{
"uniprot_canonical_ac": "P00519-1",
"uniprot_ac": "P00519",
"uniprot_id": "ABL1_HUMAN",
"mass": {
"chemical_mass": 122873.0,
"monoisotopic_mass": 122873.0
},
"refseq": {
"ac": "NP_005148",
"name": "tyrosine-protein kinase ABL1 isoform a",
"summary": "This gene is a protooncogene that encodes a protein tyrosine kinase involved in a variety of cellular processes, including cell division, adhesion, differentiation, and response to stress. The activity of the protein is negatively regulated by its SH3 domain, whereby deletion of the region encoding this domain results in an oncogene. The ubiquitously expressed protein has DNA-binding activity that is regulated by CDC2-mediated phosphorylation, suggesting a cell cycle function. This gene has been found fused to a variety of translocation partner genes in various leukemias, most notably the t(9;22) translocation that results in a fusion with the 5' end of the breakpoint cluster region gene (BCR; MIM:151410). Alternative splicing of this gene results in two transcript variants, which contain alternative first exons that are spliced to the remaining common exons. [provided by RefSeq, Aug 2014].",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_005148"
},
"gene_names": [
{
"name": "ABL1",
"resource": "UniProtKB",
"type": "recommended",
"url": "https://www.uniprot.org/uniprot/P00519",
"id": "P00519"
},
{
"name": "ABL1",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_005148",
"id": "NP_005148"
},
{
"name": "ABL; BCR-ABL; bcr/abl; c-ABL; c-ABL1; CHDSKM; JTK7; p150; v-abl",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_005148",
"id": "NP_005148"
},
{
"name": "ABL",
"resource": "UniProtKB",
"type": "synonym",
"url": "https://www.uniprot.org/uniprot/P00519",
"id": "P00519"
},
{
"name": "JTK7",
"resource": "UniProtKB",
"type": "synonym",
"url": "https://www.uniprot.org/uniprot/P00519",
"id": "P00519"
}
],
"protein_names": [
{
"name": "Tyrosine-protein kinase ABL1",
"resource": "UniProtKB",
"type": "recommended",
"url": "",
"id": "P00519"
},
{
"name": "2.7.10.2",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P00519"
},
{
"name": "Abelson murine leukemia viral oncogene homolog 1",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P00519"
},
{
"name": "Abelson tyrosine-protein kinase 1",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P00519"
},
{
"name": "Proto-oncogene c-Abl",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P00519"
},
{
"name": "c-abl oncogene 1, receptor tyrosine kinase; v-abl Abelson murine leukemia viral oncogene homolog 1; proto-oncogene tyrosine-protein kinase ABL1; bcr/c-abl oncogene protein; proto-oncogene c-Abl; Abelson tyrosine-protein kinase 1; BCR/ABL e8a2 fusion; ABL protooncogene 1 nonreceptor tyrosine kinase; BCR/ABL1 e1a2 fusion protein; BCR-ABL1 p190",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_005148",
"id": "NP_005148"
},
{
"name": "p150",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P00519"
},
{
"name": "tyrosine-protein kinase ABL1 isoform a",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_005148",
"id": "NP_005148"
}
],
"function": [
{
"annotation": "Histone demethylase PHF8 facilitates the development of chronic myeloid leukaemia by directly targeting BCR::ABL1.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_005148",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_005148"
},
{
"database": "PubMed",
"id": "37469124",
"url": "https://glygen.org/publication/PubMed/37469124"
}
]
},
{
"annotation": "Non-receptor tyrosine-protein kinase that plays a role in many key processes linked to cell growth and survival such as cytoskeleton remodeling in response to extracellular stimuli, cell motility and adhesion, receptor endocytosis, autophagy, DNA damage response and apoptosis. Coordinates actin remodeling through tyrosine phosphorylation of proteins controlling cytoskeleton dynamics like WASF3 (involved in branch formation); ANXA1 (involved in membrane anchoring); DBN1, DBNL, CTTN, RAPH1 and ENAH (involved in signaling); or MAPT and PXN (microtubule-binding proteins). Phosphorylation of WASF3 is critical for the stimulation of lamellipodia formation and cell migration. Involved in the regulation of cell adhesion and motility through phosphorylation of key regulators of these processes such as BCAR1, CRK, CRKL, DOK1, EFS or NEDD9 (PubMed:22810897). Phosphorylates multiple receptor tyrosine kinases and more particularly promotes endocytosis of EGFR, facilitates the formation of neuromuscular synapses through MUSK, inhibits PDGFRB-mediated chemotaxis and modulates the endocytosis of activated B-cell receptor complexes. Other substrates which are involved in endocytosis regulation are the caveolin (CAV1) and RIN1. Moreover, ABL1 regulates the CBL family of ubiquitin ligases that drive receptor down-regulation and actin remodeling. Phosphorylation of CBL leads to increased EGFR stability. Involved in late-stage autophagy by regulating positively the trafficking and function of lysosomal components. ABL1 targets to mitochondria in response to oxidative stress and thereby mediates mitochondrial dysfunction and cell death. In response to oxidative stress, phosphorylates serine/threonine kinase PRKD2 at 'Tyr-717' (PubMed:28428613). ABL1 is also translocated in the nucleus where it has DNA-binding activity and is involved in DNA-damage response and apoptosis. Many substrates are known mediators of DNA repair: DDB1, DDB2, ERCC3, ERCC6, RAD9A, RAD51, RAD52 or WRN. Activates the proapoptotic pathway when the DNA damage is too severe to be repaired. Phosphorylates TP73, a primary regulator for this type of damage-induced apoptosis. Phosphorylates the caspase CASP9 on 'Tyr-153' and regulates its processing in the apoptotic response to DNA damage. Phosphorylates PSMA7 that leads to an inhibition of proteasomal activity and cell cycle transition blocks. ABL1 acts also as a regulator of multiple pathological signaling cascades during infection. Several known tyrosine-phosphorylated microbial proteins have been identified as ABL1 substrates. This is the case of A36R of Vaccinia virus, Tir (translocated intimin receptor) of pathogenic E.coli and possibly Citrobacter, CagA (cytotoxin-associated gene A) of H.pylori, or AnkA (ankyrin repeat-containing protein A) of A.phagocytophilum. Pathogens can highjack ABL1 kinase signaling to reorganize the host actin cytoskeleton for multiple purposes, like facilitating intracellular movement and host cell exit. Finally, functions as its own regulator through autocatalytic activity as well as through phosphorylation of its inhibitor, ABI1. Regulates T-cell differentiation in a TBX21-dependent manner (By similarity). Positively regulates chemokine-mediated T-cell migration, polarization, and homing to lymph nodes and immune-challenged tissues, potentially via activation of NEDD9/HEF1 and RAP1 (By similarity). Phosphorylates TBX21 on tyrosine residues leading to an enhancement of its transcriptional activator activity (By similarity).",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519#function"
},
{
"database": "PubMed",
"id": "9461559",
"url": "https://glygen.org/publication/PubMed/9461559"
},
{
"database": "PubMed",
"id": "9037071",
"url": "https://glygen.org/publication/PubMed/9037071"
},
{
"database": "UniProtKB",
"id": "P00520",
"url": "https://www.uniprot.org/uniprot/P00520#function"
},
{
"database": "PubMed",
"id": "15886098",
"url": "https://glygen.org/publication/PubMed/15886098"
},
{
"database": "PubMed",
"id": "10391250",
"url": "https://glygen.org/publication/PubMed/10391250"
},
{
"database": "PubMed",
"id": "9144171",
"url": "https://glygen.org/publication/PubMed/9144171"
},
{
"database": "PubMed",
"id": "18328268",
"url": "https://glygen.org/publication/PubMed/18328268"
},
{
"database": "PubMed",
"id": "20417104",
"url": "https://glygen.org/publication/PubMed/20417104"
},
{
"database": "PubMed",
"id": "16678104",
"url": "https://glygen.org/publication/PubMed/16678104"
},
{
"database": "PubMed",
"id": "19891780",
"url": "https://glygen.org/publication/PubMed/19891780"
},
{
"database": "PubMed",
"id": "17306540",
"url": "https://glygen.org/publication/PubMed/17306540"
},
{
"database": "PubMed",
"id": "28428613",
"url": "https://glygen.org/publication/PubMed/28428613"
},
{
"database": "PubMed",
"id": "15556646",
"url": "https://glygen.org/publication/PubMed/15556646"
},
{
"database": "PubMed",
"id": "20357770",
"url": "https://glygen.org/publication/PubMed/20357770"
},
{
"database": "PubMed",
"id": "15657060",
"url": "https://glygen.org/publication/PubMed/15657060"
},
{
"database": "PubMed",
"id": "11971963",
"url": "https://glygen.org/publication/PubMed/11971963"
},
{
"database": "PubMed",
"id": "16424036",
"url": "https://glygen.org/publication/PubMed/16424036"
},
{
"database": "PubMed",
"id": "17623672",
"url": "https://glygen.org/publication/PubMed/17623672"
},
{
"database": "PubMed",
"id": "22810897",
"url": "https://glygen.org/publication/PubMed/22810897"
},
{
"database": "PubMed",
"id": "12379650",
"url": "https://glygen.org/publication/PubMed/12379650"
},
{
"database": "PubMed",
"id": "18945674",
"url": "https://glygen.org/publication/PubMed/18945674"
},
{
"database": "PubMed",
"id": "12672821",
"url": "https://glygen.org/publication/PubMed/12672821"
},
{
"database": "PubMed",
"id": "15031292",
"url": "https://glygen.org/publication/PubMed/15031292"
},
{
"database": "PubMed",
"id": "16943190",
"url": "https://glygen.org/publication/PubMed/16943190"
},
{
"database": "PubMed",
"id": "12531427",
"url": "https://glygen.org/publication/PubMed/12531427"
}
]
},
{
"annotation": "Screening for ABL1 chimeric genes could be performed in patients with ALL, more particularly in those with T-cell ALL because ABL1 modulates T-cell development and plays a role in cytoskeletal remodeling processes in T cells. Review article",
"evidence": [
{
"database": "RefSeq",
"id": "NP_005148",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_005148"
},
{
"database": "PubMed",
"id": "21435002",
"url": "https://glygen.org/publication/PubMed/21435002"
}
]
},
{
"annotation": "Spectrum of BCR-ABL mutations in Azerbaijanian imatinib-resistant patients with chronic myeloid leukemia. Publication Status: Online-Only",
"evidence": [
{
"database": "RefSeq",
"id": "NP_005148",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_005148"
},
{
"database": "PubMed",
"id": "38188610",
"url": "https://glygen.org/publication/PubMed/38188610"
}
]
},
{
"annotation": "This gene is a protooncogene that encodes a protein tyrosine kinase involved in a variety of cellular processes, including cell division, adhesion, differentiation, and response to stress. The activity of the protein is negatively regulated by its SH3 domain, whereby deletion of the region encoding this domain results in an oncogene. The ubiquitously expressed protein has DNA-binding activity that is regulated by CDC2-mediated phosphorylation, suggesting a cell cycle function. This gene has been found fused to a variety of translocation partner genes in various leukemias, most notably the t(9;22) translocation that results in a fusion with the 5' end of the breakpoint cluster region gene (BCR; MIM:151410). Alternative splicing of this gene results in two transcript variants, which contain alternative first exons that are spliced to the remaining common exons. [provided by RefSeq, Aug 2014].",
"evidence": [
{
"database": "RefSeq",
"id": "NP_005148",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_005148"
}
]
}
],
"disease": [
{
"disease_id": "DOID:8552",
"recommended_name": {
"id": "DOID:8552",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:8552",
"name": "chronic myeloid leukemia",
"description": "A myeloid leukemia that is characterized by over production of white blood cells."
