": "45917873",
"url": "http://www.informatics.jax.org/homology/45917873",
"database": "MGI"
}
],
"common_name": "Rat"
}
],
"go_annotation": {
"categories": [
{
"name": "Cellular Component",
"total": 11,
"go_terms": [
{
"name": "glutamatergic synapse",
"id": "GO:0098978",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098978",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "extracellular region",
"id": "GO:0005576",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "extracellular space",
"id": "GO:0005615",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "plasma membrane",
"id": "GO:0005886",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "cell surface",
"id": "GO:0009986",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "platelet alpha granule lumen",
"id": "GO:0031093",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031093",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "extracellular exosome",
"id": "GO:0070062",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "blood microparticle",
"id": "GO:0072562",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072562",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "external side of plasma membrane",
"id": "GO:0009897",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "collagen-containing extracellular matrix",
"id": "GO:0062023",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062023",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "Schaffer collateral - CA1 synapse",
"id": "GO:0098685",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098685",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
}
]
},
{
"name": "Biological Process",
"total": 19,
"go_terms": [
{
"name": "biological process involved in interaction with symbiont",
"id": "GO:0051702",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051702",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "proteolysis",
"id": "GO:0006508",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006508",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "negative regulation of cell population proliferation",
"id": "GO:0008285",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008285",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "extracellular matrix disassembly",
"id": "GO:0022617",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022617",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "muscle cell cellular homeostasis",
"id": "GO:0046716",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046716",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "blood coagulation",
"id": "GO:0007596",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007596",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "fibrinolysis",
"id": "GO:0042730",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042730",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "negative regulation of fibrinolysis",
"id": "GO:0051918",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051918",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "tissue regeneration",
"id": "GO:0042246",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042246",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "positive regulation of blood vessel endothelial cell migration",
"id": "GO:0043536",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043536",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "labyrinthine layer blood vessel development",
"id": "GO:0060716",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060716",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "negative regulation of cell-substrate adhesion",
"id": "GO:0010812",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010812",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "myoblast differentiation",
"id": "GO:0045445",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045445",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "trophoblast giant cell differentiation",
"id": "GO:0060707",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060707",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "tissue remodeling",
"id": "GO:0048771",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048771",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "positive regulation of fibrinolysis",
"id": "GO:0051919",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051919",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "mononuclear cell migration",
"id": "GO:0071674",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071674",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "negative regulation of cell-cell adhesion mediated by cadherin",
"id": "GO:2000048",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000048",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "trans-synaptic signaling by BDNF, modulating synaptic transmission",
"id": "GO:0099183",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0099183",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
}
]
},
{
"name": "Molecular Function",
"total": 11,
"go_terms": [
{
"name": "protease binding",
"id": "GO:0002020",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002020",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "endopeptidase activity",
"id": "GO:0004175",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004175",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "serine-type endopeptidase activity",
"id": "GO:0004252",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004252",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "signaling receptor binding",
"id": "GO:0005102",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005102",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "enzyme binding",
"id": "GO:0019899",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019899",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "protein domain specific binding",
"id": "GO:0019904",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019904",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "apolipoprotein binding",
"id": "GO:0034185",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034185",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "protein-folding chaperone binding",
"id": "GO:0051087",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051087",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "kinase binding",
"id": "GO:0019900",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019900",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "protein antigen binding",
"id": "GO:1990405",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990405",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
},
{
"name": "serine-type peptidase activity",
"id": "GO:0008236",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008236",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
}
],
"pmid": ""
}
]
}
]
},
"pro_annotation": [
{
"name": "plasminogen N-glycosylated 1 (human)",
"definition": "A plasminogen (human) that has been N-glycosylated at the residue equivalent to Asn-308 of the amino acid sequence represented by UniProtKB:P00747-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P00747-1, Asn-308, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]",
"evidence": [
{
"id": "PR:000051203",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000051203"
}
]
},
{
"name": "plasminogen N-glycosylated 2 (human)",
"definition": "A plasminogen (human) that has been N-glycosylated at the residue equivalent to Asn-308 of the amino acid sequence represented by UniProtKB:P00747-1, in which the glycan structure is represented by GlyTouCan:G11041DA. Example: UniProtKB:P00747-1, Asn-308, MOD:00160~GNO:G11041DA. [PRO:DNx, PMID:1899031, PMID:2059624, PMID:2065054, PMID:2386787]",
"evidence": [
{
"id": "PR:000051204",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000051204"
}
]
},
{
"name": "plasminogen N-glycosylated 3 (human)",
"definition": "A plasminogen (human) that has been N-glycosylated at the residue equivalent to Asn-308 of the amino acid sequence represented by UniProtKB:P00747-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P00747-1, Asn-308, MOD:00160~GNO:G29068FM. [PRO:DNx, PMID:29671580]",
"evidence": [
{
"id": "PR:000051205",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000051205"
}
]
},
{
"name": "plasminogen N-glycosylated 4 (human)",
"definition": "A plasminogen (human) that has been N-glycosylated at the residue equivalent to Asn-308 of the amino acid sequence represented by UniProtKB:P00747-1, in which the glycan structure is represented by GlyTouCan:G36191CD. Example: UniProtKB:P00747-1, Asn-308, MOD:00160~GNO:G36191CD. [PRO:DNx, PMID:1899031, PMID:2059624, PMID:2065054, PMID:2386787]",
"evidence": [
{
"id": "PR:000051206",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000051206"
}
]
},
{
"name": "plasminogen N-glycosylated 5 (human)",
"definition": "A plasminogen (human) that has been N-glycosylated at the residue equivalent to Asn-308 of the amino acid sequence represented by UniProtKB:P00747-1, in which the glycan structure is represented by GlyTouCan:G56749GV. Example: UniProtKB:P00747-1, Asn-308, MOD:00160~GNO:G56749GV. [PRO:DNx, PMID:1899031, PMID:2059624, PMID:2065054, PMID:2386787]",
"evidence": [
{
"id": "PR:000051207",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000051207"
}
]
},
{
"name": "plasminogen N-glycosylated 6 (human)",
"definition": "A plasminogen (human) that has been N-glycosylated at the residue equivalent to Asn-308 of the amino acid sequence represented by UniProtKB:P00747-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P00747-1, Asn-308, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]",
"evidence": [
{
"id": "PR:000051208",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000051208"
}
]
},
{
"name": "plasminogen N-glycosylated 7 (human)",
"definition": "A plasminogen (human) that has been N-glycosylated at the residue equivalent to Asn-308 of the amino acid sequence represented by UniProtKB:P00747-1, in which the glycan structure is represented by GlyTouCan:G84467IZ. Example: UniProtKB:P00747-1, Asn-308, MOD:00160~GNO:G84467IZ. [PRO:DNx, PMID:1899031, PMID:2059624, PMID:2065054, PMID:2386787]",
"evidence": [
{
"id": "PR:000051209",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000051209"
}
]
},
{
"name": "plasminogen N-glycosylated 8 (human)",
"definition": "A plasminogen (human) that has been N-glycosylated at the residue equivalent to Asn-308 of the amino acid sequence represented by UniProtKB:P00747-1, in which the glycan structure is represented by GlyTouCan:G91365ZQ. Example: UniProtKB:P00747-1, Asn-308, MOD:00160~GNO:G91365ZQ. [PRO:DNx, PMID:1899031, PMID:2059624, PMID:2065054, PMID:2386787]",
"evidence": [
{
"id": "PR:000051210",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000051210"
}
]
},
{
"name": "plasminogen O-glycosylated 1 (human)",
"definition": "A plasminogen (human) that has been O-glycosylated at the residue equivalent to Ser-268 of the amino acid sequence represented by UniProtKB:P00747-1, in which the glycan structure is represented by GlyTouCan:G01614ZM. Example: UniProtKB:P00747-1, Ser-268, MOD:00002~GNO:G01614ZM. [PRO:DNx, PMID:1899031, PMID:2059624, PMID:2065054, PMID:2386787]",
"evidence": [
{
"id": "PR:000051211",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000051211"
}
]
},
{
"name": "plasminogen O-glycosylated 2 (human)",
"definition": "A plasminogen (human) that has been O-glycosylated at the residue equivalent to Ser-268 of the amino acid sequence represented by UniProtKB:P00747-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P00747-1, Ser-268, MOD:00002~GNO:G29068FM. [PRO:DNx, PMID:30459171]",
"evidence": [
{
"id": "PR:000051212",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000051212"
}
]
},
{
"name": "plasminogen O-glycosylated 3 (human)",
"definition": "A plasminogen (human) that has been O-glycosylated at the residue equivalent to Ser-268 of the amino acid sequence represented by UniProtKB:P00747-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P00747-1, Ser-268, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]",
"evidence": [
{
"id": "PR:000051213",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000051213"
}
]
},
{
"name": "plasminogen O-glycosylated 4 (human)",
"definition": "A plasminogen (human) that has been O-glycosylated at the residue equivalent to Ser-268 of the amino acid sequence represented by UniProtKB:P00747-1, in which the glycan structure is represented by GlyTouCan:G65562ZE. Example: UniProtKB:P00747-1, Ser-268, MOD:00002~GNO:G65562ZE. [PRO:DNx, PMID:1899031, PMID:2059624, PMID:2065054, PMID:2386787]",
"evidence": [
{
"id": "PR:000051214",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000051214"
}
]
},
{
"name": "plasminogen O-glycosylated 5 (human)",
"definition": "A plasminogen (human) that has been O-glycosylated at the residue equivalent to Ser-358 of the amino acid sequence represented by UniProtKB:P00747-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P00747-1, Ser-358, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]",
"evidence": [
{
"id": "PR:000051215",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000051215"
}
]
},
{
"name": "plasminogen O-glycosylated 6 (human)",
"definition": "A plasminogen (human) that has been O-glycosylated at the residue equivalent to Ser-460 of the amino acid sequence represented by UniProtKB:P00747-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P00747-1, Ser-460, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]",
"evidence": [
{
"id": "PR:000051216",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000051216"
}
]
},
{
"name": "plasminogen O-glycosylated 7 (human)",
"definition": "A plasminogen (human) that has been O-glycosylated at the residue equivalent to Thr-263 of the amino acid sequence represented by UniProtKB:P00747-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P00747-1, Thr-263, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]",
"evidence": [
{
"id": "PR:000051217",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000051217"
}
]
},
{
"name": "plasminogen O-glycosylated 8 (human)",
"definition": "A plasminogen (human) that has been O-glycosylated at the residue equivalent to Thr-264 of the amino acid sequence represented by UniProtKB:P00747-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P00747-1, Thr-264, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]",
"evidence": [
{
"id": "PR:000051218",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000051218"
}
]
},
{
"name": "plasminogen O-glycosylated 9 (human)",
"definition": "A plasminogen (human) that has been O-glycosylated at the residue equivalent to Thr-264 of the amino acid sequence represented by UniProtKB:P00747-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P00747-1, Thr-264, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]",
"evidence": [
{
"id": "PR:000051219",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000051219"
}
]
},
{
"name": "plasminogen O-glycosylated 10 (human)",
"definition": "A plasminogen (human) that has been O-glycosylated at the residue equivalent to Thr-28 of the amino acid sequence represented by UniProtKB:P00747-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P00747-1, Thr-28, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]",
"evidence": [
{
"id": "PR:000051220",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000051220"
}
]
},
{
"name": "plasminogen O-glycosylated 11 (human)",
"definition": "A plasminogen (human) that has been O-glycosylated at the residue equivalent to Thr-359 of the amino acid sequence represented by UniProtKB:P00747-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P00747-1, Thr-359, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]",
"evidence": [
{
"id": "PR:000051221",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000051221"
}
]
},
{
"name": "plasminogen O-glycosylated 12 (human)",
"definition": "A plasminogen (human) that has been O-glycosylated at the residue equivalent to Thr-365 of the amino acid sequence represented by UniProtKB:P00747-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P00747-1, Thr-365, MOD:00005~GNO:G00912UN. [PRO:DNx, PMID:26598643, PMID:30459171]",
"evidence": [
{
"id": "PR:000051222",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000051222"
}
]
},
{
"name": "plasminogen O-glycosylated 13 (human)",
"definition": "A plasminogen (human) that has been O-glycosylated at the residue equivalent to Thr-365 of the amino acid sequence represented by UniProtKB:P00747-1, in which the glycan structure is represented by GlyTouCan:G01614ZM. Example: UniProtKB:P00747-1, Thr-365, MOD:00005~GNO:G01614ZM. [PRO:DNx, PMID:1899031, PMID:2059624, PMID:2065054, PMID:2386787]",
"evidence": [
{
"id": "PR:000051223",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000051223"
}
]
},
{
"name": "plasminogen O-glycosylated 14 (human)",
"definition": "A plasminogen (human) that has been O-glycosylated at the residue equivalent to Thr-365 of the amino acid sequence represented by UniProtKB:P00747-1, in which the glycan composition is represented by GlyTouCan:G17015OC. Example: UniProtKB:P00747-1, Thr-365, MOD:00005~GNO:G17015OC. [PRO:DNx, PMID:26598643, PMID:30459171]",
"evidence": [
{
"id": "PR:000051224",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000051224"
}
]
},
{