},
"synonyms": [
{
"id": "DOID:8552",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:8552",
"name": "CML",
"description": ""
},
{
"id": "DOID:8552",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:8552",
"name": "CML - chronic Myelogenous Leukemia",
"description": ""
},
{
"id": "DOID:8552",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:8552",
"name": "Myeloid Leukemia, chronic",
"description": ""
},
{
"id": "DOID:8552",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:8552",
"name": "chronic granulocytic leukaemia",
"description": ""
},
{
"id": "DOID:8552",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:8552",
"name": "chronic granulocytic leukemia",
"description": ""
},
{
"id": "DOID:8552",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:8552",
"name": "chronic myelogenous leukaemia",
"description": ""
},
{
"id": "DOID:8552",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:8552",
"name": "chronic myelogenous leukemia",
"description": ""
},
{
"id": "DOID:8552",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:8552",
"name": "chronic myeloid leukaemia",
"description": ""
},
{
"id": "MONDO:0011996",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011996",
"name": "chronic myelogenous leukemia, BCR-ABL1 positive",
"description": "A chronic myeloproliferative neoplasm characterized by the expression of the BCR-ABL1 fusion gene. It presents with neutrophilic leukocytosis. It can appear at any age, but it mostly affects middle aged and older individuals. Patients usually present with fatigue, weight loss, anemia, night sweats, and splenomegaly. If untreated, it follows a biphasic or triphasic natural course; an initial indolent chronic phase which is followed by an accelerated phase, a blast phase, or both. Allogeneic stem cell transplantation and tyrosine kinase inhibitors delay disease progression and prolong overall survival."
},
{
"id": "MONDO:0011996",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011996",
"name": "BCR-ABL Positive chronic myelogenous leukaemia",
"description": ""
},
{
"id": "MONDO:0011996",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011996",
"name": "BCR-ABL Positive chronic myelogenous leukemia",
"description": ""
},
{
"id": "MONDO:0011996",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011996",
"name": "CML",
"description": ""
},
{
"id": "MONDO:0011996",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011996",
"name": "CML - chronic myelogenous leukaemia",
"description": ""
},
{
"id": "MONDO:0011996",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011996",
"name": "CML - chronic myelogenous leukemia",
"description": ""
},
{
"id": "MONDO:0011996",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011996",
"name": "chronic granulocytic leukaemia",
"description": ""
},
{
"id": "MONDO:0011996",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011996",
"name": "chronic granulocytic leukemia",
"description": ""
},
{
"id": "MONDO:0011996",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011996",
"name": "chronic myelocytic leukaemia",
"description": ""
},
{
"id": "MONDO:0011996",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011996",
"name": "chronic myelocytic leukemia",
"description": ""
},
{
"id": "MONDO:0011996",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011996",
"name": "chronic myelogenous leukaemia",
"description": ""
},
{
"id": "MONDO:0011996",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011996",
"name": "chronic myelogenous leukaemia (CML)",
"description": ""
},
{
"id": "MONDO:0011996",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011996",
"name": "chronic myelogenous leukemia",
"description": ""
},
{
"id": "MONDO:0011996",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011996",
"name": "chronic myelogenous leukemia (CML)",
"description": ""
},
{
"id": "MONDO:0011996",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011996",
"name": "chronic myelogenous leukemia, BCR-ABL1 Positive",
"description": ""
},
{
"id": "MONDO:0011996",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011996",
"name": "chronic myelogenous leukemias",
"description": ""
},
{
"id": "MONDO:0011996",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011996",
"name": "chronic myeloid leukaemia",
"description": ""
},
{
"id": "MONDO:0011996",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011996",
"name": "chronic myeloid leukemia",
"description": ""
},
{
"id": "MONDO:0011996",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011996",
"name": "hematopoeitic - chronic myelocytic leukaemia (CML)",
"description": ""
},
{
"id": "MONDO:0011996",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011996",
"name": "hematopoeitic - chronic myelocytic leukemia (CML)",
"description": ""
},
{
"id": "MONDO:0011996",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011996",
"name": "leukemia, Philadelphia chromosome-positive, resistant to imatinib, Somatic mutation",
"description": ""
},
{
"id": "MONDO:0011996",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011996",
"name": "leukemia, chronic myeloid, Philadelphia chromosome positive, somatic",
"description": ""
},
{
"id": "MONDO:0011996",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011996",
"name": "myeloid leukemia, chronic",
"description": ""
},
{
"id": "MONDO:0011996",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011996",
"name": "leukemia, chronic myelogenous",
"description": ""
},
{
"id": "MONDO:0011996",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011996",
"name": "leukemia, chronic myeloid",
"description": ""
},
{
"id": "MONDO:0011996",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011996",
"name": "leukemia, chronic myeloid, atypical",
"description": ""
},
{
"id": "MIM:608232",
"resource": "MIM",
"url": "https://www.omim.org/entry/608232",
"name": "Leukemia, chronic myeloid, atypical",
"description": "Leukemia, chronic myeloid, atypical"
}
],
"evidence": [
{
"id": "608232",
"database": "MIM",
"url": "https://www.omim.org/entry/608232"
}
]
},
{
"disease_id": "MONDO:0060532",
"recommended_name": {
"id": "MONDO:0060532",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0060532",
"name": "congenital heart defects and skeletal malformations syndrome",
"description": ""
},
"synonyms": [
{
"id": "MONDO:0060532",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0060532",
"name": "congenital heart defects and skeletal malformations syndrome",
"description": ""
},
{
"id": "MONDO:0060532",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0060532",
"name": "marfanoid habitus-facial dysmorphism-skeletal abnormality-heart defect syndrome",
"description": ""
},
{
"id": "MONDO:0060532",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0060532",
"name": "CHDSKM",
"description": ""
},
{
"id": "MIM:617602",
"resource": "MIM",
"url": "https://www.omim.org/entry/617602",
"name": "Congenital heart defects and skeletal malformations syndrome",
"description": "Congenital heart defects and skeletal malformations syndrome"
}
],
"evidence": [
{
"id": "617602",
"database": "MIM",
"url": "https://www.omim.org/entry/617602"
}
]
}
],
"snv": [
{
"evidence": [
{
"id": "rs775748939",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775748939"
},
{
"id": "rs775748939",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775748939"
},
{
"id": "rs775748939",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs775748939#frequency_tab"
},
{
"id": "rs775748939",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs775748939"
},
{
"id": "20668451",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/20668451"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 137,
"end_pos": 137,
"sequence_org": "A",
"sequence_mut": "S",
"comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NAA->NAS).",
"chr_id": "9",
"chr_pos": "130854956",
"ref_nt": "T",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "A137",
"keywords": [
"ebi",
"somatic"
]
},
{
"evidence": [
{
"id": "rs775748939",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775748939"
},
{
"id": "rs775748939",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775748939"
},
{
"id": "rs775748939",
"database": "NCI-TCGA",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775748939"
},
{
"id": "rs775748939",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs775748939#frequency_tab"
},
{
"id": "rs775748939",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs775748939"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 137,
"end_pos": 137,
"sequence_org": "A",
"sequence_mut": "T",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NAA->NAT).",
"chr_id": "9",
"chr_pos": "130854956",
"ref_nt": "A",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "A137",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs780160146",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780160146"
},
{
"id": "rs780160146",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780160146"
},
{
"id": "rs780160146",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs780160146"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 480,
"end_pos": 480,
"sequence_org": "P",
"sequence_mut": "L",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NPS->NLS).",
"chr_id": "9",
"chr_pos": "130880083",
"ref_nt": "T",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "P480",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs1182652234",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1182652234"
},
{
"id": "rs1182652234",
"database": "ENSEMBL",
"url": "https://www.ensembl.org/id/rs1182652234"
}
],
"glycoeffect": [
"n-glyco-sequon-gain",
"o-glyco-site-loss"
],
"start_pos": 501,
"end_pos": 501,
"sequence_org": "S",
"sequence_mut": "N",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SIS->NIS).",
"chr_id": "9",
"chr_pos": "130880146",
"ref_nt": "A",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "S501",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs772876615",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772876615"
},
{
"id": "rs772876615",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772876615"
},
{
"id": "rs772876615",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs772876615"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 645,
"end_pos": 645,
"sequence_org": "A",
"sequence_mut": "S",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NGA->NGS).",
"chr_id": "9",
"chr_pos": "130884223",
"ref_nt": "T",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "A645",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs772876615",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772876615"
},
{
"id": "rs772876615",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772876615"
},
{
"id": "rs772876615",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs772876615"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 645,
"end_pos": 645,
"sequence_org": "A",
"sequence_mut": "T",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NGA->NGT).",
"chr_id": "9",
"chr_pos": "130884223",
"ref_nt": "A",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "A645",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "P00519",
"database": "BioMuta",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P00519"
}
],
"glycoeffect": [
"n-glyco-sequon-gain",
"o-glyco-site-loss"
],
"start_pos": 688,
"end_pos": 688,
"subjects_tested": "0",
"subjects_positive": "0",
"frequency": "0.0",
"sequence_org": "K",
"sequence_mut": "N",
"comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (KKS->NKS).",
"chr_id": "9",
"chr_pos": "130884354",
"ref_nt": "G",
"alt_nt": "T",
"minor_allelic_frequency": "",
"site_lbl": "K688",
"disease": [
{
"disease_id": "DOID:3571",
"recommended_name": {
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "liver cancer",
"description": "A hepatobiliary system cancer that is located_in the liver."
},
"synonyms": [
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Ca liver - primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Resectable malignant neoplasm of Liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant hepato-biliary neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant tumor of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "non-resectable primary hepatic malignant neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary liver cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "resectable malignant neoplasm of the liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, not specified as primary or secondary",
"description": ""
}
]
}
],
"keywords": [
"biomuta",
"somatic",
"cancer",
"disease"
]
},
{
"evidence": [
{
"id": "rs1307730338",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1307730338"
},
{
"id": "rs1307730338",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs1307730338#frequency_tab"
}
],
"glycoeffect": [
"n-glyco-sequon-gain",
"o-glyco-site-loss"
],
"start_pos": 694,
"end_pos": 694,
"sequence_org": "T",
"sequence_mut": "N",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TSS->NSS).",
"chr_id": "9",
"chr_pos": "130884371",
"ref_nt": "A",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "T694",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs1038387407",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1038387407"
},
{
"id": "rs1038387407",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs1038387407"
}
],
"glycoeffect": [
"o-glyco-site-loss"
],
"start_pos": 840,
"end_pos": 840,
"sequence_org": "S",
"sequence_mut": "G",
"comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).",
"chr_id": "9",
"chr_pos": "130884808",
"ref_nt": "G",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "S840",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs763658540",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763658540"
},
{
"id": "rs763658540",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763658540"
},
{
"id": "rs763658540",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs763658540"
}
],
"glycoeffect": [
"o-glyco-site-loss"
],
"start_pos": 840,
"end_pos": 840,
"sequence_org": "S",
"sequence_mut": "N",
"comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->N).",
"chr_id": "9",
"chr_pos": "130884809",
"ref_nt": "A",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "S840",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs1180557682",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1180557682"
},
{
"id": "rs1180557682",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs1180557682"
}
],
"glycoeffect": [
"o-glyco-site-loss"
],
"start_pos": 854,
"end_pos": 854,
"sequence_org": "T",
"sequence_mut": "I",
"comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).",
"chr_id": "9",
"chr_pos": "130884851",
"ref_nt": "T",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "T854",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs768751299",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768751299"
},
{
"id": "rs768751299",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768751299"
},
{
"id": "rs768751299",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs768751299#frequency_tab"
},
{
"id": "rs768751299",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs768751299"
}
],
"glycoeffect": [
"o-glyco-site-loss"
],
"start_pos": 854,
"end_pos": 854,
"sequence_org": "T",
"sequence_mut": "P",
"comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->P).",
"chr_id": "9",
"chr_pos": "130884850",
"ref_nt": "C",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "T854",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs774659092",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774659092"
},
{
"id": "rs774659092",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774659092"
},
{
"id": "rs774659092",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs774659092#frequency_tab"
},
{
"id": "rs774659092",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs774659092"
}
],
"glycoeffect": [
"o-glyco-site-loss"
],
"start_pos": 855,
"end_pos": 855,
"sequence_org": "S",
"sequence_mut": "C",
"comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->C).",
"chr_id": "9",
"chr_pos": "130884853",
"ref_nt": "T",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "S855",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs587778016",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs587778016"
},
{
"id": "rs587778016",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs587778016"
},
{
"id": "rs587778016",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs587778016#frequency_tab"
},
{
"id": "rs587778016",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs587778016"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 96,
"end_pos": 96,
"sequence_org": "N",
"sequence_mut": "S",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NHN->NHS).",
"chr_id": "9",
"chr_pos": "130854834",
"ref_nt": "G",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "N96",
"keywords": [
"ebi",
"germline"
]
}
],
"mutagenesis": [
{
"start_pos": 735,
"end_pos": 735,
"sequence_org": "T",
"sequence_mut": "A",
"comment": "Abolishes phosphorylation. Loss of binding YWHAS and YWHAZ. Localizes to the nucleus. No effect on kinase activity.",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "PubMed",
"id": "15696159",
"url": "https://glygen.org/publication/PubMed/15696159"
}
]
}
],
"expression_tissue": [
{
"tissue": {
"name": "Adult mammalian kidney",
"namespace": "UBERON",
"id": "0000082",
"url": "http://purl.obolibrary.org/obo/UBERON_0000082"
},
"score": "85.93",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000097007",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000097007"
}
]
},
{
"tissue": {
"name": "Oral cavity",
"namespace": "UBERON",
"id": "0000167",
"url": "http://purl.obolibrary.org/obo/UBERON_0000167"
},
"score": "79.65",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000097007",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000097007"
}
]
},
{
"tissue": {
"name": "Stomach",
"namespace": "UBERON",
"id": "0000945",
"url": "http://purl.obolibrary.org/obo/UBERON_0000945"
},
"score": "89.98",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000097007",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000097007"
}
]
},
{
"tissue": {
"name": "Uterus",
"namespace": "UBERON",
"id": "0000995",
"url": "http://purl.obolibrary.org/obo/UBERON_0000995"
},
"score": "89.45",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000097007",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000097007"
}
]
},
{
"tissue": {
"name": "Esophagus",
"namespace": "UBERON",
"id": "0001043",
"url": "http://purl.obolibrary.org/obo/UBERON_0001043"
},
"score": "96.47",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000097007",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000097007"
}
]
},
{
"tissue": {
"name": "Rectum",
"namespace": "UBERON",
"id": "0001052",
"url": "http://purl.obolibrary.org/obo/UBERON_0001052"
},
"score": "92.69",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000097007",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000097007"
}
]
},
{
"tissue": {
"name": "Colon",
"namespace": "UBERON",
"id": "0001155",
"url": "http://purl.obolibrary.org/obo/UBERON_0001155"
},
"score": "89.03",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000097007",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000097007"
}
]
},
{
"tissue": {
"name": "Urinary bladder",
"namespace": "UBERON",
"id": "0001255",
"url": "http://purl.obolibrary.org/obo/UBERON_0001255"
},
"score": "92.47",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000097007",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000097007"
}
]
},
{
"tissue": {
"name": "Thyroid gland",
"namespace": "UBERON",
"id": "0002046",
"url": "http://purl.obolibrary.org/obo/UBERON_0002046"
},
"score": "94.01",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000097007",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000097007"
}
]
},
{
"tissue": {
"name": "Lung",
"namespace": "UBERON",
"id": "0002048",
"url": "http://purl.obolibrary.org/obo/UBERON_0002048"
},
"score": "87.87",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000097007",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000097007"
}
]
},
{
"tissue": {
"name": "Liver",
"namespace": "UBERON",
"id": "0002107",
"url": "http://purl.obolibrary.org/obo/UBERON_0002107"
},
"score": "82.6",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000097007",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000097007"
}
]
},
{
"tissue": {
"name": "Prostate gland",
"namespace": "UBERON",
"id": "0002367",
"url": "http://purl.obolibrary.org/obo/UBERON_0002367"
},
"score": "92.65",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000097007",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000097007"
}
]
},
{
"tissue": {
"name": "Thoracic mammary gland",
"namespace": "UBERON",
"id": "0005200",
"url": "http://purl.obolibrary.org/obo/UBERON_0005200"
},
"score": "92.59",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000097007",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000097007"
}
]
}
],
"expression_disease": [
{
"significant": "No",
"trend": "down",
"name": "Prostate cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10283",
"evidence": [
{
"database": "BioXpress",
"id": "P00519",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00519"
}
],
"disease": [
{
"disease_id": "DOID:10283",
"recommended_name": {
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer",
"description": "A male reproductive organ cancer that is located_in the prostate."
},
"synonyms": [
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "NGP - new growth of prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "malignant tumor of the prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "tumor of the prostate",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, type 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "HPC9",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene."
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "EHBP1 familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "familial prostate cancer caused by mutation in EHBP1",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, type 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "HPC12",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, type 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "HPC5",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, type 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, susceptibility to, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "HPC3",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, type 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, susceptibility to, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "HPC4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, on chromosome 7",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene."
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "MSMB familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "familial prostate cancer caused by mutation in MSMB",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, type 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "HPC13",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, type 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "HPC8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "predisposing for prostate cancer",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, type 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "HPC6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "HPC10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate carcinoma",
"description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma."
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate carcinoma",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, somatic",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, hereditary",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "HPC7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer aggressiveness",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene."
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "RNASEL familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "familial prostate cancer caused by mutation in RNASEL",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, type 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "HPC1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "Prca1",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "HPC11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "HPC14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "HPC15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "HPCX1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer susceptibility, X-linked",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "HPCX2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MIM:611868",
"resource": "MIM",
"url": "https://www.omim.org/entry/611868",
"name": "Prostate cancer, hereditary, 12",
"description": "Prostate cancer, hereditary, 12"
},
{
"id": "MIM:611928",
"resource": "MIM",
"url": "https://www.omim.org/entry/611928",
"name": "Prostate cancer, hereditary, 13",
"description": "Prostate cancer, hereditary, 13"
},
{
"id": "MIM:176807",
"resource": "MIM",
"url": "https://www.omim.org/entry/176807",
"name": "Prostate cancer",
"description": "Prostate cancer"
},
{
"id": "MIM:601518",
"resource": "MIM",
"url": "https://www.omim.org/entry/601518",
"name": "Prostate cancer, hereditary, 1",
"description": "Prostate cancer, hereditary, 1"
},
{
"id": "MIM:611955",
"resource": "MIM",
"url": "https://www.omim.org/entry/611955",
"name": "Prostate cancer, hereditary, 11",
"description": "Prostate cancer, hereditary, 11"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Stomach cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10534",
"evidence": [
{
"database": "BioXpress",
"id": "P00519",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00519"
}
],
"disease": [
{
"disease_id": "DOID:10534",
"recommended_name": {
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "stomach cancer",
"description": "A gastrointestinal system cancer that is located_in the stomach."
},
"synonyms": [
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric cancer",
"description": ""
},
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": "A primary or metastatic malignant neoplasm involving the stomach."
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca lesser curvature - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "cancer of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer risk after h. pylori infection",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumor",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumour",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant stomach neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "stomach cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca body - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "ca greater curvature of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, intestinal",
"description": ""
},
{
"id": "MIM:613659",
"resource": "MIM",
"url": "https://www.omim.org/entry/613659",
"name": "Gastric cancer",
"description": "Gastric cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Urinary bladder cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11054",
"evidence": [
{
"database": "BioXpress",
"id": "P00519",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00519"
}
],
"disease": [
{
"disease_id": "DOID:11054",
"recommended_name": {
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "urinary bladder cancer",
"description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder."
},
"synonyms": [
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "bladder cancer",
"description": ""
},
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": "A primary or metastatic malignant neoplasm involving the bladder."