"name": "plasminogen O-glycosylated 15 (human)",
"definition": "A plasminogen (human) that has been O-glycosylated at the residue equivalent to Thr-365 of the amino acid sequence represented by UniProtKB:P00747-1, in which the glycan composition is represented by GlyTouCan:G23729WG. Example: UniProtKB:P00747-1, Thr-365, MOD:00005~GNO:G23729WG. [PRO:DNx, PMID:26598643, PMID:30459171]",
"evidence": [
{
"id": "PR:000051225",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000051225"
}
]
},
{
"name": "plasminogen O-glycosylated 16 (human)",
"definition": "A plasminogen (human) that has been O-glycosylated at the residue equivalent to Thr-365 of the amino acid sequence represented by UniProtKB:P00747-1, in which the glycan composition is represented by GlyTouCan:G27391WQ. Example: UniProtKB:P00747-1, Thr-365, MOD:00005~GNO:G27391WQ. [PRO:DNx, PMID:26598643, PMID:30459171]",
"evidence": [
{
"id": "PR:000051226",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000051226"
}
]
},
{
"name": "plasminogen O-glycosylated 17 (human)",
"definition": "A plasminogen (human) that has been O-glycosylated at the residue equivalent to Thr-365 of the amino acid sequence represented by UniProtKB:P00747-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P00747-1, Thr-365, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:26598643, PMID:30459171]",
"evidence": [
{
"id": "PR:000051227",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000051227"
}
]
},
{
"name": "plasminogen O-glycosylated 18 (human)",
"definition": "A plasminogen (human) that has been O-glycosylated at the residue equivalent to Thr-365 of the amino acid sequence represented by UniProtKB:P00747-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P00747-1, Thr-365, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:26598643, PMID:30459171]",
"evidence": [
{
"id": "PR:000051228",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000051228"
}
]
},
{
"name": "plasminogen O-glycosylated 19 (human)",
"definition": "A plasminogen (human) that has been O-glycosylated at the residue equivalent to Thr-365 of the amino acid sequence represented by UniProtKB:P00747-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P00747-1, Thr-365, MOD:00005~GNO:G58001LT. [PRO:DNx, PMID:26598643, PMID:30459171]",
"evidence": [
{
"id": "PR:000051229",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000051229"
}
]
},
{
"name": "plasminogen O-glycosylated 20 (human)",
"definition": "A plasminogen (human) that has been O-glycosylated at the residue equivalent to Thr-365 of the amino acid sequence represented by UniProtKB:P00747-1, in which the glycan structure is represented by GlyTouCan:G65562ZE. Example: UniProtKB:P00747-1, Thr-365, MOD:00005~GNO:G65562ZE. [PRO:DNx, PMID:1899031, PMID:2059624, PMID:2065054, PMID:2386787]",
"evidence": [
{
"id": "PR:000051230",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000051230"
}
]
},
{
"name": "plasminogen O-glycosylated 21 (human)",
"definition": "A plasminogen (human) that has been O-glycosylated at the residue equivalent to Thr-371 of the amino acid sequence represented by UniProtKB:P00747-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P00747-1, Thr-371, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]",
"evidence": [
{
"id": "PR:000051231",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000051231"
}
]
},
{
"name": "plasminogen O-glycosylated 22 (human)",
"definition": "A plasminogen (human) that has been O-glycosylated at the residue equivalent to Thr-371 of the amino acid sequence represented by UniProtKB:P00747-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P00747-1, Thr-371, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]",
"evidence": [
{
"id": "PR:000051232",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000051232"
}
]
},
{
"name": "plasminogen O-glycosylated 23 (human)",
"definition": "A plasminogen (human) that has been O-glycosylated at the residue equivalent to Thr-457 of the amino acid sequence represented by UniProtKB:P00747-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P00747-1, Thr-457, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]",
"evidence": [
{
"id": "PR:000051233",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000051233"
}
]
},
{
"name": "plasminogen O-glycosylated 24 (human)",
"definition": "A plasminogen (human) that has been O-glycosylated at the residue equivalent to Thr-710 of the amino acid sequence represented by UniProtKB:P00747-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P00747-1, Thr-710, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]",
"evidence": [
{
"id": "PR:000051234",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000051234"
}
]
},
{
"name": "plasminogen O-glycosylated 25 (human)",
"definition": "A plasminogen (human) that has been O-glycosylated at the residue equivalent to Thr-710 of the amino acid sequence represented by UniProtKB:P00747-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P00747-1, Thr-710, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]",
"evidence": [
{
"id": "PR:000051235",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000051235"
}
]
},
{
"name": "plasminogen O-glycosylated 26 (human)",
"definition": "A plasminogen (human) that has been O-glycosylated at the residue equivalent to Thr-742 of the amino acid sequence represented by UniProtKB:P00747-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P00747-1, Thr-742, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]",
"evidence": [
{
"id": "PR:000051236",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000051236"
}
]
}
],
"site_annotation": [
{
"start_pos": 308,
"end_pos": 310,
"annotation": "n_glycosylation_sequon"
}
],
"ptm_annotation": [
{
"annotation": "In the presence of the inhibitor, the activation involves only cleavage after Arg-580, yielding two chains held together by two disulfide bonds. In the absence of the inhibitor, the activation involves additionally the removal of the activation peptide.",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
},
{
"database": "PubMed",
"id": "9548733",
"url": "https://glygen.org/publication/PubMed/9548733"
},
{
"database": "PubMed",
"id": "14699093",
"url": "https://glygen.org/publication/PubMed/14699093"
}
]
},
{
"annotation": "N-linked glycan contains N-acetyllactosamine and sialic acid. O-linked glycans consist of Gal-GalNAc disaccharide modified with up to 2 sialic acid residues (microheterogeneity).",
"evidence": [
{
"database": "UniProtKB",
"id": "P00747",
"url": "https://www.uniprot.org/uniprot/P00747"
},
{
"database": "PubMed",
"id": "3356193",
"url": "https://glygen.org/publication/PubMed/3356193"
},
{
"database": "PubMed",
"id": "9054441",
"url": "https://glygen.org/publication/PubMed/9054441"
},
{
"database": "PubMed",
"id": "18780401",
"url": "https://glygen.org/publication/PubMed/18780401"
}
]
}
],
"interactions": [],
"reactions": [
{
"id": "R-HSA-1454843",
"name": "E-cadherin degradation by MMP3, MMP7 and plasmin.",
"equation": "",
"summary": "E-cadherin (CDH1) localizes to the lateral membrane of differentiated epithelia, providing the structural foundation for adherens junctions, multiprotein complexes that link cell-cell contacts to the actin cytoskeleton and various signaling molecules (Perez-Moreno et al. 2003, Baum & Georgiou 2011). The extracellular domain has five cadherin-type repeat ectodomain (EC) modules; the most membrane-distal EC mediates binding with CDH1 on adjacent cells (Boggon et al. 2002). Calcium ions bind between the EC domains of two CDH1 peptides to form a dimer with a rod-like conformation (Boggon et al. 2002) which is required for cell-cell interaction (Gumbiner 1996, Patel et al. 2006). The cytoplasmic tail of E-cadherin binds to the armadillo repeat protein beta-catenin, a target of the Wnt signaling pathway and a cofactor for TCF/LEF-mediated transcription (Gavard & M\u00e8ge 2005). Beta-catenin in turn binds alpha-catenin, which interacts with the actin microfilament network, actin and the actin-binding proteins vinculin, formins, alpha-actinin, zonula occludin protein, and afadin (Bershadsky 2004). Cell\u2013cell adhesions also contain desmosomes, which link cell contacts to intermediate filaments, and nectin-based, calcium-independent adhesions, which are linked to actin (Takai & Nakanishi 2003, Yin and Green 2004). The critical importance of E-cadherin to normal development and tissue function is demonstrated by embryonic lethal E-cadherin gene mouse knockouts (Larue et al. 1994). Loss of cadherin-based cell-cell adhesion is a hallmark of carcinogenesis, correlating with tumour progression, allowing cells to escape normal growth control signals, resulting in loss of differentiation and increased cell proliferation associated with invasive behaviour (Frixen et al. 1991, Capaldo & Macara 2007). ; ; Full-length 120-kDa CDH1 protein is cleaved in the ectodomain close to the plasma membrane by a number of metalloproteases, generating an extracellular 38-kDa C-terminal fragment (CTF) termed CTF1 which can be further processed by a gamma-secretase-like activity to a soluble 33-kDa CTF2 (Marambaud et al. 2002, Roy & Berx 2008). MMP3, MMP7 (No\u00eb et al. 2001, canine MMPs), MMP9 (Symowicz et al. 2007), plasmin (Ryniers et al. 2002, canine plasmin), Kallikrien 7 (Johnson et al. 2007), ADAM10 (Maretzky et al. 2005) and ADAM15 (Najy et al. 2008) all cleave CDH1 extracellularly, close to the transmembrane region. ; ; Presenilin-1 (Marambaud et al. 2002), the catalytic subunit of gamma-secretase (Herreman et al. 2003, Li et al. 2003), cleaves CDH1 producing a soluble 33-kDa fragment termed CTF2. Other enzymes like caspase-3 (Steinhusen et al. 2001) and calpain-1 (Rios-Doria et al. 2003) cleave E-cadherin in its cytoplasmic part releasing an intracellular 37 kDa C-terminal fragment.",
"cellular_location": "extracellular region, plasma membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00747-1",
"P09237-1",
"P08254-1"
],
"evidence": [
{
"id": "R-HSA-1454843",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1454843"
}
]
},
{
"id": "R-HSA-1566979",
"name": "Laminin-332 degradation by laminin-322 degrading extracellular proteinases",
"equation": "",
"summary": "Laminins are an important molecular component of the basement membranes (BMs) in a variety of tissue types. They have a cruciform shape, and are composed of three chains, alpha, beta and gamma., all of which have multiple subtypes. At the ultrastructural level, each laminin trimer appears as a cross-like structure with a large globular domain (LG domain) at the base of the cross. The LG domain is the C-terminal domain of the alpha subunit; it is divided into five homologous subdomains LG1-5 (Sugawara et al. 2008). Keratinocytes of the skin secrete numerous laminin isoforms, including laminin-511 and laminin-332. ; ; Laminin-332 undergoes extensive proteolysis following secretion, which is essential for laminin-332 integration into the BM (Rousselle & Beck 2013). The 200 kDa alpha-3 subunit of laminin-332 is cleaved between the LG3-LG4 subdomains to generate a 165 kDa product. The 160 kDa gamma-2 subunit is cleaved at its N-terminus to produce a 105 kDa protein (Marinkovich et al. 1992). Tissue remodeling may lead to further proteolysis of the 105 kDa subunit within the N-terminus giving rise to a 80 kDa protein (Gianelli et al. 1997, Koshikawa et al. 2005). The resulting N-terminal fragment has EGF-like properties and may activate the EGF receptor, inducing cell migration (Schenk et al. 2003). ; ; In much of the early literature it is not clear which subunit of the laminin trimer was cleaved, but in vitro studies have revealed specific enzymes involved in the processing of laminin-332 including MMP2, MMP14 (MT1-MMP), and the C-proteinase family of enzymes, especially bone morphogenic protein 1 (BMP1) and mammalian tolloid (mTLD), isoforms 1 and 3 respectively of UniProt P13497 BMP1 (Sugawara et al. 2008, Rousselle & Beck 2013). Many proteases have been demonstrated to degrade specific subunits of laminin-332. The beta-3 chain is degraded by matrix metalloproteinase 14 (MMP14, MT1-MMP, Udayakumar et al. 2003) and MMP7 (Remy et al. 2006). The alpha-3 chain is degraded by plasmin (Goldfinger et al. 1998, 1999) and BMP1 (and its isoform mTLD, Veitch et al. 2003). Laminin gamma-2 chain is degraded by MMP14 (Koshikawa et al. 2000, 2005, Piril\u00e4 et al. 2003) , MMP2 (Gianelli et al. 1997, Piril\u00e4 et al. 2003), MMP3, 12, 13 (Piril\u00e4 et al. 2003), 19 (Sadowski et al. 2005), MMP20 (V\u00e4\u00e4n\u00e4nen et al. 2001, Piril\u00e4 et al. 2003), BMP1 (Amano et al. 2000, Kessler et al. 2001) and mTLD (Veitch et al. 2003). Plasmin cleavage of laminin-111 yields fragments with sizes that correspond to the cleavage of the alpha and beta/gamma components (Guti\u00e9rrez-Fern\u00e1ndez et al. 2009). ; ; In this reaction laminin-322 is represented with all 3 component peptides cleaved.",
"cellular_location": "extracellular region",
"input_participant_list": [
"R-HSA-216001"
],
"output_participant_list": [
"R-HSA-2533911"
],
"enzyme_list": [
"P39900-1",
"P00747-1",
"P13497-1",
"P08253-1",
"P45452-1",
"P09237-1",
"P08254-1",
"O60882-1",
"Q99542-1"
],
"evidence": [
{
"id": "R-HSA-1566979",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1566979"
}
]
},
{
"id": "R-HSA-158721",
"name": "histidine-rich glycoprotein:plasminogen <-> histidine-rich glycoprotein + plasminogen",
"equation": "",
"summary": "Plasminogen reversibly binds histidine-rich glycoprotein (HRG). The resulting complex interacts poorly with fibrin, suggesting that HRG might have an anti-fibrinolytic (clot-stabilizing) effect in vivo (Lijnen et al. 1980). Consistent with this suggestion, individuals with chronically reduced plasma HRG concentrations are susceptible to thrombosis (Shigekiyo et al. 1998).",
"cellular_location": "extracellular region",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00747-1"
],
"evidence": [
{
"id": "R-HSA-158721",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-158721"
}
]
},
{
"id": "R-HSA-158722",
"name": "histidine-rich glycoprotein + plasminogen <-> histidine-rich glycoprotein:plasminogen",
"equation": "",
"summary": "Plasminogen reversibly binds histidine-rich glycoprotein (HRG). The resulting complex interacts poorly with fibrin, suggesting that HRG might have an anti-fibrinolytic (clot-stabilizing) effect in vivo (Lijnen et al. 1980). Consistent with this suggestion, individuals with chronically reduced plasma HRG concentrations are susceptible to thrombosis (Shigekiyo et al. 1998).",
"cellular_location": "extracellular region",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00747-1"
],
"evidence": [
{
"id": "R-HSA-158722",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-158722"
}
]
},
{
"id": "R-HSA-158744",
"name": "crosslinked fibrin multimer:tissue plasminogen activator (two-chain):plasminogen -> crosslinked fibrin multimer:tissue plasminogen activator (two-chain) + plasmin",
"equation": "",
"summary": "At the beginning of this reaction, 1 molecule of 'fibrin multimer, crosslinked:tissue plasminogen activator (two-chain):plasminogen' is present. At the end of this reaction, 1 molecule of 'plasmin', and 1 molecule of 'fibrin multimer, crosslinked:tissue plasminogen activator (two-chain)' are present.
This reaction takes place in the 'extracellular region' and is mediated by the 'plasminogen activator activity' of 'fibrin multimer, crosslinked:tissue plasminogen activator (two-chain):plasminogen'.
",
"cellular_location": "extracellular region",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00750-1",
"P00747-1"
],
"evidence": [
{
"id": "R-HSA-158744",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-158744"
}
]
},
{
"id": "R-HSA-158747",
"name": "crosslinked fibrin multimer:tissue plasminogen activator (one-chain) -> crosslinked fibrin multimer:tissue plasminogen activator (two-chain)",
"equation": "",
"summary": "Once plasmin has been activated, in the initial stage of the fibrinolysis process, it can catalyze the conversion of fibrin-bound tissue plasminogen activator (one-chain) to its more active two-chain form, increasing the rate at which additional plasminogen molecules can be activated.",
"cellular_location": "extracellular region",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00750-1",
"P00747-1"
],
"evidence": [
{
"id": "R-HSA-158747",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-158747"
}
]
},
{
"id": "R-HSA-158750",
"name": "crosslinked fibrin multimer:tissue plasminogen activator (one-chain):plasminogen -> crosslinked fibrin multimer:tissue plasminogen activator (one-chain) + plasmin",
"equation": "",
"summary": "Plasminogen bound to fibrin is cleaved and activated by tissue plasminogen activator also bound to the fibrin. The association of both plasminogen and tissue plasminogen activator with a fibrin clot juxtaposes the two molecules, facilitating their interaction (Hoylaerts et al. 1982). Early studies suggested that tissue plasminogen activator itself might require activation (conversion to its two-chain form) before it could catalyze this reaction (e.g., Higgins and Vehar 1987). More recent work (Boose et al. 1989) indicates that the single-chain form of the molecule is catalytically active, although cleavage increases its activity and may thus serve to accelerate the later stages of fibrinolysis.