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "bladder cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "cancer of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumour",
"description": ""
},
{
"id": "MIM:109800",
"resource": "MIM",
"url": "https://www.omim.org/entry/109800",
"name": "Bladder cancer",
"description": "Bladder cancer"
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Head and neck cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11934",
"evidence": [
{
"database": "BioXpress",
"id": "P00519",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00519"
}
],
"disease": [
{
"disease_id": "DOID:11934",
"recommended_name": {
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck cancer",
"description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx."
},
"synonyms": [
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck tumours",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head/neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "tumor of head and neck",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Lung cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1324",
"evidence": [
{
"database": "BioXpress",
"id": "P00519",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00519"
}
],
"disease": [
{
"disease_id": "DOID:1324",
"recommended_name": {
"id": "DOID:1324",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1324",
"name": "lung cancer",
"description": "A respiratory system cancer that is located_in the lung."
},
"synonyms": [
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "LNCR1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "LNCR3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "adenocarcinoma of lung, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "LNCR4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "LNCR5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": "A malignant neoplasm involving the lung."
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "cancer of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung neoplasm",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumor",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumour",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "Nonsmall cell lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "alveolar cell carcinoma",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung neoplasm",
"description": ""
},
{
"id": "MIM:211980",
"resource": "MIM",
"url": "https://www.omim.org/entry/211980",
"name": "Lung cancer",
"description": "Lung cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Breast cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1612",
"evidence": [
{
"database": "BioXpress",
"id": "P00519",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00519"
}
],
"disease": [
{
"disease_id": "DOID:1612",
"recommended_name": {
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast cancer",
"description": "A thoracic cancer that originates in the mammary gland."
},
"synonyms": [
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant neoplasm of breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant tumor of the breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary cancer",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "primary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma."
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer susceptibility, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, lobular, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of the breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial Male",
"description": ""
},
{
"id": "MIM:114480",
"resource": "MIM",
"url": "https://www.omim.org/entry/114480",
"name": "Breast cancer",
"description": "Breast cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Thyroid cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1781",
"evidence": [
{
"database": "BioXpress",
"id": "P00519",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00519"
}
],
"disease": [
{
"disease_id": "DOID:1781",
"recommended_name": {
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid cancer",
"description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage."
},
"synonyms": [
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid gland cancer",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "Thyroid gland neoplasm",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant tumour of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Kidney cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:263",
"evidence": [
{
"database": "BioXpress",
"id": "P00519",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00519"
}
],
"disease": [
{
"disease_id": "DOID:263",
"recommended_name": {
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "kidney cancer",
"description": "A urinary system cancer that is located_in the kidney."
},
"synonyms": [
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant neoplasm of kidney except pelvis",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant tumour of kidney",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "renal cancer",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Liver cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:3571",
"evidence": [
{
"database": "BioXpress",
"id": "P00519",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00519"
}
],
"disease": [
{
"disease_id": "DOID:3571",
"recommended_name": {
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "liver cancer",
"description": "A hepatobiliary system cancer that is located_in the liver."
},
"synonyms": [
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Ca liver - primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Resectable malignant neoplasm of Liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant hepato-biliary neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant tumor of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "non-resectable primary hepatic malignant neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary liver cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "resectable malignant neoplasm of the liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, not specified as primary or secondary",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Uterine cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:363",
"evidence": [
{
"database": "BioXpress",
"id": "P00519",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00519"
}
],
"disease": [
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Esophageal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:5041",
"evidence": [
{
"database": "BioXpress",
"id": "P00519",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00519"
}
],
"disease": [
{
"disease_id": "DOID:5041",
"recommended_name": {
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophageal cancer",
"description": "A gastrointestinal system cancer that is located_in the esophagus."
},
"synonyms": [
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophagus cancer",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Distal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Proximal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of the middle Third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": "A primary or metastatic malignant neoplasm involving the esophagus."
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "oesophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the middle third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of abdominal oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the middle third of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Aerodigestive tract cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Escc, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "gastric cardia adenocarcinoma, susceptibility to",
"description": ""
},
{
"id": "MIM:133239",
"resource": "MIM",
"url": "https://www.omim.org/entry/133239",
"name": "Esophageal cancer",
"description": "Esophageal cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Colorectal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:9256",
"evidence": [
{
"database": "BioXpress",
"id": "P00519",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00519"
}
],
"disease": [
{
"disease_id": "DOID:9256",
"recommended_name": {
"id": "DOID:9256",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9256",
"name": "colorectal cancer",
"description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
},
"synonyms": [
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, advanced, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer with chromosomal instability, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectum cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectum neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "CRC",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "large intestine cancer",
"description": ""
},
{
"id": "MIM:114500",
"resource": "MIM",
"url": "https://www.omim.org/entry/114500",
"name": "Colorectal cancer",
"description": "Colorectal cancer"
}
]
}
]
}
],
"species": [
{
"name": "Homo sapiens",
"taxid": 9606,
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"common_name": "Human"
}
],
"gene": [
{
"name": "ABL1",
"url": "https://www.uniprot.org/uniprot/P00519",
"locus": {
"chromosome": "9",
"start_pos": 178795,
"end_pos": 4163,
"strand": "-",
"evidence": [
{
"database": "Ensembl Gene",
"id": "LRG_769",
"url": "https://www.ensembl.org/id/LRG_769"
}
]
}
}
],
"crossref": [
{
"id": "ENSG00000097007",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000097007",
"database": "Bgee",
"categories": [
"Gene Expression"
]
},
{
"id": "P00519",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P00519",
"database": "BioMuta",
"categories": [
"Variation"
]
},
{
"id": "2.7.10.2",
"url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.7.10.2&UniProtAcc=P00519",
"database": "BRENDA",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "cd05052",
"url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05052",
"database": "CDD",
"categories": [
"Protein Classification"
]
},
{
"id": "cd09935",
"url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd09935",
"database": "CDD",
"categories": [
"Protein Classification"
]
},
{
"id": "cd11850",
"url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd11850",
"database": "CDD",
"categories": [
"Protein Classification"
]
},
{
"id": "CHEMBL1862",
"url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL1862",
"database": "ChEMBL",
"categories": [
"Other"
]
},
{
"id": "ABL1",
"url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=ABL1",
"database": "GeneCards",
"categories": [
"Gene Annotation",
"Organism-specific"
]
},
{
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25",
"database": "GeneID",
"categories": [
"Genome Annotation"
]
},
{
"id": "76",
"url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=76",
"database": "HGNC",
"categories": [
"Organism-specific"
]
},
{
"id": "P00519",
"url": "https://www.ebi.ac.uk/intact/interactors/id:P00519*",
"database": "IntAct",
"categories": [
"Other"
]
},
{
"id": "IPR000719",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR000719",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR000980",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR000980",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR001245",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR001245",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR001452",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR001452",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR008266",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR008266",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR011009",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR011009",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR015015",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR015015",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR017441",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR017441",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR020635",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR020635",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR035837",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR035837",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR036028",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR036028",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR036860",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR036860",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "hsa:25",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:25",