Annexin A2 (ANXA2) is a multicompartmental, multifunctional protein that forms a heterotetramer with its endothelial cell-surface binding partner protein S100-A10 (S100A10) (Rety et al. 1999). The tetramer is able to positively modulate tissue plasminogen activator-dependent activation of the fibrinolytic protease, plasmin from its plasminogen precursor (Luo et al. 2013, Hedhli et al. 2012).",
"cellular_location": "extracellular region",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00750-1",
"P00747-1"
],
"evidence": [
{
"id": "R-HSA-158750",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-158750"
}
]
},
{
"id": "R-HSA-158756",
"name": "crosslinked fibrin multimer:tissue plasminogen activator (two-chain) + plasminogen -> crosslinked fibrin multimer:tissue plasminogen activator (two-chain):plasminogen",
"equation": "",
"summary": "At the beginning of this reaction, 1 molecule of 'plasminogen', and 1 molecule of 'fibrin multimer, crosslinked:tissue plasminogen activator (two-chain)' are present. At the end of this reaction, 1 molecule of 'fibrin multimer, crosslinked:tissue plasminogen activator (two-chain):plasminogen' is present.
This reaction takes place in the 'extracellular region'.
",
"cellular_location": "extracellular region",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00750-1",
"P00747-1"
],
"evidence": [
{
"id": "R-HSA-158756",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-158756"
}
]
},
{
"id": "R-HSA-158766",
"name": "fibrin multimer, crosslinked -> fibrin digestion products (plasmin)",
"equation": "",
"summary": "Plasmin, generated at the surfaces of the fibrin clot by tissue plasminogen activator or at the surfaces of cells by urokinase plasminogen activator, catalyzes the hydrolysis of fibrin to soluble fragments (Chapman 1997).",
"cellular_location": "extracellular region",
"input_participant_list": [],
"output_participant_list": [
"R-ALL-158774"
],
"enzyme_list": [
"P00747-1"
],
"evidence": [
{
"id": "R-HSA-158766",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-158766"
}
]
},
{
"id": "R-HSA-158784",
"name": "crosslinked fibrin multimer:tissue plasminogen activator (one-chain) + plasminogen -> crosslinked fibrin multimer:tissue plasminogen activator (one-chain):plasminogen",
"equation": "",
"summary": "Plasminogen associates with tissue plasminogen activator bound to fibrin.",
"cellular_location": "extracellular region",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00750-1",
"P00747-1"
],
"evidence": [
{
"id": "R-HSA-158784",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-158784"
}
]
},
{
"id": "R-HSA-158893",
"name": "alpha-2-antiplasmin + plasmin -> alpha-2-antiplasmin:plasmin",
"equation": "",
"summary": "Plasmin binds the serpin alpha-2-antiplasmin, forming a stable and catalytically inactive complex. While several serpin proteins bind and inactivate plasmin in vitro, alpha-2-antiplasmin appears to be the only one with substantial plasmin-neutralizing activity in vivo (Moroi and Aoki 1976; Lijnen et al. 1987).",
"cellular_location": "extracellular region",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00747-1"
],
"evidence": [
{
"id": "R-HSA-158893",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-158893"
}
]
},
{
"id": "R-HSA-158925",
"name": "plasminogen:histidine-rich glycoprotein -> plasmin + histidine-rich glycoprotein (uPA [two-chain] catalyst)",
"equation": "",
"summary": "Plasminogen, tethered to the cell surface by its association with histidine-rich glycoprotein, is rapidly cleaved and activated to plasmin by the action of urokinase plasminogen activator(two-chain form) bound to uPAR, its cell-surface receptor. The association of both substrate and enzyme with the cell surface is necessary for the reaction to proceed efficiently (Ellis et al. 1989, 1991).",
"cellular_location": "extracellular region, plasma membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00749-1",
"P00747-1"
],
"evidence": [
{
"id": "R-HSA-158925",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-158925"
}
]
},
{
"id": "R-HSA-158941",
"name": "plasminogen + histidine-rich glycoprotein -> plasminogen:histidine-rich glycoprotein",
"equation": "",
"summary": "Extracellular plasminogen binds with high affinity to histidine-rich glycoprotein on the plasma membrane. Binding requires Zn++ in concentrations higher than those found in normal plasma, but that can be generated, e.g., by platelet activation (Jones et al. 2004).",
"cellular_location": "extracellular region, plasma membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00747-1"
],
"evidence": [
{
"id": "R-HSA-158941",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-158941"
}
]
},
{
"id": "R-HSA-158942",
"name": "urokinase plasminogen activator (one-chain):uPAR -> urokinase plasminogen activator (two-chain):uPAR",
"equation": "",
"summary": "The small amount of plasmin generated by the activity of the one-chain form of urokinase plasminogen activator in turn cleaves urokinase plasminogen activator, converting it to its substantially more active two-chain form (Cubellis et al. 1986; Lijnen et al. 1991).",
"cellular_location": "extracellular region, plasma membrane",
"input_participant_list": [
"R-HSA-158926"
],
"output_participant_list": [
"R-HSA-158969"
],
"enzyme_list": [
"P00749-1",
"P00747-1"
],
"evidence": [
{
"id": "R-HSA-158942",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-158942"
}
]
},
{
"id": "R-HSA-158982",
"name": "plasminogen:histidine-rich glycoprotein -> plasmin + histidine-rich glycoprotein (uPA [one-chain] catalyst)",
"equation": "",
"summary": "Plasminogen, tethered to the cell surface by its association with histidine-rich glycoprotein, is cleaved and activated to plasmin by the action of urokinase plasminogen activator bound to uPAR, its cell-surface receptor. The association of both substrate and enzyme with the cell surface is necessary for the reaction to proceed efficiently (Ellis et al. 1991). While the one-chain form of urokinase plasminogen activator is lower than that of the two-chain form, it is still sufficient to initiate the process of plasmin activation (Ellis et al. 1989; Lijnen et al. 1986).",
"cellular_location": "extracellular region, plasma membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00749-1",
"P00747-1"
],
"evidence": [
{
"id": "R-HSA-158982",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-158982"
}
]
},
{
"id": "R-HSA-1592314",
"name": "HSPG2 (perlecan) degradation by MMP3, plasmin, (MMP12)",
"equation": "",
"summary": "HSPG2 protein (perlecan) consists of a core protein of molecular weight 470 kDa with three long glycosaminoglycan (GAG) chains attached, each approximately 70-100 kDa. These are usually heparan sulphate (HS), but can be chondroitin sulphate (CS). The core protein consists of five distinct structural domains. The N-terminal domain I (aa ~1-195) contains attachment sites for GAG chains. Although GAG chains are not required for correct folding and secretion of the protein, lack of GAG or decreased sulfation can decrease perlecan's ability to interact with matrix proteins. Removal of GAG chains may affect matrix organization and endothelial barrier function. ; ; The GAG chains of HSPG2 bind growth factors in the ECM, and serve as co-ligands or ligand enhancers when bound to receptors. For example, HS-bound FGF was released from cultured cells by treatments with MMP3, rat MMP13, and plasmin (Whitelock et al. 1996). Other MMPs reported to degrade HSPG2 include MMP14 and MMP15 (d'Ortho et al. 1997). MMP12 releases chondroitin sulphate and heparan sulphate from basement membranes (Gronski et al. 1997) and degrades the related aggrecan (Durigova et al. 2011) so may degrade perlecan. Corneal epithelium explant growth correlates with MMP2 expression, an initial degradation of the original basement membrane, and an initial upregulation followed by downregulation of MMP9. However this may not result from direct cleavage of HSPG2 by these MMPs, they may modulate some factor involved in the maturation of basement membrane (Li et al. 2006). The core protein of HSPG2 can be cleaved by cathepsin S (Liuzzo et al. 1999).",
"cellular_location": "extracellular region",
"input_participant_list": [
"R-HSA-1011570"
],
"output_participant_list": [
"R-HSA-2534246",
"R-HSA-2534251"
],
"enzyme_list": [
"P39900-1",
"P00747-1",
"P08254-1"
],
"evidence": [
{
"id": "R-HSA-1592314",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592314"
}
]
},
{
"id": "R-HSA-1592316",
"name": "Initial activation of proMMP1",
"equation": "",
"summary": "ProMMP1 has several activators including plasmin (Eeckhout & Vaes 1977, Werb et al. 1977, Santala et al. 1999), trypsin (Grant et al. 1987, Saunders et al. 2005), plasma kallikrein (Nagase et al. 1982, Saunders et al. 2005), chymase (Saarinen et al. 1994, Suzuki et al. 1995, Saunders et al. 2005), tryptase (Gruber et al. 1989, Suzuki et al. 1995, Saunders et al. 2005), neutrophil elastase, cathepsin G (Saunders et al. 2005) and trypsin-2 (Moilanen et al. 2003). Concanavalin A (ConA) was the first cellular treatment that yielded active MMPs in culture, inducing the cellular activation of MMP1 likely through MMP14 activity (Overall and Sodek 1990).Trypsin-like serine proteinases are believed to remove 34-36 residues from the N-terminus of the secreted pro-enzyme, equivalent to positions 53-55 of the UniProt cannonical sequence which includes a signal peptide. Removal of this region is sufficient to destabilize the Cys92-Zn2+ stabilizing bond (numbered according to the Uniprot canonical sequence, Cys73 when numbered from the N terminus of the secreted peptide as typically represented in the literature) and partially activate enzyme activity. This intermediate form then undergoes autocatalysis at Thr83-Leu84 producing an MMP1 with about 20% of full collagenase activity (Suzuki et al. 1990). Full activation is brought about by a further cleavage at Gln99-Phe100. When first reported, considerable debate surrounded the activation of this archetypical MMP. Divergence of opinion resulted when competing groups studied activation in vitro using chemicals (organomercurials such as aminophenylmecuricacetate), which yield a different autolytic cleavage site in the protease susceptible loop when compared with the site cut by serine proteases such as trypsin. Different specific activities result, but in general the final autolytic cleavage site for all MMPs is the homologous Phe or Tyr at position 100 or 101. When the active enzyme commences here, full activity is realised due to the salt bridge forming between the N-terminal primary amine of the conserved Phe or Tyr with an Asp on helix C that in turn salt bridges to the active site Glu. Termini either side of this position do not result in full activity.",
"cellular_location": "extracellular region",
"input_participant_list": [
"R-HSA-1602455"
],
"output_participant_list": [
"R-HSA-1602470",
"R-HSA-1602471"
],
"enzyme_list": [
"P08246-1",
"P03956-1",
"P00747-1",
"P08311-1",
"Q15661-1",
"P07478-1",
"P03952-1",
"P23946-1",
"P07477-1"
],
"evidence": [
{
"id": "R-HSA-1592316",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592316"
}
]
},
{
"id": "R-HSA-1592371",
"name": "Initial activation of proMMP3",
"equation": "",
"summary": "proMMP3 is activated in a similar manner to pro MMP1 but by a large number of proteinases, including bacterial thermolysin, all cleaving within the region residues 51-56 (Woessner & Nagase 2000). This initiates autocatalysis and cleavage of the His99-Phe100 bond (Nagase et al. 1990, 1991). Residue numbering given here is based on the UniProt canonical sequence.",
"cellular_location": "extracellular region",
"input_participant_list": [
"R-HSA-1604707"
],
"output_participant_list": [
"R-HSA-1604705",
"R-HSA-1604735"
],
"enzyme_list": [
"P17538-1",
"P00747-1",
"P03952-1",
"P07477-1",
"P08254-1"
],
"evidence": [
{
"id": "R-HSA-1592371",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592371"
}
]
},
{
"id": "R-HSA-1592398",
"name": "Activation of proMMP8",
"equation": "",
"summary": "proMMP8 is activated by tissue kallikrein, leukocyte elastase, trypsin and cathepsin G (Capodici et al. 1989, Knauper et al. 1990) probably at the predicted bait region, residues 30-36.",
"cellular_location": "extracellular region",
"input_participant_list": [
"R-HSA-1604708"
],
"output_participant_list": [
"R-HSA-1442475"
],
"enzyme_list": [
"P08246-1",
"P00747-1",
"P20151-1",
"P07477-1",
"P22894-1"
],
"evidence": [
{
"id": "R-HSA-1592398",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592398"
}
]
},
{
"id": "R-HSA-1602458",
"name": "Activation of proMMP10",
"equation": "",
"summary": "proMMP10 is similar in sequence to proMMP3 with just one residue difference in the bait region. The activation mechanism is believed to be similar, namely cleavage in the N-terminal bait region, followed by autocatalytic cleavage at His81-Phe82 (Woessner & Nagasse 2000). proMMP10 is activated by plasmin, trypsin and chymotrypsin.",
"cellular_location": "extracellular region",
"input_participant_list": [
"R-HSA-1604748"
],
"output_participant_list": [
"R-HSA-1442488"
],
"enzyme_list": [
"P17538-1",
"Q6GPI1-1",
"P00747-1",
"P09238-1",
"P07477-1"
],
"evidence": [
{
"id": "R-HSA-1602458",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1602458"
}
]
},
{
"id": "R-HSA-1602488",
"name": "Initial activation of proMMP13 by plasmin and trypsin",
"equation": "",
"summary": "proMMP13 can be activated by plasmin and trypsin initially cleaving at Lys57-Glu58 followed by autoproteolysis at Glu103-Tyr104 (Knauper et al. 1996a).",
"cellular_location": "extracellular region",
"input_participant_list": [
"R-HSA-1604702"
],
"output_participant_list": [
"R-HSA-1604698",
"R-HSA-1604719"
],
"enzyme_list": [
"P00747-1",
"P45452-1",
"P07477-1"
],
"evidence": [
{
"id": "R-HSA-1602488",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1602488"
}
]
},
{
"id": "R-HSA-1604712",
"name": "Initial activation of proMMP7 by trypsin",
"equation": "",
"summary": "proMMP7 (proMatrilysin-1) activation by trypsin occurs via an intermediate cleaved at Lys50-Asn51 which undergoes autocatalysis (Crabbe et al. 1992). Leukocyte elastase and plasmin partially activate MMP7 by an uncharacterized mechanism. Highly sulfated glycosaminoglycans (GAG), such as heparin, chondroitin-4,6-sulfate (CS-E), and dermatan sulfate, markedly enhance (>50-fold) the intermolecular autolytic activation of promatrilysin and the activity of fully active matrilysin (Ra et al. 2009).",
"cellular_location": "extracellular region",
"input_participant_list": [],
"output_participant_list": [
"R-HSA-1604759"
],
"enzyme_list": [
"P08246-1",
"P00747-1",
"P09237-1",
"P07477-1"
],
"evidence": [
{
"id": "R-HSA-1604712",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1604712"
}
]
},
{
"id": "R-HSA-381461",
"name": "Plasmin proteolyzes IGF:IGFBP-3:ALS",
"equation": "",
"summary": "Plasmin cleaves IGFBP-3 in the IGF:IGFBP-3:ALS Complex between amino acids 124 and 125 and between amino acids 187 and 188, releasing IGF.",
"cellular_location": "extracellular region",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00747-1"
],
"evidence": [
{
"id": "R-HSA-381461",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381461"
}
]
},
{
"id": "R-HSA-382061",
"name": "Extracellular processing of novel PDGFs",
"equation": "",
"summary": "During the extracellular proteolytic activation of PDGF-C and PDGF-D chains, the CUB domains is removed and plasmin protease has been shown to proteolytically cleave within the hinge regions, and thus releasing the corresponding growth factor domains. In addition the protease tissue-type plasminogen activator (tPA) is also involved in the activation of PDGF-CC but not able to cleave and activate PDGF-DD.",
"cellular_location": "extracellular region",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00750-1",
"P00747-1"
],
"evidence": [
{
"id": "R-HSA-382061",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382061"
}
]
},
{
"id": "R-HSA-481007",
"name": "Exocytosis of platelet alpha granule contents",
"equation": "",
"summary": "Alpha granules contain mainly polypeptides such as fibrinogen, von Willebrand factor, growth factors and protease inhibitors that supplement thrombin generation at the site of injury. In addtion to their role in hemostasis, platelets also contain angiogenesis stimulators and inhibitors (Italiano et al. 2008).",
"cellular_location": "plasma membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00747-1",
"P04075-1",
"Q8NBM8-1",
"Q8NBX0-1",
"P00746-1",
"P00488-1",
"O00391-1"
],
"evidence": [
{
"id": "R-HSA-481007",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-481007"
}
]
},
{
"id": "R-HSA-9724745",
"name": "PLG(20-810) binds aprotinin",
"equation": "",
"summary": "Fibrinolysis is the process that leads to the breakdown of blood clots by the action of the serine protease plasmin. Aprotinin is a competitive inhibitor of several serine proteases including plasmin (Sperzel & Huetter 2007). It is a monomeric polypeptide derived from bovine lung tissue. By inhibiting the formation of plasmin and thereby inhibiting fibrinolysis, aprotinin can be used to reduce bleeding during complex surgery (Mahdy & Webster 2004).