"database": "KEGG Pathway",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "189980",
"url": "http://www.omim.org/entry/189980",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "608232",
"url": "http://www.omim.org/entry/608232",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "617602",
"url": "http://www.omim.org/entry/617602",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "NX_P00519",
"url": "https://www.nextprot.org/entry/NX_P00519",
"database": "neXtProt",
"categories": [
"Protein",
"Organism-specific"
]
},
{
"id": "P00519",
"url": "https://oglcnac.org/atlas/detail/P00519",
"database": "O-GlcNAc Atlas",
"categories": [
"Glycoproteomics"
]
},
{
"id": "P00519",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P00519",
"database": "O-GlcNAc Database",
"categories": [
"Glycoproteomics"
]
},
{
"id": "LSHKEET",
"url": "https://omabrowser.org/oma/group/LSHKEET/",
"database": "OMA",
"categories": [
"Protein Classification"
]
},
{
"id": "1614410at2759",
"url": "http://www.orthodb.org/?query=1614410at2759",
"database": "OrthoDB",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR24418",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24418",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR24418:SF438",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24418:SF438",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "1AB2",
"url": "https://www.rcsb.org/structure/1AB2",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1AWO",
"url": "https://www.rcsb.org/structure/1AWO",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1BBZ",
"url": "https://www.rcsb.org/structure/1BBZ",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1JU5",
"url": "https://www.rcsb.org/structure/1JU5",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1OPL",
"url": "https://www.rcsb.org/structure/1OPL",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1ZZP",
"url": "https://www.rcsb.org/structure/1ZZP",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2ABL",
"url": "https://www.rcsb.org/structure/2ABL",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2E2B",
"url": "https://www.rcsb.org/structure/2E2B",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2F4J",
"url": "https://www.rcsb.org/structure/2F4J",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2FO0",
"url": "https://www.rcsb.org/structure/2FO0",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2G1T",
"url": "https://www.rcsb.org/structure/2G1T",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2G2F",
"url": "https://www.rcsb.org/structure/2G2F",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2G2H",
"url": "https://www.rcsb.org/structure/2G2H",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2G2I",
"url": "https://www.rcsb.org/structure/2G2I",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2GQG",
"url": "https://www.rcsb.org/structure/2GQG",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2HIW",
"url": "https://www.rcsb.org/structure/2HIW",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2HYY",
"url": "https://www.rcsb.org/structure/2HYY",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2HZ0",
"url": "https://www.rcsb.org/structure/2HZ0",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2HZ4",
"url": "https://www.rcsb.org/structure/2HZ4",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2HZI",
"url": "https://www.rcsb.org/structure/2HZI",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2O88",
"url": "https://www.rcsb.org/structure/2O88",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2V7A",
"url": "https://www.rcsb.org/structure/2V7A",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3CS9",
"url": "https://www.rcsb.org/structure/3CS9",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3EG0",
"url": "https://www.rcsb.org/structure/3EG0",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3EG1",
"url": "https://www.rcsb.org/structure/3EG1",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3EG2",
"url": "https://www.rcsb.org/structure/3EG2",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3EG3",
"url": "https://www.rcsb.org/structure/3EG3",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3EGU",
"url": "https://www.rcsb.org/structure/3EGU",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3K2M",
"url": "https://www.rcsb.org/structure/3K2M",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3PYY",
"url": "https://www.rcsb.org/structure/3PYY",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3QRI",
"url": "https://www.rcsb.org/structure/3QRI",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3QRJ",
"url": "https://www.rcsb.org/structure/3QRJ",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3QRK",
"url": "https://www.rcsb.org/structure/3QRK",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3T04",
"url": "https://www.rcsb.org/structure/3T04",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3UE4",
"url": "https://www.rcsb.org/structure/3UE4",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3UYO",
"url": "https://www.rcsb.org/structure/3UYO",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4J9B",
"url": "https://www.rcsb.org/structure/4J9B",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4J9C",
"url": "https://www.rcsb.org/structure/4J9C",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4J9D",
"url": "https://www.rcsb.org/structure/4J9D",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4J9E",
"url": "https://www.rcsb.org/structure/4J9E",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4J9F",
"url": "https://www.rcsb.org/structure/4J9F",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4J9G",
"url": "https://www.rcsb.org/structure/4J9G",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4J9H",
"url": "https://www.rcsb.org/structure/4J9H",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4J9I",
"url": "https://www.rcsb.org/structure/4J9I",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4JJB",
"url": "https://www.rcsb.org/structure/4JJB",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4JJC",
"url": "https://www.rcsb.org/structure/4JJC",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4JJD",
"url": "https://www.rcsb.org/structure/4JJD",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4TWP",
"url": "https://www.rcsb.org/structure/4TWP",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4WA9",
"url": "https://www.rcsb.org/structure/4WA9",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4XEY",
"url": "https://www.rcsb.org/structure/4XEY",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4YC8",
"url": "https://www.rcsb.org/structure/4YC8",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4ZOG",
"url": "https://www.rcsb.org/structure/4ZOG",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5DC0",
"url": "https://www.rcsb.org/structure/5DC0",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5DC4",
"url": "https://www.rcsb.org/structure/5DC4",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5DC9",
"url": "https://www.rcsb.org/structure/5DC9",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5HU9",
"url": "https://www.rcsb.org/structure/5HU9",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5MO4",
"url": "https://www.rcsb.org/structure/5MO4",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5NP2",
"url": "https://www.rcsb.org/structure/5NP2",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5OAZ",
"url": "https://www.rcsb.org/structure/5OAZ",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6AMV",
"url": "https://www.rcsb.org/structure/6AMV",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6AMW",
"url": "https://www.rcsb.org/structure/6AMW",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6BL8",
"url": "https://www.rcsb.org/structure/6BL8",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6NPE",
"url": "https://www.rcsb.org/structure/6NPE",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6NPU",
"url": "https://www.rcsb.org/structure/6NPU",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6NPV",
"url": "https://www.rcsb.org/structure/6NPV",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6XR6",
"url": "https://www.rcsb.org/structure/6XR6",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6XR7",
"url": "https://www.rcsb.org/structure/6XR7",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6XRG",
"url": "https://www.rcsb.org/structure/6XRG",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7CC2",
"url": "https://www.rcsb.org/structure/7CC2",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7DT2",
"url": "https://www.rcsb.org/structure/7DT2",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7N9G",
"url": "https://www.rcsb.org/structure/7N9G",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7PVQ",
"url": "https://www.rcsb.org/structure/7PVQ",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7PVR",
"url": "https://www.rcsb.org/structure/7PVR",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7PVS",
"url": "https://www.rcsb.org/structure/7PVS",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7PVV",
"url": "https://www.rcsb.org/structure/7PVV",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7PW2",
"url": "https://www.rcsb.org/structure/7PW2",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7W7X",
"url": "https://www.rcsb.org/structure/7W7X",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7W7Y",
"url": "https://www.rcsb.org/structure/7W7Y",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "8H7F",
"url": "https://www.rcsb.org/structure/8H7F",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "8H7H",
"url": "https://www.rcsb.org/structure/8H7H",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "8SSN",
"url": "https://www.rcsb.org/structure/8SSN",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "PF00017",
"url": "http://pfam.xfam.org/family/PF00017",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "PF00018",
"url": "http://pfam.xfam.org/family/PF00018",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "PF07714",
"url": "http://pfam.xfam.org/family/PF07714",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "PF08919",
"url": "http://pfam.xfam.org/family/PF08919",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "P00519",
"url": "https://pharos.nih.gov/targets/P00519",
"database": "PHAROS",
"categories": [
"Organism-specific"
]
},
{
"id": "PR_P00519",
"url": "http://purl.obolibrary.org/obo/PR_P00519",
"database": "PRO",
"categories": [
"Protein"
]
},
{
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-428890",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-428890",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-525793",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-525793",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-5663213",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663213",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-5685938",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685938",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-8939236",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-8940973",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8940973",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9664422",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664422",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-983231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "NP_005148",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_005148",
"database": "RefSeq",
"categories": [
"Protein"
]
},
{
"id": "10596",
"url": "https://www.rhea-db.org/rhea/10596",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P00519-1",
"url": "https://www.uniprot.org/uniprot/P00519-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P00519-2",
"url": "https://www.uniprot.org/uniprot/P00519-2",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "R4GRW0",
"url": "https://www.uniprot.org/uniprot/R4GRW0",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "R4GRW0-1",
"url": "https://www.uniprot.org/uniprot/R4GRW0-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
}
],
"sequence": {