Aprotinin has been shown to display anti-SARS-CoV-2 activity against four viral isolates (Bojkova et al. 2020). Protease inhibitors such as aprotinin may prevent virus entry into host cells by preventing the cleavage of the spike protein by ceulluar proteases.",
"cellular_location": "extracellular region",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00750-1",
"P00747-1"
],
"evidence": [
{
"id": "R-HSA-9724745",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9724745"
}
]
},
{
"id": "R-HSA-9724753",
"name": "PLG(20-810) binds anti-fibrinolytics",
"equation": "",
"summary": "The plasminogen inhibitors aminocaproic acid (Sun et al. 2002) and tranexamic acid (Sperzel & Huetter 2007, Cheng et al. 2014) can be administered to patients undergoing coronary artery bypass graft surgery to reduce bleeding.",
"cellular_location": "extracellular region",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00750-1",
"P00747-1"
],
"evidence": [
{
"id": "R-HSA-9724753",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9724753"
}
]
},
{
"id": "R-NUL-2534162",
"name": "E-cadherin strand dimer degradation by MMP3, MMP7 and Plasmin",
"equation": "",
"summary": "Full-length 120-kDa CDH1 protein is cleaved in the ectodomain close to the plasma membrane by a number of metalloproteases, generating an extracellular 38-kDa C-terminal fragment (CTF) termed CTF1 which can be further processed by a gamma-secretase-like activity to a soluble 33-kDa CTF2 (Marambaud et al. 2002, Roy & Berx 2008). MMP3, MMP7 (No\u00eb et al. 2001) and plasmin (Ryniers et al. 2002), all cleave dog CDH1 extracellularly, close to the transmembrane region.",
"cellular_location": "extracellular region, plasma membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00747-1",
"P09237-1",
"P08254-1"
],
"evidence": [
{
"id": "R-NUL-2534162",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-NUL-2534162"
}
]
}
],
"reaction_participants": [
{
"participant_id": "R-ALL-158774",
"participant_name": "fibrin digestion products (plasmin) [extracellular region]",
"crossref": [
{
"id": "36080",
"database": "ChEBI",
"url": ""
},
{
"id": "36080",
"database": "ChEBI",
"url": ""
},
{
"id": "36080",
"database": "ChEBI",
"url": ""
},
{
"id": "36080",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-HSA-1011570",
"participant_name": "HSPG2(22-4391) [extracellular region]",
"crossref": [
{
"id": "P98160",
"database": "UniProt",
"url": ""
},
{
"id": "ENST00000374695",
"database": "Ensembl",
"url": ""
},
{
"id": "3SH4",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000363827",
"database": "Ensembl",
"url": ""
},
{
"id": "NP_001278789.1",
"database": "RefSeq",
"url": ""
},
{
"id": "3SH5",
"database": "PDB",
"url": ""
},
{
"id": "HMDBP01713",
"database": "HMDB Protein",
"url": ""
},
{
"id": "16234",
"database": "Orphanet",
"url": ""
},
{
"id": "NP_005520.4",
"database": "RefSeq",
"url": ""
},
{
"id": "P98160",
"database": "PRO",
"url": ""
},
{
"id": "ENSG00000142798",
"database": "Ensembl",
"url": ""
},
{
"id": "P98160",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "ENSG00000142798",
"database": "OpenTargets",
"url": ""
},
{
"id": "ENSG00000142798-HSPG2",
"database": "HPA",
"url": ""
},
{
"id": "P98160",
"database": "GeneCards",
"url": ""
}
]
},
{
"participant_id": "R-HSA-1442475",
"participant_name": "MMP8 [extracellular region]",
"crossref": [
{
"id": "3.4.24.34",
"database": "IntEnz",
"url": ""
},
{
"id": "NP_002415.1",
"database": "RefSeq",
"url": ""
},
{
"id": "1I73",
"database": "PDB",
"url": ""
},
{
"id": "MMP8_HUMAN",
"database": "ZINC - Metabolites",
"url": ""
},
{
"id": "ENST00000236826",
"database": "Ensembl",
"url": ""
},
{
"id": "MMP8_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "MMP8_HUMAN",
"database": "ZINC - Biogenic",
"url": ""
},
{
"id": "1MMB",
"database": "PDB",
"url": ""
},
{
"id": "1A85",
"database": "PDB",
"url": ""
},
{
"id": "1JAN",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000118113",
"database": "Ensembl",
"url": ""
},
{
"id": "1ZS0",
"database": "PDB",
"url": ""
},
{
"id": "1JJ9",
"database": "PDB",
"url": ""
},
{
"id": "3DPE",
"database": "PDB",
"url": ""
},
{
"id": "1JAP",
"database": "PDB",
"url": ""
},
{
"id": "1JAO",
"database": "PDB",
"url": ""
},
{
"id": "2OY4",
"database": "PDB",
"url": ""
},
{
"id": "HMDBP07814",
"database": "HMDB Protein",
"url": ""
},
{
"id": "1MNC",
"database": "PDB",
"url": ""
},
{
"id": "1JH1",
"database": "PDB",
"url": ""
},
{
"id": "MMP8_HUMAN",
"database": "ZINC - Investigational",
"url": ""
},
{
"id": "3DNG",
"database": "PDB",
"url": ""
},
{
"id": "NP_001291371.1",
"database": "RefSeq",
"url": ""
},
{
"id": "P22894",
"database": "UniProt",
"url": ""
},
{
"id": "ENSG00000118113",
"database": "OpenTargets",
"url": ""
},
{
"id": "1KBC",
"database": "PDB",
"url": ""
},
{
"id": "NP_001291370.1",
"database": "RefSeq",
"url": ""
},
{
"id": "4QKZ",
"database": "PDB",
"url": ""
},
{
"id": "3TT4",
"database": "PDB",
"url": ""
},
{
"id": "1JAQ",
"database": "PDB",
"url": ""
},
{
"id": "P22894",
"database": "PRO",
"url": ""
},
{
"id": "ENSP00000236826",
"database": "Ensembl",
"url": ""
},
{
"id": "1632",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "MMP8_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "3DPF",
"database": "PDB",
"url": ""
},
{
"id": "2OY2",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000118113-MMP8",
"database": "HPA",
"url": ""
},
{
"id": "MMP8_HUMAN",
"database": "ZINC - World Drugs",
"url": ""
},
{
"id": "5H8X",
"database": "PDB",
"url": ""
},
{
"id": "1BZS",
"database": "PDB",
"url": ""
},
{
"id": "1I76",
"database": "PDB",
"url": ""
},
{
"id": "P22894",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "1A86",
"database": "PDB",
"url": ""
},
{
"id": "1ZP5",
"database": "PDB",
"url": ""
},
{
"id": "1ZVX",
"database": "PDB",
"url": ""
},
{
"id": "P22894",
"database": "ZINC target",
"url": ""
},
{
"id": "P22894",
"database": "GeneCards",
"url": ""
}
]
},
{
"participant_id": "R-HSA-1442488",
"participant_name": "MMP10 [extracellular region]",
"crossref": [
{
"id": "MMP10_HUMAN",
"database": "ZINC - Investigational",
"url": ""
},
{
"id": "P09238",
"database": "ZINC target",
"url": ""
},
{
"id": "3.4.24.22",
"database": "IntEnz",
"url": ""
},
{
"id": "ENSG00000166670-MMP10",
"database": "HPA",
"url": ""
},
{
"id": "HMDBP07801",
"database": "HMDB Protein",
"url": ""
},
{
"id": "P09238",
"database": "UniProt",
"url": ""
},
{
"id": "ENSG00000166670",
"database": "Ensembl",
"url": ""
},
{
"id": "3V96",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000279441",
"database": "Ensembl",
"url": ""
},
{
"id": "NP_002416.1",
"database": "RefSeq",
"url": ""
},
{
"id": "4ILW",
"database": "PDB",
"url": ""
},
{
"id": "MMP10_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "P09238",
"database": "GeneCards",
"url": ""
},
{
"id": "MMP10_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "P09238",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "1Q3A",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000279441",
"database": "Ensembl",
"url": ""
},
{
"id": "1634",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "P09238",
"database": "PRO",
"url": ""
},
{
"id": "ENSG00000166670",
"database": "OpenTargets",
"url": ""
}
]
},
{
"participant_id": "R-HSA-158926",
"participant_name": "PLAU(21-431):PI-PLAUR [plasma membrane]",
"crossref": [
{
"id": "CPX-487",
"database": "ComplexPortal",
"url": ""
}
]
},
{
"participant_id": "R-HSA-158969",
"participant_name": "PI-PLAUR:PLAU(21-177):PLAU(179-431) [plasma membrane]",
"crossref": [
{
"id": "CPX-487",
"database": "ComplexPortal",
"url": ""
}
]
},
{
"participant_id": "R-HSA-1602455",
"participant_name": "MMP1(20-469) [extracellular region]",
"crossref": [
{
"id": "P03956",
"database": "UniProt",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "3SHI",
"database": "PDB",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - World Drugs",
"url": ""
},
{
"id": "3AYK",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000322788",
"database": "Ensembl",
"url": ""
},
{
"id": "1CGF",
"database": "PDB",
"url": ""
},
{
"id": "P03956",
"database": "ZINC target",
"url": ""
},
{
"id": "ENST00000315274",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSG00000196611",
"database": "Ensembl",
"url": ""
},
{
"id": "1628",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "1CGL",
"database": "PDB",
"url": ""
},
{
"id": "21204",
"database": "Orphanet",
"url": ""
},
{
"id": "2J0T",
"database": "PDB",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Biogenic",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - FDA approved",
"url": ""
},
{
"id": "P03956",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "2TCL",
"database": "PDB",
"url": ""
},
{
"id": "HMDBP02457",
"database": "HMDB Protein",
"url": ""
},
{
"id": "1CGE",
"database": "PDB",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Metabolites",
"url": ""
},
{
"id": "1AYK",
"database": "PDB",
"url": ""
},
{
"id": "966C",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000196611",
"database": "OpenTargets",
"url": ""
},
{
"id": "2AYK",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000196611-MMP1",
"database": "HPA",
"url": ""
},
{
"id": "2CLT",
"database": "PDB",
"url": ""
},
{
"id": "NP_002412.1",
"database": "RefSeq",
"url": ""
},
{
"id": "4AUO",
"database": "PDB",
"url": ""
},
{
"id": "4AYK",
"database": "PDB",
"url": ""
},
{
"id": "P03956",
"database": "GeneCards",
"url": ""
},
{
"id": "1SU3",
"database": "PDB",
"url": ""
},
{
"id": "1HFC",
"database": "PDB",
"url": ""
},
{
"id": "P03956",
"database": "PRO",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Investigational",
"url": ""
}
]
},
{
"participant_id": "R-HSA-1602470",
"participant_name": "MMP1(54-469) [extracellular region]",
"crossref": [
{
"id": "ENSP00000322788",
"database": "Ensembl",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Metabolites",
"url": ""
},
{
"id": "4AUO",
"database": "PDB",
"url": ""
},
{
"id": "2J0T",
"database": "PDB",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "2AYK",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000196611",
"database": "Ensembl",
"url": ""
},
{
"id": "1HFC",
"database": "PDB",
"url": ""
},
{
"id": "P03956",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Investigational",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "P03956",
"database": "GeneCards",
"url": ""
},
{
"id": "P03956",
"database": "ZINC target",
"url": ""
},
{
"id": "966C",
"database": "PDB",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - World Drugs",
"url": ""
},
{
"id": "HMDBP02457",
"database": "HMDB Protein",
"url": ""
},
{
"id": "2CLT",
"database": "PDB",
"url": ""
},
{
"id": "1CGL",
"database": "PDB",
"url": ""
},
{
"id": "P03956",
"database": "UniProt",
"url": ""
},
{
"id": "2TCL",
"database": "PDB",
"url": ""
},
{
"id": "3SHI",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000196611-MMP1",
"database": "HPA",
"url": ""
},
{
"id": "1628",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "4AYK",
"database": "PDB",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Biogenic",
"url": ""
},
{
"id": "1CGF",
"database": "PDB",
"url": ""
},
{
"id": "1AYK",
"database": "PDB",
"url": ""
},
{
"id": "P03956",
"database": "PRO",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - FDA approved",
"url": ""
},
{
"id": "1SU3",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000315274",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSG00000196611",
"database": "OpenTargets",
"url": ""
},
{
"id": "3AYK",
"database": "PDB",
"url": ""
},
{
"id": "1CGE",
"database": "PDB",
"url": ""
},
{
"id": "NP_002412.1",
"database": "RefSeq",
"url": ""
},
{
"id": "21204",
"database": "Orphanet",
"url": ""
}
]
},
{
"participant_id": "R-HSA-1602471",
"participant_name": "MMP1(20-53) [extracellular region]",
"crossref": [
{
"id": "3AYK",
"database": "PDB",
"url": ""
},
{
"id": "1CGE",
"database": "PDB",
"url": ""
},
{
"id": "NP_002412.1",
"database": "RefSeq",
"url": ""
},
{
"id": "21204",
"database": "Orphanet",
"url": ""
},
{
"id": "P03956",
"database": "UniProt",
"url": ""
},
{
"id": "ENSG00000196611",
"database": "OpenTargets",
"url": ""
},
{
"id": "ENST00000315274",
"database": "Ensembl",
"url": ""
},
{
"id": "1SU3",
"database": "PDB",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - FDA approved",
"url": ""
},
{
"id": "P03956",
"database": "PRO",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Biogenic",
"url": ""
},
{
"id": "4AYK",
"database": "PDB",
"url": ""
},
{
"id": "1CGF",
"database": "PDB",
"url": ""
},
{
"id": "1AYK",
"database": "PDB",
"url": ""
},
{
"id": "3SHI",
"database": "PDB",
"url": ""
},
{
"id": "2TCL",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000196611-MMP1",
"database": "HPA",
"url": ""
},
{
"id": "1628",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Investigational",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "P03956",
"database": "GeneCards",
"url": ""
},
{
"id": "P03956",
"database": "ZINC target",
"url": ""
},
{
"id": "966C",