"sequence": "MLEICLKLVGCKSKKGLSSSSSCYLEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKQGVRGAVSTLLQAPELPTKTRTSRRAAEHRDTTDVPEMPHSKGQGESDPLDHEPAVSPLLPRKERGPPEGGLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGQPERRGAGEEEGRDISNGALAFTPLDTADPAKSPKPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLTSSRLATGEEEGGGSSSKRFLRSCSASCVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTVTPPPRLVKKNEEAADEVFKDIMESSPGSSPPNLTPKPLRRQVTVAPASGLPHKEEAGKGSALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLSRLKPAPPPPPAASAGKAGGKPSQSPSQEAAGEAVLGAKTKATSLVDAVNSDAAKPSQPGEGLKKPVLPATPKPQSAKPSGTPISPAPVPSTLPSASSALAGDQPSSTAFIPLISTRVSLRKTRQPPERIASGAITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSYVDSIQQMRNKFAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSSVKEISDIVQR",
"length": 1130,
"header": "sp|P00519-1|ABL1_HUMAN Isoform 1 of Tyrosine-protein kinase ABL1 OS=Homo sapiens OX=9606 GN=ABL1 PE=1 SV=4 CANONICAL=P00519-1"
},
"isoforms": [
{
"isoform_ac": "P00519-1",
"url": "",
"sequence": {
"sequence": "MLEICLKLVGCKSKKGLSSSSSCYLEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKQGVRGAVSTLLQAPELPTKTRTSRRAAEHRDTTDVPEMPHSKGQGESDPLDHEPAVSPLLPRKERGPPEGGLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGQPERRGAGEEEGRDISNGALAFTPLDTADPAKSPKPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLTSSRLATGEEEGGGSSSKRFLRSCSASCVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTVTPPPRLVKKNEEAADEVFKDIMESSPGSSPPNLTPKPLRRQVTVAPASGLPHKEEAGKGSALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLSRLKPAPPPPPAASAGKAGGKPSQSPSQEAAGEAVLGAKTKATSLVDAVNSDAAKPSQPGEGLKKPVLPATPKPQSAKPSGTPISPAPVPSTLPSASSALAGDQPSSTAFIPLISTRVSLRKTRQPPERIASGAITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSYVDSIQQMRNKFAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSSVKEISDIVQR",
"length": 1130,
"header": "sp|P00519-1|ABL1_HUMAN Isoform 1 of Tyrosine-protein kinase ABL1 OS=Homo sapiens OX=9606 GN=ABL1 PE=1 SV=4 CANONICAL=P00519-1"
},
"locus": {
"chromosome": "9",
"start_pos": 130885680,
"end_pos": 130835447,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000318560.6",
"url": "https://www.ensembl.org/id/ENST00000318560.6"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000323315.5",
"url": "https://www.ensembl.org/id/ENSP00000323315.5"
}
]
}
},
{
"isoform_ac": "P00519-2",
"url": "",
"sequence": {
"sequence": "MGQQPGKVLGDQRRPSLPALHFIKGAGKKESSRHGGPHCNVFVEHEALQRPVASDFEPQGLSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKQGVRGAVSTLLQAPELPTKTRTSRRAAEHRDTTDVPEMPHSKGQGESDPLDHEPAVSPLLPRKERGPPEGGLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGQPERRGAGEEEGRDISNGALAFTPLDTADPAKSPKPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLTSSRLATGEEEGGGSSSKRFLRSCSASCVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTVTPPPRLVKKNEEAADEVFKDIMESSPGSSPPNLTPKPLRRQVTVAPASGLPHKEEAGKGSALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLSRLKPAPPPPPAASAGKAGGKPSQSPSQEAAGEAVLGAKTKATSLVDAVNSDAAKPSQPGEGLKKPVLPATPKPQSAKPSGTPISPAPVPSTLPSASSALAGDQPSSTAFIPLISTRVSLRKTRQPPERIASGAITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSYVDSIQQMRNKFAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSSVKEISDIVQR",
"length": 1149,
"header": "sp|P00519-2|ABL1_HUMAN Isoform 2 of Tyrosine-protein kinase ABL1 OS=Homo sapiens OX=9606 GN=ABL1 PE=1 SV=4 CANONICAL=P00519-1"
},
"locus": {
"chromosome": "9",
"start_pos": 130885680,
"end_pos": 130714320,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000372348.9",
"url": "https://www.ensembl.org/id/ENST00000372348.9"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000361423.2",
"url": "https://www.ensembl.org/id/ENSP00000361423.2"
}
]
}
},
{
"isoform_ac": "R4GRW0-1",
"url": "",
"sequence": {
"sequence": "MGQQPGKVLGDQRRPSLPALHFIKGAGKKESSRHGGPHCNVFVEHALQRPVASDFEPQGLSEAA",
"length": 64,
"header": "tr|R4GRW0-1|R4GRW0_HUMAN Computationally mapped isoform of ABL proto-oncogene 1, non-receptor tyrosine kinase OS=Homo sapiens OX=9606 GN=ABL1 PE=1 SV=1 CANONICAL=P00519-1"
},
"locus": {
"chromosome": "9",
"start_pos": 130854122,
"end_pos": 130714320,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000393293.4",
"url": "https://www.ensembl.org/id/ENST00000393293.4"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000376971.4",
"url": "https://www.ensembl.org/id/ENSP00000376971.4"
}
]
}
}
],
"glycosylation": [
{
"glytoucan_ac": "G49108TO",
"type": "O-linked",
"subtype": "O-GlcNAcylation",
"site_category": "reported_with_glycan",
"site_seq": "S",
"relation": "attached",
"comment": "O-GlcNAcylation",
"start_pos": 840,
"start_aa": "Ser",
"end_pos": 840,
"end_aa": "Ser",
"residue": "Ser",
"site_lbl": "Ser840",
"evidence": [
{
"id": "P00519",
"database": "O-GlcNAc Database",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P00519"
},
{
"id": "28657654",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/28657654"
},
{
"id": "30059200",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/30059200"
},
{
"id": "35254053",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/35254053"
}
]
},
{
"glytoucan_ac": "G49108TO",
"type": "O-linked",
"subtype": "O-GlcNAcylation",
"site_category": "reported_with_glycan",
"site_seq": "T",
"relation": "attached",
"comment": "O-GlcNAcylation",
"start_pos": 854,
"start_aa": "Thr",
"end_pos": 854,
"end_aa": "Thr",
"residue": "Thr",
"site_lbl": "Thr854",
"evidence": [
{
"id": "P00519",
"database": "O-GlcNAc Atlas",
"url": "https://oglcnac.org/atlas/detail/P00519"
},
{
"id": "31373491",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/31373491"
}
]
},
{
"glytoucan_ac": "G49108TO",
"type": "O-linked",
"subtype": "O-GlcNAcylation",
"site_category": "reported_with_glycan",
"site_seq": "S",
"relation": "attached",
"comment": "O-GlcNAcylation",
"start_pos": 855,
"start_aa": "Ser",
"end_pos": 855,
"end_aa": "Ser",
"residue": "Ser",
"site_lbl": "Ser855",
"evidence": [
{
"id": "P00519",
"database": "O-GlcNAc Database",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P00519"
},
{
"id": "28657654",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/28657654"
},
{
"id": "30059200",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/30059200"
},
{
"id": "35254053",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/35254053"
},
{
"id": "P00519",
"database": "O-GlcNAc Atlas",
"url": "https://oglcnac.org/atlas/detail/P00519"
}
]
}
],
"phosphorylation": [
{
"start_pos": 115,
"end_pos": 115,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Tyr",
"comment": "Phosphotyrosine",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "PubMed",
"id": "16912036",
"url": "https://glygen.org/publication/PubMed/16912036"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "16497976",
"url": "https://glygen.org/publication/PubMed/16497976"
}
],
"site_lbl": "Tyr115"
},
{
"start_pos": 128,
"end_pos": 128,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Tyr",
"comment": "Phosphotyrosine",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "PubMed",
"id": "16912036",
"url": "https://glygen.org/publication/PubMed/16912036"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"site_lbl": "Tyr128"
},
{
"start_pos": 139,
"end_pos": 139,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Tyr",
"comment": "Phosphotyrosine",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "PubMed",
"id": "16912036",
"url": "https://glygen.org/publication/PubMed/16912036"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"site_lbl": "Tyr139"
},
{
"start_pos": 172,
"end_pos": 172,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Tyr",
"comment": "Phosphotyrosine",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "PubMed",
"id": "16912036",
"url": "https://glygen.org/publication/PubMed/16912036"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"site_lbl": "Tyr172"
},
{
"start_pos": 185,
"end_pos": 185,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Tyr",
"comment": "Phosphotyrosine",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "PubMed",
"id": "16912036",
"url": "https://glygen.org/publication/PubMed/16912036"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "12522270",
"url": "https://glygen.org/publication/PubMed/12522270"
},
{
"database": "PubMed",
"id": "16497976",
"url": "https://glygen.org/publication/PubMed/16497976"
},
{
"database": "PubMed",
"id": "18691976",
"url": "https://glygen.org/publication/PubMed/18691976"
},
{
"database": "phospho.ELM",
"id": "P00519",
"url": "http://phospho.elm.eu.org/byAccession/P00519.html"
},
{
"database": "PubMed",
"id": "18083107",
"url": "https://glygen.org/publication/PubMed/18083107"
}
],
"site_lbl": "Tyr185"
},
{
"start_pos": 215,
"end_pos": 215,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Tyr",
"comment": "Phosphotyrosine",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "PubMed",
"id": "16912036",
"url": "https://glygen.org/publication/PubMed/16912036"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"site_lbl": "Tyr215"
},
{
"start_pos": 226,
"end_pos": 226,
"kinase_uniprot_canonical_ac": "P00519-1",
"kinase_gene_name": "ABL1",
"residue": "Tyr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "12522270",
"url": "https://glygen.org/publication/PubMed/12522270"
},
{
"database": "PubMed",
"id": "16497976",
"url": "https://glygen.org/publication/PubMed/16497976"
},
{
"database": "PubMed",
"id": "12748290",
"url": "https://glygen.org/publication/PubMed/12748290"
},
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "PubMed",
"id": "16912036",
"url": "https://glygen.org/publication/PubMed/16912036"
}
],
"site_lbl": "Tyr226"
},
{
"start_pos": 226,
"end_pos": 226,
"kinase_uniprot_canonical_ac": "P12931-1",
"kinase_gene_name": "SRC",
"residue": "Tyr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "11847100",
"url": "https://glygen.org/publication/PubMed/11847100"
}
],
"site_lbl": "Tyr226"
},
{
"start_pos": 226,
"end_pos": 226,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Tyr",
"comment": "Phosphotyrosine; by autocatalysis",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "IntAct",
"id": "P00519",
"url": "https://www.ebi.ac.uk/intact/interactors/id:P00519*"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "12384576",
"url": "https://glygen.org/publication/PubMed/12384576"
},
{
"database": "phospho.ELM",
"id": "P00519",
"url": "http://phospho.elm.eu.org/byAccession/P00519.html"
},
{
"database": "PubMed",
"id": "12522270",
"url": "https://glygen.org/publication/PubMed/12522270"
},
{
"database": "PubMed",
"id": "10964922",
"url": "https://glygen.org/publication/PubMed/10964922"
},
{
"database": "PubMed",
"id": "11847100",
"url": "https://glygen.org/publication/PubMed/11847100"
}
],
"site_lbl": "Tyr226"
},
{
"start_pos": 229,
"end_pos": 229,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "Phosphoserine",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "19651622",
"url": "https://glygen.org/publication/PubMed/19651622"
}
],
"site_lbl": "Ser229"
},
{
"start_pos": 232,
"end_pos": 232,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Tyr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "16497976",
"url": "https://glygen.org/publication/PubMed/16497976"
}
],
"site_lbl": "Tyr232"
},
{
"start_pos": 253,
"end_pos": 253,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Tyr",
"comment": "Phosphotyrosine",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "PubMed",
"id": "23186163",
"url": "https://glygen.org/publication/PubMed/23186163"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "12522270",
"url": "https://glygen.org/publication/PubMed/12522270"
},
{
"database": "PubMed",
"id": "16497976",
"url": "https://glygen.org/publication/PubMed/16497976"
}
],
"site_lbl": "Tyr253"
},
{
"start_pos": 257,
"end_pos": 257,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Tyr",
"comment": "Phosphotyrosine",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "PubMed",
"id": "23186163",
"url": "https://glygen.org/publication/PubMed/23186163"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "12522270",
"url": "https://glygen.org/publication/PubMed/12522270"
},
{
"database": "PubMed",
"id": "16497976",
"url": "https://glygen.org/publication/PubMed/16497976"
}
],
"site_lbl": "Tyr257"
},
{
"start_pos": 264,
"end_pos": 264,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Tyr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "12522270",
"url": "https://glygen.org/publication/PubMed/12522270"
},
{
"database": "phospho.ELM",
"id": "P00519",
"url": "http://phospho.elm.eu.org/byAccession/P00519.html"
}
],
"site_lbl": "Tyr264"
},
{
"start_pos": 315,
"end_pos": 315,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Thr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "24155950",
"url": "https://glygen.org/publication/PubMed/24155950"
},
{
"database": "PubMed",