"database": "PDB",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - World Drugs",
"url": ""
},
{
"id": "HMDBP02457",
"database": "HMDB Protein",
"url": ""
},
{
"id": "2CLT",
"database": "PDB",
"url": ""
},
{
"id": "1CGL",
"database": "PDB",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Metabolites",
"url": ""
},
{
"id": "ENSP00000322788",
"database": "Ensembl",
"url": ""
},
{
"id": "4AUO",
"database": "PDB",
"url": ""
},
{
"id": "2J0T",
"database": "PDB",
"url": ""
},
{
"id": "1HFC",
"database": "PDB",
"url": ""
},
{
"id": "P03956",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "ENSG00000196611",
"database": "Ensembl",
"url": ""
},
{
"id": "2AYK",
"database": "PDB",
"url": ""
}
]
},
{
"participant_id": "R-HSA-1604698",
"participant_name": "MMP13(58-471) [extracellular region]",
"crossref": [
{
"id": "16452",
"database": "Orphanet",
"url": ""
},
{
"id": "3KRY",
"database": "PDB",
"url": ""
},
{
"id": "2YIG",
"database": "PDB",
"url": ""
},
{
"id": "1PEX",
"database": "PDB",
"url": ""
},
{
"id": "2OZR",
"database": "PDB",
"url": ""
},
{
"id": "1XUD",
"database": "PDB",
"url": ""
},
{
"id": "5UWN",
"database": "PDB",
"url": ""
},
{
"id": "NP_002418.1",
"database": "RefSeq",
"url": ""
},
{
"id": "P45452",
"database": "UniProt",
"url": ""
},
{
"id": "MMP13_HUMAN",
"database": "ZINC - Metabolites",
"url": ""
},
{
"id": "MMP13_HUMAN",
"database": "ZINC - Biogenic",
"url": ""
},
{
"id": "4A7B",
"database": "PDB",
"url": ""
},
{
"id": "830C",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000260302",
"database": "Ensembl",
"url": ""
},
{
"id": "3KEC",
"database": "PDB",
"url": ""
},
{
"id": "5UWM",
"database": "PDB",
"url": ""
},
{
"id": "MMP13_HUMAN",
"database": "ZINC - Investigational",
"url": ""
},
{
"id": "ENSP00000260302",
"database": "Ensembl",
"url": ""
},
{
"id": "456C",
"database": "PDB",
"url": ""
},
{
"id": "3ZXH",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000137745",
"database": "OpenTargets",
"url": ""
},
{
"id": "5B5P",
"database": "PDB",
"url": ""
},
{
"id": "1FLS",
"database": "PDB",
"url": ""
},
{
"id": "1EUB",
"database": "PDB",
"url": ""
},
{
"id": "4JPA",
"database": "PDB",
"url": ""
},
{
"id": "3WV3",
"database": "PDB",
"url": ""
},
{
"id": "P45452",
"database": "GeneCards",
"url": ""
},
{
"id": "5BOY",
"database": "PDB",
"url": ""
},
{
"id": "2PJT",
"database": "PDB",
"url": ""
},
{
"id": "3O2X",
"database": "PDB",
"url": ""
},
{
"id": "2OW9",
"database": "PDB",
"url": ""
},
{
"id": "1XUR",
"database": "PDB",
"url": ""
},
{
"id": "MMP13_HUMAN",
"database": "ZINC - World Drugs",
"url": ""
},
{
"id": "5B5O",
"database": "PDB",
"url": ""
},
{
"id": "2D1N",
"database": "PDB",
"url": ""
},
{
"id": "2E2D",
"database": "PDB",
"url": ""
},
{
"id": "1ZTQ",
"database": "PDB",
"url": ""
},
{
"id": "HMDBP02183",
"database": "HMDB Protein",
"url": ""
},
{
"id": "4JP4",
"database": "PDB",
"url": ""
},
{
"id": "5UWK",
"database": "PDB",
"url": ""
},
{
"id": "3ELM",
"database": "PDB",
"url": ""
},
{
"id": "4L19",
"database": "PDB",
"url": ""
},
{
"id": "P45452",
"database": "PRO",
"url": ""
},
{
"id": "1FM1",
"database": "PDB",
"url": ""
},
{
"id": "3KEJ",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000137745-MMP13",
"database": "HPA",
"url": ""
},
{
"id": "5UWL",
"database": "PDB",
"url": ""
},
{
"id": "4FVL",
"database": "PDB",
"url": ""
},
{
"id": "3WV2",
"database": "PDB",
"url": ""
},
{
"id": "5BPA",
"database": "PDB",
"url": ""
},
{
"id": "P45452",
"database": "ZINC target",
"url": ""
},
{
"id": "3LJZ",
"database": "PDB",
"url": ""
},
{
"id": "3KEK",
"database": "PDB",
"url": ""
},
{
"id": "MMP13_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "P45452",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "1YOU",
"database": "PDB",
"url": ""
},
{
"id": "4G0D",
"database": "PDB",
"url": ""
},
{
"id": "7JU8",
"database": "PDB",
"url": ""
},
{
"id": "3TVC",
"database": "PDB",
"url": ""
},
{
"id": "3I7I",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000137745",
"database": "Ensembl",
"url": ""
},
{
"id": "5BOT",
"database": "PDB",
"url": ""
},
{
"id": "1XUC",
"database": "PDB",
"url": ""
},
{
"id": "1637",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "MMP13_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "3I7G",
"database": "PDB",
"url": ""
},
{
"id": "4FU4",
"database": "PDB",
"url": ""
},
{
"id": "3WV1",
"database": "PDB",
"url": ""
}
]
},
{
"participant_id": "R-HSA-1604702",
"participant_name": "MMP13(20-471) [extracellular region]",
"crossref": [
{
"id": "P45452",
"database": "UniProt",
"url": ""
},
{
"id": "3LJZ",
"database": "PDB",
"url": ""
},
{
"id": "P45452",
"database": "GeneCards",
"url": ""
},
{
"id": "1FM1",
"database": "PDB",
"url": ""
},
{
"id": "3KRY",
"database": "PDB",
"url": ""
},
{
"id": "MMP13_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "1FLS",
"database": "PDB",
"url": ""
},
{
"id": "5UWK",
"database": "PDB",
"url": ""
},
{
"id": "MMP13_HUMAN",
"database": "ZINC - Biogenic",
"url": ""
},
{
"id": "MMP13_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "MMP13_HUMAN",
"database": "ZINC - World Drugs",
"url": ""
},
{
"id": "5BPA",
"database": "PDB",
"url": ""
},
{
"id": "5UWN",
"database": "PDB",
"url": ""
},
{
"id": "3TVC",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000137745",
"database": "OpenTargets",
"url": ""
},
{
"id": "HMDBP02183",
"database": "HMDB Protein",
"url": ""
},
{
"id": "5UWM",
"database": "PDB",
"url": ""
},
{
"id": "1XUC",
"database": "PDB",
"url": ""
},
{
"id": "3O2X",
"database": "PDB",
"url": ""
},
{
"id": "5UWL",
"database": "PDB",
"url": ""
},
{
"id": "1PEX",
"database": "PDB",
"url": ""
},
{
"id": "1YOU",
"database": "PDB",
"url": ""
},
{
"id": "3WV3",
"database": "PDB",
"url": ""
},
{
"id": "P45452",
"database": "PRO",
"url": ""
},
{
"id": "830C",
"database": "PDB",
"url": ""
},
{
"id": "3WV1",
"database": "PDB",
"url": ""
},
{
"id": "1XUR",
"database": "PDB",
"url": ""
},
{
"id": "3WV2",
"database": "PDB",
"url": ""
},
{
"id": "1XUD",
"database": "PDB",
"url": ""
},
{
"id": "7JU8",
"database": "PDB",
"url": ""
},
{
"id": "456C",
"database": "PDB",
"url": ""
},
{
"id": "2E2D",
"database": "PDB",
"url": ""
},
{
"id": "3KEC",
"database": "PDB",
"url": ""
},
{
"id": "5BOT",
"database": "PDB",
"url": ""
},
{
"id": "5BOY",
"database": "PDB",
"url": ""
},
{
"id": "3KEJ",
"database": "PDB",
"url": ""
},
{
"id": "16452",
"database": "Orphanet",
"url": ""
},
{
"id": "3KEK",
"database": "PDB",
"url": ""
},
{
"id": "1EUB",
"database": "PDB",
"url": ""
},
{
"id": "3ELM",
"database": "PDB",
"url": ""
},
{
"id": "MMP13_HUMAN",
"database": "ZINC - Metabolites",
"url": ""
},
{
"id": "3I7G",
"database": "PDB",
"url": ""
},
{
"id": "5B5O",
"database": "PDB",
"url": ""
},
{
"id": "P45452",
"database": "ZINC target",
"url": ""
},
{
"id": "NP_002418.1",
"database": "RefSeq",
"url": ""
},
{
"id": "3I7I",
"database": "PDB",
"url": ""
},
{
"id": "5B5P",
"database": "PDB",
"url": ""
},
{
"id": "4JP4",
"database": "PDB",
"url": ""
},
{
"id": "MMP13_HUMAN",
"database": "ZINC - Investigational",
"url": ""
},
{
"id": "1637",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "2PJT",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000137745-MMP13",
"database": "HPA",
"url": ""
},
{
"id": "2YIG",
"database": "PDB",
"url": ""
},
{
"id": "P45452",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "4JPA",
"database": "PDB",
"url": ""
},
{
"id": "4L19",
"database": "PDB",
"url": ""
},
{
"id": "4A7B",
"database": "PDB",
"url": ""
},
{
"id": "4FU4",
"database": "PDB",
"url": ""
},
{
"id": "2OW9",
"database": "PDB",
"url": ""
},
{
"id": "4FVL",
"database": "PDB",
"url": ""
},
{
"id": "2OZR",
"database": "PDB",
"url": ""
},
{
"id": "4G0D",
"database": "PDB",
"url": ""
},
{
"id": "3ZXH",
"database": "PDB",
"url": ""
},
{
"id": "1ZTQ",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000260302",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSG00000137745",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSP00000260302",
"database": "Ensembl",
"url": ""
},
{
"id": "2D1N",
"database": "PDB",
"url": ""
}
]
},
{
"participant_id": "R-HSA-1604705",
"participant_name": "MMP3(18-54) [extracellular region]",
"crossref": [
{
"id": "1CQR",
"database": "PDB",
"url": ""
},
{
"id": "6MAV",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000149968",
"database": "OpenTargets",
"url": ""
},
{
"id": "1C3I",
"database": "PDB",
"url": ""
},
{
"id": "1BM6",
"database": "PDB",
"url": ""
},
{
"id": "MMP3_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "1D7X",
"database": "PDB",
"url": ""
},
{
"id": "1G49",
"database": "PDB",
"url": ""
},
{
"id": "MMP3_HUMAN",
"database": "ZINC - Metabolites",
"url": ""
},
{
"id": "1D5J",
"database": "PDB",
"url": ""
},
{
"id": "7S7M",
"database": "PDB",
"url": ""
},
{
"id": "1CIZ",
"database": "PDB",
"url": ""
},
{
"id": "1D8M",
"database": "PDB",
"url": ""
},
{
"id": "6N9D",
"database": "PDB",
"url": ""
},
{
"id": "2JT6",
"database": "PDB",
"url": ""
},
{
"id": "1G4K",
"database": "PDB",
"url": ""
},
{
"id": "1G05",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000299855",
"database": "Ensembl",
"url": ""
},
{
"id": "1OO9",
"database": "PDB",
"url": ""
},
{
"id": "P08254",
"database": "ZINC target",
"url": ""
},
{
"id": "1SLN",
"database": "PDB",
"url": ""
},
{
"id": "1HFS",
"database": "PDB",
"url": ""
},
{
"id": "NP_002413.1",
"database": "RefSeq",
"url": ""
},
{
"id": "1CAQ",
"database": "PDB",
"url": ""
},
{
"id": "P08254",
"database": "PRO",
"url": ""
},
{
"id": "1B3D",
"database": "PDB",
"url": ""
},
{
"id": "1USN",
"database": "PDB",
"url": ""
},
{
"id": "4G9L",
"database": "PDB",
"url": ""
},
{
"id": "MMP3_HUMAN",
"database": "ZINC - Investigational",
"url": ""
},
{
"id": "ENSG00000149968-MMP3",
"database": "HPA",
"url": ""
},
{
"id": "P08254",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "P08254",
"database": "UniProt",
"url": ""
},
{
"id": "HMDBP02592",
"database": "HMDB Protein",
"url": ""
},
{
"id": "MMP3_HUMAN",
"database": "ZINC - World Drugs",
"url": ""
},
{
"id": "1QIC",
"database": "PDB",
"url": ""
},
{
"id": "1UEA",
"database": "PDB",
"url": ""
},
{
"id": "7S7L",
"database": "PDB",
"url": ""
},
{
"id": "1HY7",
"database": "PDB",
"url": ""
},
{
"id": "2JT5",
"database": "PDB",
"url": ""
},
{
"id": "1UMS",
"database": "PDB",
"url": ""
},
{
"id": "1SLM",
"database": "PDB",
"url": ""
},
{
"id": "3USN",
"database": "PDB",
"url": ""
},
{
"id": "P08254",
"database": "GeneCards",
"url": ""
},
{
"id": "3OHO",
"database": "PDB",
"url": ""
},
{
"id": "2USN",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000299855",
"database": "Ensembl",
"url": ""
},
{
"id": "4JA1",
"database": "PDB",
"url": ""
},
{
"id": "1BIW",
"database": "PDB",
"url": ""
},
{
"id": "1630",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "1QIA",
"database": "PDB",
"url": ""
},
{
"id": "2D1O",
"database": "PDB",
"url": ""
},
{
"id": "4DPE",
"database": "PDB",
"url": ""
},
{
"id": "MMP3_HUMAN",
"database": "ZINC - Biogenic",
"url": ""
},
{
"id": "1UMT",
"database": "PDB",
"url": ""
},
{
"id": "MMP3_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "3OHL",
"database": "PDB",
"url": ""
},
{
"id": "2SRT",
"database": "PDB",
"url": ""
},
{
"id": "1D8F",
"database": "PDB",
"url": ""
},
{
"id": "1B8Y",
"database": "PDB",
"url": ""
},
{
"id": "1C8T",
"database": "PDB",
"url": ""
},
{
"id": "2JNP",
"database": "PDB",
"url": ""
},
{
"id": "1BQO",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000149968",
"database": "Ensembl",
"url": ""
}
]
},
{
"participant_id": "R-HSA-1604707",
"participant_name": "MMP3(18-477) [extracellular region]",
"crossref": [
{
"id": "P08254",
"database": "UniProt",
"url": ""
},
{
"id": "1G4K",
"database": "PDB",
"url": ""
},
{
"id": "3OHO",
"database": "PDB",
"url": ""
},
{
"id": "1G49",
"database": "PDB",
"url": ""
},
{
"id": "3OHL",
"database": "PDB",
"url": ""
},
{
"id": "4G9L",
"database": "PDB",
"url": ""
},
{
"id": "1HY7",
"database": "PDB",
"url": ""
},
{
"id": "MMP3_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "4DPE",
"database": "PDB",
"url": ""
},
{
"id": "1HFS",
"database": "PDB",
"url": ""
},
{
"id": "3USN",
"database": "PDB",
"url": ""
},
{
"id": "6N9D",
"database": "PDB",
"url": ""
},
{
"id": "1B8Y",
"database": "PDB",
"url": ""
},
{
"id": "1B3D",
"database": "PDB",
"url": ""
},
{
"id": "1QIC",
"database": "PDB",
"url": ""
},
{
"id": "6MAV",
"database": "PDB",
"url": ""
},
{
"id": "1QIA",
"database": "PDB",
"url": ""
},
{
"id": "1OO9",
"database": "PDB",
"url": ""
},
{
"id": "4JA1",
"database": "PDB",
"url": ""
},
{
"id": "7S7M",
"database": "PDB",
"url": ""
},
{
"id": "1BQO",
"database": "PDB",
"url": ""
},
{
"id": "P08254",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "7S7L",
"database": "PDB",
"url": ""
},
{
"id": "1BM6",
"database": "PDB",
"url": ""
},
{
"id": "MMP3_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "1SLN",
"database": "PDB",
"url": ""
},
{
"id": "1SLM",
"database": "PDB",
"url": ""
},
{
"id": "1D8M",
"database": "PDB",
"url": ""
},
{
"id": "2SRT",
"database": "PDB",
"url": ""
},
{
"id": "P08254",
"database": "PRO",
"url": ""
},
{
"id": "HMDBP02592",
"database": "HMDB Protein",
"url": ""
},
{
"id": "ENSG00000149968",
"database": "OpenTargets",
"url": ""
},
{
"id": "1630",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "1G05",
"database": "PDB",
"url": ""
},
{
"id": "2USN",
"database": "PDB",
"url": ""
},
{
"id": "MMP3_HUMAN",
"database": "ZINC - Metabolites",
"url": ""
},
{
"id": "2JNP",
"database": "PDB",
"url": ""
},
{
"id": "MMP3_HUMAN",
"database": "ZINC - Investigational",
"url": ""
},
{
"id": "2JT5",
"database": "PDB",
"url": ""
},
{
"id": "1D7X",
"database": "PDB",
"url": ""
},
{
"id": "MMP3_HUMAN",
"database": "ZINC - Biogenic",
"url": ""
},
{
"id": "NP_002413.1",
"database": "RefSeq",
"url": ""
},
{
"id": "P08254",
"database": "GeneCards",
"url": ""
},
{
"id": "2JT6",
"database": "PDB",
"url": ""
},
{
"id": "1D8F",
"database": "PDB",
"url": ""
},
{
"id": "1USN",
"database": "PDB",
"url": ""
},
{
"id": "MMP3_HUMAN",
"database": "ZINC - World Drugs",
"url": ""
},
{
"id": "1CQR",
"database": "PDB",
"url": ""
},
{
"id": "2D1O",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000299855",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSP00000299855",
"database": "Ensembl",
"url": ""
},
{
"id": "1D5J",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000149968",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSG00000149968-MMP3",
"database": "HPA",
"url": ""
},
{
"id": "1UEA",
"database": "PDB",
"url": ""
},
{
"id": "1C3I",
"database": "PDB",
"url": ""
},
{
"id": "1UMT",
"database": "PDB",
"url": ""
},
{
"id": "P08254",
"database": "ZINC target",
"url": ""
},
{
"id": "1UMS",
"database": "PDB",
"url": ""
},
{
"id": "1CIZ",
"database": "PDB",
"url": ""
},
{
"id": "1C8T",
"database": "PDB",
"url": ""
},
{
"id": "1CAQ",
"database": "PDB",
"url": ""
},
{
"id": "1BIW",
"database": "PDB",
"url": ""
}
]
},
{
"participant_id": "R-HSA-1604708",
"participant_name": "MMP8(21-467) [extracellular region]",
"crossref": [
{
"id": "P22894",
"database": "UniProt",
"url": ""
},
{
"id": "P22894",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "1ZS0",
"database": "PDB",
"url": ""
},
{
"id": "1632",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "MMP8_HUMAN",
"database": "ZINC - Investigational",
"url": ""
},
{
"id": "5H8X",
"database": "PDB",
"url": ""
},
{
"id": "MMP8_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "4QKZ",
"database": "PDB",
"url": ""
},
{
"id": "1JAO",
"database": "PDB",
"url": ""
},
{
"id": "1ZP5",
"database": "PDB",
"url": ""
},
{
"id": "1JAN",
"database": "PDB",
"url": ""
},
{
"id": "P22894",
"database": "PRO",
"url": ""
},
{
"id": "1MNC",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000118113-MMP8",
"database": "HPA",
"url": ""
},
{
"id": "1I73",
"database": "PDB",
"url": ""
},
{
"id": "1KBC",
"database": "PDB",
"url": ""
},
{
"id": "3DPE",
"database": "PDB",
"url": ""
},
{
"id": "P22894",
"database": "GeneCards",
"url": ""
},
{
"id": "1MMB",
"database": "PDB",
"url": ""
},
{
"id": "3DPF",
"database": "PDB",
"url": ""
},
{
"id": "NP_001291371.1",
"database": "RefSeq",
"url": ""
},
{
"id": "1I76",
"database": "PDB",
"url": ""
},
{
"id": "NP_002415.1",
"database": "RefSeq",
"url": ""
},
{
"id": "3TT4",
"database": "PDB",
"url": ""
},
{
"id": "2OY4",
"database": "PDB",
"url": ""
},
{
"id": "1A86",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000118113",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSP00000236826",
"database": "Ensembl",
"url": ""
},
{
"id": "1JH1",
"database": "PDB",
"url": ""
},
{
"id": "MMP8_HUMAN",
"database": "ZINC - World Drugs",
"url": ""
},
{
"id": "ENST00000236826",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSG00000118113",
"database": "OpenTargets",
"url": ""
},
{
"id": "1JJ9",
"database": "PDB",
"url": ""
},
{
"id": "P22894",
"database": "ZINC target",
"url": ""
},
{
"id": "MMP8_HUMAN",
"database": "ZINC - Biogenic",
"url": ""
},
{
"id": "MMP8_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "3DNG",
"database": "PDB",
"url": ""
},
{
"id": "1BZS",
"database": "PDB",
"url": ""
},
{
"id": "3.4.24.34",
"database": "IntEnz",
"url": ""
},
{
"id": "NP_001291370.1",
"database": "RefSeq",
"url": ""
},
{
"id": "1JAP",
"database": "PDB",
"url": ""
},
{
"id": "1ZVX",
"database": "PDB",
"url": ""
},
{
"id": "1A85",
"database": "PDB",
"url": ""
},
{
"id": "1JAQ",
"database": "PDB",
"url": ""
},
{
"id": "HMDBP07814",
"database": "HMDB Protein",
"url": ""
},
{
"id": "2OY2",
"database": "PDB",
"url": ""
},
{
"id": "MMP8_HUMAN",
"database": "ZINC - Metabolites",
"url": ""
}
]
},
{
"participant_id": "R-HSA-1604719",
"participant_name": "MMP13(20-57) [extracellular region]",
"crossref": [
{
"id": "1EUB",
"database": "PDB",
"url": ""
},
{
"id": "4JPA",
"database": "PDB",
"url": ""
},
{
"id": "3WV3",
"database": "PDB",
"url": ""
},
{
"id": "1FLS",
"database": "PDB",
"url": ""
},
{
"id": "5B5P",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000137745",
"database": "OpenTargets",
"url": ""
},
{
"id": "3ZXH",
"database": "PDB",
"url": ""
},
{
"id": "456C",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000260302",
"database": "Ensembl",
"url": ""
},
{
"id": "5BOY",
"database": "PDB",
"url": ""
},
{
"id": "3O2X",
"database": "PDB",
"url": ""
},
{
"id": "2PJT",
"database": "PDB",
"url": ""
},
{
"id": "MMP13_HUMAN",
"database": "ZINC - World Drugs",
"url": ""
},
{
"id": "5B5O",
"database": "PDB",
"url": ""
},
{
"id": "2OW9",
"database": "PDB",
"url": ""
},
{
"id": "1XUR",
"database": "PDB",
"url": ""
},
{
"id": "P45452",
"database": "GeneCards",
"url": ""
},
{
"id": "16452",
"database": "Orphanet",
"url": ""
},
{
"id": "3KRY",
"database": "PDB",
"url": ""
},
{
"id": "2YIG",
"database": "PDB",
"url": ""
},
{
"id": "1PEX",
"database": "PDB",
"url": ""
},
{
"id": "2OZR",
"database": "PDB",
"url": ""
},
{
"id": "1XUD",
"database": "PDB",
"url": ""
},
{
"id": "5UWN",
"database": "PDB",
"url": ""
},
{
"id": "NP_002418.1",
"database": "RefSeq",
"url": ""
},
{
"id": "ENST00000260302",
"database": "Ensembl",
"url": ""
},
{
"id": "3KEC",
"database": "PDB",
"url": ""
},
{
"id": "5UWM",
"database": "PDB",
"url": ""
},
{
"id": "MMP13_HUMAN",
"database": "ZINC - Investigational",
"url": ""
},
{
"id": "MMP13_HUMAN",
"database": "ZINC - Biogenic",
"url": ""
},
{
"id": "MMP13_HUMAN",
"database": "ZINC - Metabolites",
"url": ""
},
{
"id": "4A7B",
"database": "PDB",
"url": ""
},
{
"id": "830C",
"database": "PDB",
"url": ""
},
{
"id": "P45452",
"database": "UniProt",
"url": ""
},
{
"id": "3KEK",
"database": "PDB",
"url": ""
},
{
"id": "MMP13_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "P45452",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "1YOU",
"database": "PDB",
"url": ""
},
{
"id": "4G0D",
"database": "PDB",
"url": ""
},
{
"id": "7JU8",
"database": "PDB",
"url": ""
},
{
"id": "3TVC",
"database": "PDB",
"url": ""
},
{
"id": "3I7I",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000137745",
"database": "Ensembl",
"url": ""
},
{
"id": "3WV1",
"database": "PDB",
"url": ""
},
{
"id": "4FU4",
"database": "PDB",
"url": ""
},
{
"id": "MMP13_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "3I7G",
"database": "PDB",
"url": ""
},
{
"id": "3LJZ",
"database": "PDB",
"url": ""
},
{
"id": "5BOT",
"database": "PDB",
"url": ""
},
{
"id": "1637",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "1XUC",
"database": "PDB",
"url": ""
},
{
"id": "2D1N",
"database": "PDB",
"url": ""
},
{
"id": "2E2D",
"database": "PDB",
"url": ""
},
{
"id": "1ZTQ",
"database": "PDB",
"url": ""
},
{
"id": "HMDBP02183",
"database": "HMDB Protein",
"url": ""
},
{
"id": "4JP4",
"database": "PDB",
"url": ""
},
{
"id": "5UWK",
"database": "PDB",
"url": ""
},
{
"id": "3ELM",
"database": "PDB",
"url": ""
},
{
"id": "4L19",
"database": "PDB",
"url": ""
},
{
"id": "P45452",
"database": "PRO",
"url": ""
},
{
"id": "1FM1",
"database": "PDB",
"url": ""
},
{
"id": "3WV2",
"database": "PDB",
"url": ""
},
{
"id": "P45452",
"database": "ZINC target",
"url": ""
},
{
"id": "5BPA",
"database": "PDB",
"url": ""
},
{
"id": "4FVL",
"database": "PDB",
"url": ""
},
{
"id": "3KEJ",
"database": "PDB",
"url": ""
},
{
"id": "5UWL",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000137745-MMP13",
"database": "HPA",
"url": ""
}
]
},
{
"participant_id": "R-HSA-1604735",
"participant_name": "MMP3(55-477) [extracellular region]",
"crossref": [
{
"id": "1C3I",
"database": "PDB",
"url": ""
},
{
"id": "1BM6",
"database": "PDB",
"url": ""
},
{
"id": "1D7X",
"database": "PDB",
"url": ""
},
{
"id": "MMP3_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "ENSG00000149968",
"database": "OpenTargets",
"url": ""
},
{
"id": "1CQR",
"database": "PDB",
"url": ""
},
{
"id": "6MAV",
"database": "PDB",
"url": ""
},
{
"id": "1CIZ",
"database": "PDB",
"url": ""
},
{
"id": "1D8M",
"database": "PDB",
"url": ""
},
{
"id": "6N9D",
"database": "PDB",
"url": ""
},
{
"id": "2JT6",
"database": "PDB",
"url": ""
},
{
"id": "1G49",
"database": "PDB",
"url": ""
},
{
"id": "MMP3_HUMAN",
"database": "ZINC - Metabolites",
"url": ""
},
{
"id": "1D5J",
"database": "PDB",
"url": ""
},
{
"id": "7S7M",
"database": "PDB",
"url": ""
},
{
"id": "1CAQ",
"database": "PDB",
"url": ""
},
{
"id": "P08254",
"database": "PRO",
"url": ""
},
{
"id": "1B3D",
"database": "PDB",
"url": ""
},
{
"id": "1USN",
"database": "PDB",
"url": ""
},
{
"id": "4G9L",
"database": "PDB",
"url": ""
},
{
"id": "MMP3_HUMAN",
"database": "ZINC - Investigational",
"url": ""
},
{
"id": "ENSG00000149968-MMP3",
"database": "HPA",
"url": ""
},
{
"id": "P08254",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "1G4K",
"database": "PDB",
"url": ""
},
{
"id": "1G05",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000299855",
"database": "Ensembl",
"url": ""
},
{
"id": "1OO9",
"database": "PDB",
"url": ""
},
{
"id": "P08254",
"database": "ZINC target",
"url": ""
},
{
"id": "1SLN",
"database": "PDB",
"url": ""
},
{
"id": "1HFS",
"database": "PDB",
"url": ""
},
{
"id": "NP_002413.1",
"database": "RefSeq",
"url": ""
},
{
"id": "1BIW",
"database": "PDB",
"url": ""
},
{
"id": "HMDBP02592",
"database": "HMDB Protein",
"url": ""
},
{
"id": "1QIC",
"database": "PDB",
"url": ""
},
{
"id": "MMP3_HUMAN",
"database": "ZINC - World Drugs",
"url": ""
},
{
"id": "1HY7",
"database": "PDB",
"url": ""
},
{
"id": "2JT5",
"database": "PDB",
"url": ""
},
{
"id": "1UEA",
"database": "PDB",
"url": ""
},
{
"id": "7S7L",
"database": "PDB",
"url": ""
},
{
"id": "3OHO",
"database": "PDB",
"url": ""
},
{
"id": "2USN",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000299855",
"database": "Ensembl",
"url": ""
},
{
"id": "4JA1",
"database": "PDB",
"url": ""
},
{
"id": "1UMS",
"database": "PDB",
"url": ""
},
{
"id": "1SLM",
"database": "PDB",
"url": ""
},
{
"id": "3USN",
"database": "PDB",
"url": ""
},
{
"id": "P08254",
"database": "GeneCards",
"url": ""
},
{
"id": "P08254",
"database": "UniProt",
"url": ""
},
{
"id": "2SRT",
"database": "PDB",
"url": ""
},
{
"id": "1D8F",
"database": "PDB",
"url": ""
},
{
"id": "1B8Y",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000149968",
"database": "Ensembl",
"url": ""
},
{
"id": "1BQO",
"database": "PDB",
"url": ""
},
{
"id": "3OHL",
"database": "PDB",
"url": ""
},
{
"id": "2JNP",
"database": "PDB",
"url": ""
},
{
"id": "1C8T",
"database": "PDB",
"url": ""
},
{
"id": "1630",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "1QIA",
"database": "PDB",
"url": ""
},
{
"id": "2D1O",
"database": "PDB",
"url": ""
},
{
"id": "4DPE",
"database": "PDB",
"url": ""
},
{
"id": "MMP3_HUMAN",
"database": "ZINC - Biogenic",
"url": ""
},
{
"id": "1UMT",
"database": "PDB",
"url": ""
},
{
"id": "MMP3_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
}
]
},
{
"participant_id": "R-HSA-1604748",
"participant_name": "MMP10(18-476) [extracellular region]",
"crossref": [
{
"id": "P09238",
"database": "UniProt",
"url": ""
},
{
"id": "1Q3A",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000166670-MMP10",
"database": "HPA",
"url": ""
},
{
"id": "MMP10_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "3V96",
"database": "PDB",
"url": ""
},
{
"id": "1634",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "MMP10_HUMAN",
"database": "ZINC - Investigational",
"url": ""
},
{
"id": "MMP10_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "NP_002416.1",
"database": "RefSeq",
"url": ""
},
{
"id": "ENSG00000166670",
"database": "OpenTargets",
"url": ""
},
{
"id": "HMDBP07801",
"database": "HMDB Protein",
"url": ""
},
{
"id": "P09238",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "ENSG00000166670",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSP00000279441",
"database": "Ensembl",
"url": ""
},
{
"id": "P09238",
"database": "ZINC target",
"url": ""
},
{
"id": "P09238",
"database": "GeneCards",
"url": ""
},
{
"id": "ENST00000279441",
"database": "Ensembl",
"url": ""
},
{
"id": "P09238",
"database": "PRO",
"url": ""
},
{
"id": "3.4.24.22",
"database": "IntEnz",
"url": ""
},
{
"id": "4ILW",
"database": "PDB",
"url": ""
}
]
},
{
"participant_id": "R-HSA-1604759",
"participant_name": "MMP7(18-50) [extracellular region]",
"crossref": [
{