"id": "31044085",
"url": "https://glygen.org/publication/PubMed/31044085"
}
],
"site_lbl": "Thr315"
},
{
"start_pos": 392,
"end_pos": 392,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Thr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "18691976",
"url": "https://glygen.org/publication/PubMed/18691976"
}
],
"site_lbl": "Thr392"
},
{
"start_pos": 393,
"end_pos": 393,
"kinase_uniprot_canonical_ac": "P00519-1",
"kinase_gene_name": "ABL1",
"residue": "Tyr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "12748290",
"url": "https://glygen.org/publication/PubMed/12748290"
},
{
"database": "PubMed",
"id": "10964922",
"url": "https://glygen.org/publication/PubMed/10964922"
},
{
"database": "PubMed",
"id": "11781820",
"url": "https://glygen.org/publication/PubMed/11781820"
},
{
"database": "PubMed",
"id": "8441409",
"url": "https://glygen.org/publication/PubMed/8441409"
},
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "PubMed",
"id": "16912036",
"url": "https://glygen.org/publication/PubMed/16912036"
}
],
"site_lbl": "Tyr393"
},
{
"start_pos": 393,
"end_pos": 393,
"kinase_uniprot_canonical_ac": "P12931-1",
"kinase_gene_name": "SRC",
"residue": "Tyr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "11781820",
"url": "https://glygen.org/publication/PubMed/11781820"
},
{
"database": "PubMed",
"id": "16497976",
"url": "https://glygen.org/publication/PubMed/16497976"
},
{
"database": "PubMed",
"id": "18691976",
"url": "https://glygen.org/publication/PubMed/18691976"
},
{
"database": "PubMed",
"id": "19901323",
"url": "https://glygen.org/publication/PubMed/19901323"
},
{
"database": "PubMed",
"id": "11847100",
"url": "https://glygen.org/publication/PubMed/11847100"
}
],
"site_lbl": "Tyr393"
},
{
"start_pos": 393,
"end_pos": 393,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Tyr",
"comment": "Phosphotyrosine; by autocatalysis and SRC-type Tyr-kinases",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "phospho.ELM",
"id": "P00519",
"url": "http://phospho.elm.eu.org/byAccession/P00519.html"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "10964922",
"url": "https://glygen.org/publication/PubMed/10964922"
},
{
"database": "PubMed",
"id": "11781820",
"url": "https://glygen.org/publication/PubMed/11781820"
},
{
"database": "PubMed",
"id": "12522270",
"url": "https://glygen.org/publication/PubMed/12522270"
},
{
"database": "PubMed",
"id": "12149456",
"url": "https://glygen.org/publication/PubMed/12149456"
},
{
"database": "PubMed",
"id": "22493660",
"url": "https://glygen.org/publication/PubMed/22493660"
}
],
"site_lbl": "Tyr393"
},
{
"start_pos": 394,
"end_pos": 394,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Thr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "12522270",
"url": "https://glygen.org/publication/PubMed/12522270"
},
{
"database": "PubMed",
"id": "18707149",
"url": "https://glygen.org/publication/PubMed/18707149"
},
{
"database": "phospho.ELM",
"id": "P00519",
"url": "http://phospho.elm.eu.org/byAccession/P00519.html"
}
],
"site_lbl": "Thr394"
},
{
"start_pos": 413,
"end_pos": 413,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Tyr",
"comment": "Phosphotyrosine",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "PubMed",
"id": "23186163",
"url": "https://glygen.org/publication/PubMed/23186163"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"site_lbl": "Tyr413"
},
{
"start_pos": 446,
"end_pos": 446,
"kinase_uniprot_canonical_ac": "Q13315-1",
"kinase_gene_name": "ATM",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "9168116",
"url": "https://glygen.org/publication/PubMed/9168116"
},
{
"database": "phospho.ELM",
"id": "P00519",
"url": "http://phospho.elm.eu.org/byAccession/P00519.html"
}
],
"site_lbl": "Ser446"
},
{
"start_pos": 446,
"end_pos": 446,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "Phosphoserine",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "8668151",
"url": "https://glygen.org/publication/PubMed/8668151"
},
{
"database": "PRO",
"id": "P00519",
"url": "http://purl.obolibrary.org/obo/P00519"
}
],
"site_lbl": "Ser446"
},
{
"start_pos": 469,
"end_pos": 469,
"kinase_uniprot_canonical_ac": "P00519-1",
"kinase_gene_name": "ABL1",
"residue": "Tyr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "12522270",
"url": "https://glygen.org/publication/PubMed/12522270"
}
],
"site_lbl": "Tyr469"
},
{
"start_pos": 50,
"end_pos": 50,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "Phosphoserine",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "PubMed",
"id": "16543148",
"url": "https://glygen.org/publication/PubMed/16543148"
},
{
"database": "PubMed",
"id": "18691976",
"url": "https://glygen.org/publication/PubMed/18691976"
},
{
"database": "PubMed",
"id": "19690332",
"url": "https://glygen.org/publication/PubMed/19690332"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"site_lbl": "Ser50"
},
{
"start_pos": 559,
"end_pos": 559,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "Phosphoserine",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "PubMed",
"id": "23186163",
"url": "https://glygen.org/publication/PubMed/23186163"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"site_lbl": "Ser559"
},
{
"start_pos": 569,
"end_pos": 569,
"kinase_uniprot_canonical_ac": "P06493-1",
"kinase_gene_name": "CDK1",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "18452278",
"url": "https://glygen.org/publication/PubMed/18452278"
},
{
"database": "PubMed",
"id": "18669648",
"url": "https://glygen.org/publication/PubMed/18669648"
},
{
"database": "PubMed",
"id": "18691976",
"url": "https://glygen.org/publication/PubMed/18691976"
},
{
"database": "PubMed",
"id": "19651622",
"url": "https://glygen.org/publication/PubMed/19651622"
},
{
"database": "PubMed",
"id": "2183353",
"url": "https://glygen.org/publication/PubMed/2183353"
}
],
"site_lbl": "Ser569"
},
{
"start_pos": 569,
"end_pos": 569,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "Phosphoserine",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "PubMed",
"id": "17081983",
"url": "https://glygen.org/publication/PubMed/17081983"
},
{
"database": "PubMed",
"id": "18669648",
"url": "https://glygen.org/publication/PubMed/18669648"
},
{
"database": "PubMed",
"id": "19369195",
"url": "https://glygen.org/publication/PubMed/19369195"
},
{
"database": "PubMed",
"id": "18691976",
"url": "https://glygen.org/publication/PubMed/18691976"
},
{
"database": "PubMed",
"id": "24275569",
"url": "https://glygen.org/publication/PubMed/24275569"
},
{
"database": "PubMed",
"id": "23186163",
"url": "https://glygen.org/publication/PubMed/23186163"
},
{
"database": "PubMed",
"id": "19690332",
"url": "https://glygen.org/publication/PubMed/19690332"
},
{
"database": "phospho.ELM",
"id": "P00519",
"url": "http://phospho.elm.eu.org/byAccession/P00519.html"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "17192257",
"url": "https://glygen.org/publication/PubMed/17192257"
},
{
"database": "PubMed",
"id": "18220336",
"url": "https://glygen.org/publication/PubMed/18220336"
}
],
"site_lbl": "Ser569"
},
{
"start_pos": 613,
"end_pos": 613,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Thr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "18691976",
"url": "https://glygen.org/publication/PubMed/18691976"
}
],
"site_lbl": "Thr613"
},
{
"start_pos": 618,
"end_pos": 618,
"kinase_uniprot_canonical_ac": "Q13177-1",
"kinase_gene_name": "PAK2",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "18161990",
"url": "https://glygen.org/publication/PubMed/18161990"
}
],
"site_lbl": "Ser618"
},
{
"start_pos": 618,
"end_pos": 618,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "Phosphoserine; by PAK2",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "18691976",
"url": "https://glygen.org/publication/PubMed/18691976"
},
{
"database": "PubMed",
"id": "18161990",
"url": "https://glygen.org/publication/PubMed/18161990"
}
],
"site_lbl": "Ser618"
},
{
"start_pos": 619,
"end_pos": 619,
"kinase_uniprot_canonical_ac": "Q13177-1",
"kinase_gene_name": "PAK2",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "18161990",
"url": "https://glygen.org/publication/PubMed/18161990"
}
],
"site_lbl": "Ser619"
},
{
"start_pos": 619,
"end_pos": 619,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "Phosphoserine; by PAK2",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "18161990",
"url": "https://glygen.org/publication/PubMed/18161990"
}
],
"site_lbl": "Ser619"
},
{
"start_pos": 620,
"end_pos": 620,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "Phosphoserine",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "PubMed",
"id": "23186163",
"url": "https://glygen.org/publication/PubMed/23186163"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "18691976",
"url": "https://glygen.org/publication/PubMed/18691976"
}
],
"site_lbl": "Ser620"
},
{
"start_pos": 659,
"end_pos": 659,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "Phosphoserine",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "PubMed",
"id": "18691976",
"url": "https://glygen.org/publication/PubMed/18691976"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"site_lbl": "Ser659"
},
{
"start_pos": 683,
"end_pos": 683,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "Phosphoserine",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "PubMed",
"id": "23186163",
"url": "https://glygen.org/publication/PubMed/23186163"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "17081983",
"url": "https://glygen.org/publication/PubMed/17081983"
},
{
"database": "PubMed",
"id": "18691976",
"url": "https://glygen.org/publication/PubMed/18691976"
}
],
"site_lbl": "Ser683"
},
{
"start_pos": 70,
"end_pos": 70,
"kinase_uniprot_canonical_ac": "P00519-1",
"kinase_gene_name": "ABL1",
"residue": "Tyr",
"comment": "",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "16912036",
"url": "https://glygen.org/publication/PubMed/16912036"
}
],
"site_lbl": "Tyr70"
},
{
"start_pos": 70,
"end_pos": 70,
"kinase_uniprot_canonical_ac": "P08631-1",
"kinase_gene_name": "HCK",
"residue": "Tyr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "18775435",
"url": "https://glygen.org/publication/PubMed/18775435"
}
],
"site_lbl": "Tyr70"
},
{
"start_pos": 70,
"end_pos": 70,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Tyr",
"comment": "Phosphotyrosine; by autocatalysis",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "18775435",
"url": "https://glygen.org/publication/PubMed/18775435"
}
],
"site_lbl": "Tyr70"
},
{
"start_pos": 710,
"end_pos": 710,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "18691976",
"url": "https://glygen.org/publication/PubMed/18691976"
}
],
"site_lbl": "Ser710"
},
{
"start_pos": 718,
"end_pos": 718,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "Phosphoserine",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "PubMed",
"id": "23186163",
"url": "https://glygen.org/publication/PubMed/23186163"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "18691976",
"url": "https://glygen.org/publication/PubMed/18691976"
}
],
"site_lbl": "Ser718"
},
{
"start_pos": 735,
"end_pos": 735,
"kinase_uniprot_canonical_ac": "P33981-1",
"kinase_gene_name": "TTK",
"residue": "Thr",
"comment": "",
"evidence": [
{
"database": "phospho.ELM",
"id": "P00519",
"url": "http://phospho.elm.eu.org/byAccession/P00519.html"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "18794806",
"url": "https://glygen.org/publication/PubMed/18794806"
}
],
"site_lbl": "Thr735"
},
{
"start_pos": 735,
"end_pos": 735,
"kinase_uniprot_canonical_ac": "P49759-1",
"kinase_gene_name": "CLK1",
"residue": "Thr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "18794806",
"url": "https://glygen.org/publication/PubMed/18794806"
}
],
"site_lbl": "Thr735"
},
{
"start_pos": 735,
"end_pos": 735,
"kinase_uniprot_canonical_ac": "Q13043-1",
"kinase_gene_name": "STK4",
"residue": "Thr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "18794806",
"url": "https://glygen.org/publication/PubMed/18794806"
}
],
"site_lbl": "Thr735"
},
{
"start_pos": 735,
"end_pos": 735,
"kinase_uniprot_canonical_ac": "Q13188-1",
"kinase_gene_name": "STK3",
"residue": "Thr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "18794806",
"url": "https://glygen.org/publication/PubMed/18794806"
}
],
"site_lbl": "Thr735"
},
{
"start_pos": 735,
"end_pos": 735,
"kinase_uniprot_canonical_ac": "Q9HAZ1-1",
"kinase_gene_name": "CLK4",
"residue": "Thr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "18794806",
"url": "https://glygen.org/publication/PubMed/18794806"
}
],
"site_lbl": "Thr735"
},
{
"start_pos": 735,