"id": "ENSG00000137673",
"database": "Ensembl",
"url": ""
},
{
"id": "5UE2",
"database": "PDB",
"url": ""
},
{
"id": "MMP7_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "P09237",
"database": "UniProt",
"url": ""
},
{
"id": "2Y6D",
"database": "PDB",
"url": ""
},
{
"id": "1MMQ",
"database": "PDB",
"url": ""
},
{
"id": "P09237",
"database": "PRO",
"url": ""
},
{
"id": "2DDY",
"database": "PDB",
"url": ""
},
{
"id": "MMP7_HUMAN",
"database": "ZINC - Investigational",
"url": ""
},
{
"id": "2MZI",
"database": "PDB",
"url": ""
},
{
"id": "1MMR",
"database": "PDB",
"url": ""
},
{
"id": "7WXX",
"database": "PDB",
"url": ""
},
{
"id": "HMDBP02928",
"database": "HMDB Protein",
"url": ""
},
{
"id": "NP_002414.1",
"database": "RefSeq",
"url": ""
},
{
"id": "MMP7_HUMAN",
"database": "ZINC - World Drugs",
"url": ""
},
{
"id": "2MZE",
"database": "PDB",
"url": ""
},
{
"id": "P09237",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "ENSP00000260227",
"database": "Ensembl",
"url": ""
},
{
"id": "1MMP",
"database": "PDB",
"url": ""
},
{
"id": "2MZH",
"database": "PDB",
"url": ""
},
{
"id": "P09237",
"database": "ZINC target",
"url": ""
},
{
"id": "2Y6C",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000137673-MMP7",
"database": "HPA",
"url": ""
},
{
"id": "P09237",
"database": "GeneCards",
"url": ""
},
{
"id": "1631",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "ENST00000260227",
"database": "Ensembl",
"url": ""
},
{
"id": "5UE5",
"database": "PDB",
"url": ""
},
{
"id": "MMP7_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "ENSG00000137673",
"database": "OpenTargets",
"url": ""
}
]
},
{
"participant_id": "R-HSA-216001",
"participant_name": "Laminin-332 [extracellular region]",
"crossref": [
{
"id": "CPX-3165",
"database": "ComplexPortal",
"url": ""
},
{
"id": "CPX-1774",
"database": "ComplexPortal",
"url": ""
}
]
},
{
"participant_id": "R-HSA-2533911",
"participant_name": "Cleaved laminin-332 [extracellular region]",
"crossref": [
{
"id": "CPX-1774",
"database": "ComplexPortal",
"url": ""
}
]
},
{
"participant_id": "R-HSA-2534246",
"participant_name": "HSPG2(?-4391) [extracellular region]",
"crossref": [
{
"id": "ENSG00000142798",
"database": "OpenTargets",
"url": ""
},
{
"id": "NP_001278789.1",
"database": "RefSeq",
"url": ""
},
{
"id": "NP_005520.4",
"database": "RefSeq",
"url": ""
},
{
"id": "P98160",
"database": "UniProt",
"url": ""
},
{
"id": "HMDBP01713",
"database": "HMDB Protein",
"url": ""
},
{
"id": "ENSG00000142798",
"database": "Ensembl",
"url": ""
},
{
"id": "3SH4",
"database": "PDB",
"url": ""
},
{
"id": "P98160",
"database": "GeneCards",
"url": ""
},
{
"id": "16234",
"database": "Orphanet",
"url": ""
},
{
"id": "ENSP00000363827",
"database": "Ensembl",
"url": ""
},
{
"id": "P98160",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "ENST00000374695",
"database": "Ensembl",
"url": ""
},
{
"id": "3SH5",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000142798-HSPG2",
"database": "HPA",
"url": ""
},
{
"id": "P98160",
"database": "PRO",
"url": ""
}
]
},
{
"participant_id": "R-HSA-2534251",
"participant_name": "HSPG2(22-?) [extracellular region]",
"crossref": [
{
"id": "ENSG00000142798-HSPG2",
"database": "HPA",
"url": ""
},
{
"id": "3SH5",
"database": "PDB",
"url": ""
},
{
"id": "P98160",
"database": "PRO",
"url": ""
},
{
"id": "ENST00000374695",
"database": "Ensembl",
"url": ""
},
{
"id": "16234",
"database": "Orphanet",
"url": ""
},
{
"id": "P98160",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "ENSP00000363827",
"database": "Ensembl",
"url": ""
},
{
"id": "P98160",
"database": "GeneCards",
"url": ""
},
{
"id": "HMDBP01713",
"database": "HMDB Protein",
"url": ""
},
{
"id": "3SH4",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000142798",
"database": "Ensembl",
"url": ""
},
{
"id": "P98160",
"database": "UniProt",
"url": ""
},
{
"id": "NP_001278789.1",
"database": "RefSeq",
"url": ""
},
{
"id": "ENSG00000142798",
"database": "OpenTargets",
"url": ""
},
{
"id": "NP_005520.4",
"database": "RefSeq",
"url": ""
}
]
}
],
"reaction_enzymes": [
{
"uniprot_ac": "O00391",
"gene_name": "QSOX1",
"activity": [
{
"ec_number": "1.8.3.2",
"activity": "O2 + 2 R'C(R)SH = H2O2 + R'C(R)S-S(R)CR'.",
"evidence": [
{
"id": "O00391",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O00391"
}
]
},
{
"ec_number": "1.8.3.2",
"activity": "",
"evidence": [
{
"id": "O00391",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O00391"
}
]
}
]
},
{
"uniprot_ac": "O60882",
"gene_name": "MMP20",
"activity": [
{
"ec_number": "3.4.24.-",
"activity": "",
"evidence": [
{
"id": "O60882",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O60882"
}
]
}
]
},
{
"uniprot_ac": "P00488",
"gene_name": "F13A1",
"activity": [
{
"ec_number": "2.3.2.13",
"activity": "L-glutaminyl-[protein] + L-lysyl-[protein] = [protein]-L-lysyl-N(6)-5-L-glutamyl-[protein] + NH4(+).",
"evidence": [
{
"id": "P00488",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00488"
}
]
},
{
"ec_number": "2.3.2.13",
"activity": "",
"evidence": [
{
"id": "P00488",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00488"
}
]
}
]
},
{
"uniprot_ac": "P00746",
"gene_name": "CFD",
"activity": [
{
"ec_number": "3.4.21.46",
"activity": "Selective cleavage of Arg-|-Lys bond in complement factor B when in complex with complement subcomponent C3b or with cobra venom factor.",
"evidence": [
{
"id": "P00746",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00746"
}
]
},
{
"ec_number": "3.4.21.46",
"activity": "",
"evidence": [
{
"id": "P00746",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00746"
}
]
}
]
},
{
"uniprot_ac": "P00747",
"gene_name": "PLG",
"activity": [
{
"ec_number": "3.4.21.7",
"activity": "Preferential cleavage: Lys-|-Xaa > Arg-|-Xaa, higher selectivity than trypsin. Converts fibrin into soluble products.",
"evidence": [
{
"id": "P00747",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00747"
}
]
},
{
"ec_number": "3.4.21.7",
"activity": "",
"evidence": [
{
"id": "P00747",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00747"
}
]
}
]
},
{
"uniprot_ac": "P00749",
"gene_name": "PLAU",
"activity": [
{
"ec_number": "3.4.21.73",
"activity": "Specific cleavage of Arg-|-Val bond in plasminogen to form plasmin.",
"evidence": [
{
"id": "P00749",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00749"
}
]
},
{
"ec_number": "3.4.21.73",
"activity": "",
"evidence": [
{
"id": "P00749",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00749"
}
]
}
]
},
{
"uniprot_ac": "P00750",
"gene_name": "PLAT",
"activity": [
{
"ec_number": "3.4.21.68",
"activity": "Specific cleavage of Arg-|-Val bond in plasminogen to form plasmin.",
"evidence": [
{
"id": "P00750",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00750"
}
]
},
{
"ec_number": "3.4.21.68",
"activity": "",
"evidence": [
{
"id": "P00750",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00750"
}
]
}
]
},
{
"uniprot_ac": "P03952",
"gene_name": "KLKB1",
"activity": [
{
"ec_number": "3.4.21.34",
"activity": "Cleaves selectively Arg-|-Xaa and Lys-|-Xaa bonds, including Lys-|-Arg and Arg-|-Ser bonds in (human) kininogen to release bradykinin.",
"evidence": [
{
"id": "P03952",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P03952"
}
]
},
{
"ec_number": "3.4.21.34",
"activity": "",
"evidence": [
{
"id": "P03952",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P03952"
}
]
}
]
},
{
"uniprot_ac": "P03956",
"gene_name": "MMP1",
"activity": [
{
"ec_number": "3.4.24.7",
"activity": "Cleavage of the triple helix of collagen at about three-quarters of the length of the molecule from the N-terminus, at 775-Gly-|-Ile-776 in the alpha1(I) chain. Cleaves synthetic substrates and alpha-macroglobulins at bonds where P1' is a hydrophobic residue.",
"evidence": [
{
"id": "P03956",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P03956"
}
]
},
{
"ec_number": "3.4.24.7",
"activity": "",
"evidence": [
{
"id": "P03956",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P03956"
}
]
}
]
},
{
"uniprot_ac": "P04075",
"gene_name": "ALDOA",
"activity": [
{
"ec_number": "4.1.2.13",
"activity": "beta-D-fructose 1,6-bisphosphate = D-glyceraldehyde 3-phosphate + dihydroxyacetone phosphate.",
"evidence": [
{
"id": "P04075",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04075"
}
]
},
{
"ec_number": "4.1.2.13",
"activity": "",
"evidence": [
{
"id": "P04075",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04075"
}
]
}
]
},
{
"uniprot_ac": "P07477",
"gene_name": "PRSS1",
"activity": [
{
"ec_number": "3.4.21.4",
"activity": "Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa.",
"evidence": [
{
"id": "P07477",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07477"
}
]
},
{
"ec_number": "3.4.21.4",
"activity": "",
"evidence": [
{
"id": "P07477",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07477"
}
]
}
]
},
{
"uniprot_ac": "P07478",
"gene_name": "PRSS2",
"activity": [
{
"ec_number": "3.4.21.4",
"activity": "Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa.",
"evidence": [
{
"id": "P07478",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07478"
}
]
},
{
"ec_number": "3.4.21.4",
"activity": "",
"evidence": [
{
"id": "P07478",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07478"
}
]
}
]
},
{
"uniprot_ac": "P08246",
"gene_name": "ELANE",
"activity": [
{
"ec_number": "3.4.21.37",
"activity": "Hydrolysis of proteins, including elastin. Preferential cleavage: Val-|-Xaa > Ala-|-Xaa.",
"evidence": [
{
"id": "P08246",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08246"
}
]
},
{
"ec_number": "3.4.21.37",
"activity": "",
"evidence": [
{
"id": "P08246",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08246"
}
]
}
]
},
{
"uniprot_ac": "P08253",
"gene_name": "MMP2",
"activity": [
{
"ec_number": "3.4.24.24",
"activity": "Cleavage of gelatin type I and collagen types IV, V, VII, X. Cleaves the collagen-like sequence Pro-Gln-Gly-|-Ile-Ala-Gly-Gln.",
"evidence": [
{
"id": "P08253",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08253"
}
]
},
{
"ec_number": "3.4.24.24",
"activity": "",
"evidence": [
{
"id": "P08253",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08253"
}
]
}
]
},
{
"uniprot_ac": "P08254",
"gene_name": "MMP3",
"activity": [
{
"ec_number": "3.4.24.17",
"activity": "Preferential cleavage where P1', P2' and P3' are hydrophobic residues.",
"evidence": [
{
"id": "P08254",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08254"
}
]
},
{
"ec_number": "3.4.24.17",
"activity": "",
"evidence": [
{
"id": "P08254",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08254"
}
]
}
]
},
{
"uniprot_ac": "P08311",
"gene_name": "CTSG",
"activity": [
{
"ec_number": "3.4.21.20",
"activity": "Specificity similar to chymotrypsin C.",
"evidence": [
{
"id": "P08311",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08311"
}
]
},
{
"ec_number": "3.4.21.20",
"activity": "",
"evidence": [
{
"id": "P08311",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08311"
}
]
}
]
},
{
"uniprot_ac": "P09237",
"gene_name": "MMP7",
"activity": [
{
"ec_number": "3.4.24.23",
"activity": "Cleavage of 14-Ala-|-Leu-15 and 16-Tyr-|-Leu-17 in B chain of insulin. No action on collagen types I, II, IV, V. Cleaves gelatin chain alpha2(I) > alpha1(I).",
"evidence": [
{
"id": "P09237",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09237"
}
]
},
{
"ec_number": "3.4.24.23",
"activity": "",
"evidence": [
{
"id": "P09237",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09237"
}
]
}
]
},
{
"uniprot_ac": "P09238",
"gene_name": "MMP10",
"activity": [
{
"ec_number": "3.4.24.22",
"activity": "Similar to stromelysin 1, but action on collagen types III, IV and V is weak.",
"evidence": [
{
"id": "P09238",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09238"
}
]
},
{
"ec_number": "3.4.24.22",
"activity": "",
"evidence": [
{
"id": "P09238",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09238"
}
]
}
]
},
{
"uniprot_ac": "P13497",
"gene_name": "BMP1",
"activity": [
{
"ec_number": "3.4.24.19",
"activity": "Cleavage of the C-terminal propeptide at Ala-|-Asp in type I and II procollagens and at Arg-|-Asp in type III.",
"evidence": [
{
"id": "P13497",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P13497"
}
]
},
{
"ec_number": "3.4.24.19",
"activity": "",
"evidence": [
{
"id": "P13497",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P13497"
}
]
},
{
"ec_number": "3.4.24.-",
"activity": "",
"evidence": [
{
"id": "P13497",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P13497"
}
]
}
]
},
{
"uniprot_ac": "P17538",
"gene_name": "CTRB1",
"activity": [
{
"ec_number": "3.4.21.1",
"activity": "Preferential cleavage: Tyr-|-Xaa, Trp-|-Xaa, Phe-|-Xaa, Leu-|-Xaa.",
"evidence": [
{
"id": "P17538",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P17538"
}
]
},
{
"ec_number": "3.4.21.1",
"activity": "",
"evidence": [
{
"id": "P17538",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P17538"
}
]
}
]
},
{
"uniprot_ac": "P20151",
"gene_name": "KLK2",
"activity": [
{
"ec_number": "3.4.21.35",
"activity": "Preferential cleavage of Arg-|-Xaa bonds in small molecule substrates. Highly selective action to release kallidin (lysyl-bradykinin) from kininogen involves hydrolysis of Met-|-Xaa or Leu-|-Xaa.",
"evidence": [
{
"id": "P20151",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20151"
}
]
},
{
"ec_number": "3.4.21.35",
"activity": "",
"evidence": [
{
"id": "P20151",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20151"
}
]
}
]
},
{
"uniprot_ac": "P22894",
"gene_name": "MMP8",
"activity": [
{
"ec_number": "3.4.24.34",
"activity": "Cleavage of interstitial collagens in the triple helical domain. Unlike EC 3.4.24.7, this enzyme cleaves type III collagen more slowly than type I.",
"evidence": [
{
"id": "P22894",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P22894"
}
]
},
{
"ec_number": "3.4.24.34",
"activity": "",
"evidence": [
{
"id": "P22894",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P22894"
}
]
}
]
},
{
"uniprot_ac": "P23946",
"gene_name": "CMA1",
"activity": [
{
"ec_number": "3.4.21.39",
"activity": "Preferential cleavage: Phe-|-Xaa > Tyr-|-Xaa > Trp-|-Xaa > Leu-|-Xaa.",
"evidence": [
{
"id": "P23946",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P23946"
}
]
},
{
"ec_number": "3.4.21.39",
"activity": "",
"evidence": [
{
"id": "P23946",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P23946"
}
]
}
]
},
{
"uniprot_ac": "P39900",
"gene_name": "MMP12",
"activity": [
{
"ec_number": "3.4.24.65",
"activity": "Hydrolysis of soluble and insoluble elastin. Specific cleavages are also produced at 14-Ala-|-Leu-15 and 16-Tyr-|-Leu-17 in the B chain of insulin.",
"evidence": [
{
"id": "P39900",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P39900"
}
]
},
{
"ec_number": "3.4.24.65",
"activity": "",
"evidence": [
{
"id": "P39900",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P39900"
}
]
}
]
},
{
"uniprot_ac": "P45452",
"gene_name": "MMP13",
"activity": [
{
"ec_number": "3.4.24.-",
"activity": "",
"evidence": [
{
"id": "P45452",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P45452"
}
]
}
]
},
{
"uniprot_ac": "Q15661",
"gene_name": "TPSAB1",
"activity": [
{
"ec_number": "3.4.21.59",
"activity": "Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa, but with more restricted specificity than trypsin.",
"evidence": [
{
"id": "Q15661",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q15661"
}
]
},
{
"ec_number": "3.4.21.59",
"activity": "",
"evidence": [
{
"id": "Q15661",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q15661"
}
]
}
]
},
{
"uniprot_ac": "Q6GPI1",
"gene_name": "CTRB2",
"activity": [
{
"ec_number": "3.4.21.1",
"activity": "Preferential cleavage: Tyr-|-Xaa, Trp-|-Xaa, Phe-|-Xaa, Leu-|-Xaa.",
"evidence": [
{
"id": "Q6GPI1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6GPI1"
}
]
},
{
"ec_number": "3.4.21.1",
"activity": "",
"evidence": [
{
"id": "Q6GPI1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6GPI1"
}
]
}
]
},
{
"uniprot_ac": "Q8NBM8",
"gene_name": "PCYOX1L",
"activity": [
{
"ec_number": "1.8.3.-",
"activity": "",
"evidence": [
{
"id": "Q8NBM8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8NBM8"
}
]
}
]
},
{
"uniprot_ac": "Q8NBX0",
"gene_name": "SCCPDH",
"activity": [
{
"ec_number": "1.-.-.-",
"activity": "",
"evidence": [
{
"id": "Q8NBX0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8NBX0"
}
]
}
]
},
{
"uniprot_ac": "Q99542",
"gene_name": "MMP19",
"activity": [
{
"ec_number": "3.4.24.-",
"activity": "",
"evidence": [
{
"id": "Q99542",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99542"
}
]
}
]
}
],
"biomarkers": [
{
"assessed_biomarker_entity": "Plasminogen (PLG)",
"biomarker_id": "A0310",
"evidence": [
{
"id": "GLY_000625",
"database": "GlyGen",
"url": "https://data.glygen.org/GLY_000625"
},
{
"id": "27935848",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/27935848"
}
],
"instances": [
{
"best_biomarker_type": "prognostic",
"status": "increased PLG level",
"disease": {
"disease_id": "DOID:2394",
"recommended_name": {
"id": "DOID:2394",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:2394",
"name": "ovarian cancer",
"description": "A female reproductive organ cancer that is located_in the ovary."
},
"synonyms": [
{
"id": "DOID:2394",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:2394",
"name": "malignant Ovarian tumor",
"description": ""
},
{
"id": "DOID:2394",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:2394",
"name": "malignant tumour of ovary",
"description": ""
},
{
"id": "DOID:2394",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:2394",
"name": "ovarian neoplasm",
"description": ""
},
{
"id": "DOID:2394",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:2394",
"name": "ovary neoplasm",
"description": ""
},
{
"id": "DOID:2394",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:2394",
"name": "primary ovarian cancer",
"description": ""
},
{
"id": "DOID:2394",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:2394",
"name": "tumor of the Ovary",
"description": ""
},
{
"id": "MONDO:0011931",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011931",
"name": "ovarian cancer, susceptibility to, 1",
"description": ""
},
{
"id": "MONDO:0011931",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011931",
"name": "OVCAS1",
"description": ""
},
{
"id": "MONDO:0011931",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011931",
"name": "ovarian cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0011931",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011931",
"name": "ovarian cancer, susceptibility to, 1",
"description": ""
},
{
"id": "MONDO:0008170",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008170",
"name": "ovarian cancer",
"description": "A primary or metastatic malignant neoplasm involving the ovary. Most primary malignant ovarian neoplasms are either carcinomas (serous, mucinous, or endometrioid adenocarcinomas) or malignant germ cell tumors. Metastatic malignant neoplasms to the ovary include carcinomas, lymphomas, and melanomas."
},
{
"id": "MONDO:0008170",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008170",
"name": "ovarian neoplasm",
"description": ""
},
{
"id": "MONDO:0008170",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008170",
"name": "ovary neoplasm",
"description": ""
},
{
"id": "MONDO:0008170",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008170",
"name": "tumor of the ovary",
"description": ""
},
{
"id": "MONDO:0008170",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008170",
"name": "tumour of the ovary",
"description": ""
},
{
"id": "MONDO:0008170",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008170",
"name": "cancer of ovary",
"description": ""
},
{
"id": "MONDO:0008170",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008170",
"name": "cancer of the ovary",
"description": ""
},
{
"id": "MONDO:0008170",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008170",
"name": "malignant neoplasm of ovary",
"description": ""
},
{
"id": "MONDO:0008170",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008170",
"name": "malignant neoplasm of the ovary",
"description": ""
},
{
"id": "MONDO:0008170",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008170",
"name": "malignant ovarian neoplasm",
"description": ""
},
{
"id": "MONDO:0008170",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008170",
"name": "malignant ovarian tumor",
"description": ""
},
{
"id": "MONDO:0008170",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008170",
"name": "malignant ovarian tumour",
"description": ""
},
{
"id": "MONDO:0008170",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008170",
"name": "malignant ovary neoplasm",
"description": ""
},
{
"id": "MONDO:0008170",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008170",
"name": "malignant tumor of ovary",
"description": ""
},
{
"id": "MONDO:0008170",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008170",
"name": "malignant tumor of the ovary",
"description": ""
},
{
"id": "MONDO:0008170",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008170",
"name": "malignant tumour of ovary",
"description": ""
},
{
"id": "MONDO:0008170",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008170",
"name": "malignant tumour of the ovary",
"description": ""
},
{
"id": "MONDO:0008170",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008170",
"name": "ovarian cancer",
"description": ""
},
{
"id": "MONDO:0008170",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008170",
"name": "ovarian cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008170",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008170",
"name": "ovarian malignant tumor",
"description": ""
},
{
"id": "MONDO:0008170",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008170",
"name": "ovarian malignant tumour",
"description": ""
},
{
"id": "MONDO:0008170",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008170",
"name": "ovary cancer",
"description": ""
},
{
"id": "MONDO:0008170",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008170",
"name": "ovarian cancer, epithelial",
"description": ""
},
{
"id": "MONDO:0008170",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008170",
"name": "primary ovarian cancer",
"description": ""
},
{
"id": "MIM:167000",
"resource": "MIM",
"url": "https://www.omim.org/entry/167000",
"name": "Ovarian cancer",
"description": "Ovarian cancer"
}
]
},
"tissue": {
"name": "ovary",
"namespace": "UBERON",
"id": "0000992",
"url": "http://purl.obolibrary.org/obo/UBERON_0000992"
},
"evidence": [
{
"id": "GLY_000625",
"database": "GlyGen",
"url": "https://data.glygen.org/GLY_000625"
},
{
"id": "27935848",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/27935848"
}
]
}
]
}
],
"synthesized_glycans": [],
"cluster_types": [
{
"name": "isoformset.uniprotkb",
"label": "Isoforms"
},
{
"name": "homologset.mgi",
"label": "MGI Homologs"
},
{
"name": "homologset.oma",
"label": "OMA Homologs"
}
],
"sequence_features": {
"n_linked_sites": [
150,
308,
424
],
"o_linked_sites": [
28,
262,
263,
264,
268,
349,
358,
359,
365,
371,
457,
460,
710,
742
],
"snv_sites": [
28,
158,
159,
263,
308,
315,
358,
359,
365,
371,
388,
420,
457,
460,
500,
646,
663,
695,
710,
742
],
"glycation_sites": [],
"phosphorylation_sites": [
597,
688
],
"sequon_annotation_sites": [
{
"start_pos": 308,
"end_pos": 310
}
]
},
"section_stats": [
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 96
},
{
"field": "total_sites",
"count": 16
},
{
"field": "n_linked_glycans",
"count": 54
},
{
"field": "n_linked_glycan_sites",
"count": 4
},
{
"field": "o_linked_glycans",
"count": 13
},
{
"field": "o_linked_glycan_sites",
"count": 15
}
],
"sort_fields": [
"glytoucan_ac",
"type",
"subtype",
"site_category",
"site_seq",
"relation",
"comment",
"start_pos",
"start_aa",
"end_pos",
"end_aa",
"residue",
"site_lbl"
]
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 3
},
{
"field": "total_sites",
"count": 3
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 1
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 2
}
],
"sort_fields": [
"glytoucan_ac",
"type",
"subtype",
"site_category",
"site_seq",
"relation",
"comment",
"start_pos",
"start_aa",
"end_pos",
"end_aa",
"residue",
"site_lbl"
]
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 93
},
{
"field": "total_sites",
"count": 16
},
{
"field": "n_linked_glycans",
"count": 54
},
{
"field": "n_linked_glycan_sites",
"count": 3
},
{
"field": "o_linked_glycans",
"count": 13
},
{
"field": "o_linked_glycan_sites",
"count": 13
}
],
"sort_fields": [
"glytoucan_ac",
"type",
"subtype",
"site_category",
"site_seq",
"relation",
"comment",
"start_pos",
"start_aa",
"end_pos",
"end_aa",
"residue",
"site_lbl"
]
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 2
},
{
"field": "total_sites",
"count": 2
}
],
"sort_fields": [
"start_pos",
"end_pos",
"kinase_uniprot_canonical_ac",
"kinase_gene_name",
"residue",
"comment",
"site_lbl"
]
},
{
"table_id": "snv",
"table_stats": [
{
"field": "total",
"count": 27
},
{
"field": "total_sites",
"count": 20
}
],
"sort_fields": [
"start_pos",
"end_pos",
"subjects_tested",
"subjects_positive",
"frequency",
"sequence_org",
"sequence_mut",
"comment",
"chr_id",
"chr_pos",
"ref_nt",
"alt_nt",
"minor_allelic_frequency",
"site_lbl"
]
},
{
"table_id": "snv_disease",
"table_stats": [
{
"field": "total",
"count": 9
},
{
"field": "total_sites",
"count": 9
}
],
"sort_fields": [
"start_pos",
"end_pos",
"subjects_tested",
"subjects_positive",
"frequency",
"sequence_org",
"sequence_mut",
"comment",
"chr_id",
"chr_pos",
"ref_nt",
"alt_nt",
"minor_allelic_frequency",
"site_lbl"
]
},
{
"table_id": "snv_non_disease",
"table_stats": [
{
"field": "total",
"count": 18
},
{
"field": "total_sites",
"count": 12
}
],
"sort_fields": [
"start_pos",
"end_pos",
"subjects_tested",
"subjects_positive",
"frequency",
"sequence_org",
"sequence_mut",
"comment",
"chr_id",
"chr_pos",
"ref_nt",
"alt_nt",
"minor_allelic_frequency",
"site_lbl"
]
},
{
"table_id": "publication",
"table_stats": [
{
"field": "total",
"count": 292
}
],
"sort_fields": [
"title",
"journal",
"date",
"authors"
]
}
]
}