"end_pos": 735,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Thr",
"comment": "Phosphothreonine",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "PubMed",
"id": "15696159",
"url": "https://glygen.org/publication/PubMed/15696159"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PRO",
"id": "P00519",
"url": "http://purl.obolibrary.org/obo/P00519"
},
{
"database": "PubMed",
"id": "16888623",
"url": "https://glygen.org/publication/PubMed/16888623"
},
{
"database": "PubMed",
"id": "18794806",
"url": "https://glygen.org/publication/PubMed/18794806"
},
{
"database": "PubMed",
"id": "28661474",
"url": "https://glygen.org/publication/PubMed/28661474"
},
{
"database": "PubMed",
"id": "30704478",
"url": "https://glygen.org/publication/PubMed/30704478"
},
{
"database": "PubMed",
"id": "30948493",
"url": "https://glygen.org/publication/PubMed/30948493"
}
],
"site_lbl": "Thr735"
},
{
"start_pos": 751,
"end_pos": 751,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Thr",
"comment": "Phosphothreonine",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "PubMed",
"id": "23186163",
"url": "https://glygen.org/publication/PubMed/23186163"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"site_lbl": "Thr751"
},
{
"start_pos": 781,
"end_pos": 781,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Thr",
"comment": "Phosphothreonine",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "PubMed",
"id": "23186163",
"url": "https://glygen.org/publication/PubMed/23186163"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "18691976",
"url": "https://glygen.org/publication/PubMed/18691976"
}
],
"site_lbl": "Thr781"
},
{
"start_pos": 79,
"end_pos": 79,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Thr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "20068231",
"url": "https://glygen.org/publication/PubMed/20068231"
}
],
"site_lbl": "Thr79"
},
{
"start_pos": 804,
"end_pos": 804,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "18691976",
"url": "https://glygen.org/publication/PubMed/18691976"
},
{
"database": "PubMed",
"id": "19651622",
"url": "https://glygen.org/publication/PubMed/19651622"
}
],
"site_lbl": "Ser804"
},
{
"start_pos": 805,
"end_pos": 805,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "17081983",
"url": "https://glygen.org/publication/PubMed/17081983"
},
{
"database": "PubMed",
"id": "18691976",
"url": "https://glygen.org/publication/PubMed/18691976"
},
{
"database": "PubMed",
"id": "19413330",
"url": "https://glygen.org/publication/PubMed/19413330"
},
{
"database": "PubMed",
"id": "19651622",
"url": "https://glygen.org/publication/PubMed/19651622"
}
],
"site_lbl": "Ser805"
},
{
"start_pos": 808,
"end_pos": 808,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "18691976",
"url": "https://glygen.org/publication/PubMed/18691976"
},
{
"database": "PubMed",
"id": "19651622",
"url": "https://glygen.org/publication/PubMed/19651622"
}
],
"site_lbl": "Ser808"
},
{
"start_pos": 809,
"end_pos": 809,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "17081983",
"url": "https://glygen.org/publication/PubMed/17081983"
},
{
"database": "PubMed",
"id": "18691976",
"url": "https://glygen.org/publication/PubMed/18691976"
},
{
"database": "PubMed",
"id": "19413330",
"url": "https://glygen.org/publication/PubMed/19413330"
},
{
"database": "PubMed",
"id": "19651622",
"url": "https://glygen.org/publication/PubMed/19651622"
}
],
"site_lbl": "Ser809"
},
{
"start_pos": 814,
"end_pos": 814,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Thr",
"comment": "Phosphothreonine",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "PubMed",
"id": "18691976",
"url": "https://glygen.org/publication/PubMed/18691976"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"site_lbl": "Thr814"
},
{
"start_pos": 823,
"end_pos": 823,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Thr",
"comment": "Phosphothreonine",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "PubMed",
"id": "23186163",
"url": "https://glygen.org/publication/PubMed/23186163"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"site_lbl": "Thr823"
},
{
"start_pos": 844,
"end_pos": 844,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Thr",
"comment": "Phosphothreonine",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "PubMed",
"id": "18691976",
"url": "https://glygen.org/publication/PubMed/18691976"
},
{
"database": "PubMed",
"id": "23186163",
"url": "https://glygen.org/publication/PubMed/23186163"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "18669648",
"url": "https://glygen.org/publication/PubMed/18669648"
},
{
"database": "phospho.ELM",
"id": "P00519",
"url": "http://phospho.elm.eu.org/byAccession/P00519.html"
}
],
"site_lbl": "Thr844"
},
{
"start_pos": 852,
"end_pos": 852,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Thr",
"comment": "Phosphothreonine",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "PubMed",
"id": "18669648",
"url": "https://glygen.org/publication/PubMed/18669648"
},
{
"database": "PubMed",
"id": "23186163",
"url": "https://glygen.org/publication/PubMed/23186163"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "18691976",
"url": "https://glygen.org/publication/PubMed/18691976"
},
{
"database": "PubMed",
"id": "19413330",
"url": "https://glygen.org/publication/PubMed/19413330"
},
{
"database": "phospho.ELM",
"id": "P00519",
"url": "http://phospho.elm.eu.org/byAccession/P00519.html"
}
],
"site_lbl": "Thr852"
},
{
"start_pos": 854,
"end_pos": 854,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Thr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "18669648",
"url": "https://glygen.org/publication/PubMed/18669648"
},
{
"database": "phospho.ELM",
"id": "P00519",
"url": "http://phospho.elm.eu.org/byAccession/P00519.html"
}
],
"site_lbl": "Thr854"
},
{
"start_pos": 855,
"end_pos": 855,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "Phosphoserine",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "PubMed",
"id": "23186163",
"url": "https://glygen.org/publication/PubMed/23186163"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "19413330",
"url": "https://glygen.org/publication/PubMed/19413330"
}
],
"site_lbl": "Ser855"
},
{
"start_pos": 915,
"end_pos": 915,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "18452278",
"url": "https://glygen.org/publication/PubMed/18452278"
},
{
"database": "PubMed",
"id": "18691976",
"url": "https://glygen.org/publication/PubMed/18691976"
}
],
"site_lbl": "Ser915"
},
{
"start_pos": 917,
"end_pos": 917,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "Phosphoserine",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "PubMed",
"id": "18669648",
"url": "https://glygen.org/publication/PubMed/18669648"
},
{
"database": "PubMed",
"id": "23186163",
"url": "https://glygen.org/publication/PubMed/23186163"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "18452278",
"url": "https://glygen.org/publication/PubMed/18452278"
},
{
"database": "PubMed",
"id": "18691976",
"url": "https://glygen.org/publication/PubMed/18691976"
},
{
"database": "PubMed",
"id": "19651622",
"url": "https://glygen.org/publication/PubMed/19651622"
},
{
"database": "phospho.ELM",
"id": "P00519",
"url": "http://phospho.elm.eu.org/byAccession/P00519.html"
}
],
"site_lbl": "Ser917"
},
{
"start_pos": 919,
"end_pos": 919,
"kinase_uniprot_canonical_ac": "P00519-1",
"kinase_gene_name": "ABL1",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "17192257",
"url": "https://glygen.org/publication/PubMed/17192257"
},
{
"database": "PubMed",
"id": "18691976",
"url": "https://glygen.org/publication/PubMed/18691976"
}
],
"site_lbl": "Ser919"
},
{
"start_pos": 936,
"end_pos": 936,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "18691976",
"url": "https://glygen.org/publication/PubMed/18691976"
}
],
"site_lbl": "Ser936"
},
{
"start_pos": 949,
"end_pos": 949,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "17081983",
"url": "https://glygen.org/publication/PubMed/17081983"
},
{
"database": "phospho.ELM",
"id": "P00519",
"url": "http://phospho.elm.eu.org/byAccession/P00519.html"
}
],
"site_lbl": "Ser949"
},
{
"start_pos": 977,
"end_pos": 977,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "Phosphoserine",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "PubMed",
"id": "18691976",
"url": "https://glygen.org/publication/PubMed/18691976"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"site_lbl": "Ser977"
},
{
"start_pos": 989,
"end_pos": 989,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
},
{
"database": "PubMed",
"id": "18691976",
"url": "https://glygen.org/publication/PubMed/18691976"
}
],
"site_lbl": "Ser989"
}
],
"glycation": [],
"keywords": [
"enzyme",
"glycoprotein",
"glycoprotein_reported_with_glycan"
],
"publication": [
{
"title": "A novel SH2-containing phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase (SHIP2) is constitutively tyrosine phosphorylated and associated with src homologous and collagen gene (SHC) in chronic myelogenous leukemia progenitor cells.",
"journal": "Blood",
"date": "1999",
"authors": "Wisniewski D, Strife A, Swendeman S, Erdjument-Bromage H, Geromanos S, Kavanaugh WM, Tempst P, Clarkson B",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "10194451",
"url": "https://glygen.org/publication/PubMed/10194451"
}
]
},
{
"title": "Cumulative effect of phosphorylation of pRB on regulation of E2F activity.",
"journal": "Molecular and cellular biology",
"date": "1999",
"authors": "Brown VD, Phillips RA, Gallie BL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "10207050",
"url": "https://glygen.org/publication/PubMed/10207050"
}
]
},
{
"title": "Radiation-induced assembly of Rad51 and Rad52 recombination complex requires ATM and c-Abl.",
"journal": "The Journal of biological chemistry",
"date": "1999",
"authors": "Chen G, Yuan SS, Liu W, Xu Y, Trujillo K, Song B, Cong F, Goff SP, Wu Y, Arlinghaus R, Baltimore D, Gasser PJ, Park MS, Sung P, Lee EY",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5685938",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685938"
}
],
"reference": [
{
"type": "PubMed",
"id": "10212258",
"url": "https://glygen.org/publication/PubMed/10212258"
}
]
},
{
"title": "The interaction between N-WASP and the Arp2/3 complex links Cdc42-dependent signals to actin assembly.",
"journal": "Cell",
"date": "1999",
"authors": "Rohatgi R, Ma L, Miki H, Lopez M, Kirchhausen T, Takenawa T, Kirschner MW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "10219243",
"url": "https://glygen.org/publication/PubMed/10219243"
}
]
},
{
"title": "The DNA-binding domain of human c-Abl tyrosine kinase promotes the interaction of a HMG chromosomal protein with DNA.",
"journal": "Nucleic Acids Res.",
"date": "1999",
"authors": "David-Cordonnier M H, Payet D, D'Halluin J C, Waring M J, Travers A A, Bailly C",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "10325413",
"url": "https://glygen.org/publication/PubMed/10325413"
}
]
},
{
"title": "Targeting of p38 mitogen-activated protein kinases to MEF2 transcription factors.",
"journal": "Molecular and cellular biology",
"date": "1999",
"authors": "Yang SH, Galanis A, Sharrocks AD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-525793",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-525793"
}
],
"reference": [
{
"type": "PubMed",
"id": "10330143",
"url": "https://glygen.org/publication/PubMed/10330143"
}
]
},
{
"title": "CDK inhibitors: positive and negative regulators of G1-phase progression.",
"journal": "Genes & development",
"date": "1999",
"authors": "Sherr CJ, Roberts JM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "10385618",
"url": "https://glygen.org/publication/PubMed/10385618"
}
]
},
{
"title": "Interaction of c-Abl and p73alpha and their collaboration to induce apoptosis.",
"journal": "Nature",
"date": "1999-06-24",
"authors": "Agami R, Blandino G, Oren M, Shaul Y",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "10391250",
"url": "https://glygen.org/publication/PubMed/10391250"
}
]
},
{
"title": "Heteroduplex formation by human Rad51 protein: effects of DNA end-structure, hRP-A and hRad52.",
"journal": "Journal of molecular biology",
"date": "1999",
"authors": "Baumann P, West SC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5685938",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685938"
}
],
"reference": [
{
"type": "PubMed",
"id": "10438626",
"url": "https://glygen.org/publication/PubMed/10438626"
}
]
},
{
"title": "Localization of p21-activated kinase 1 (PAK1) to pseudopodia, membrane ruffles, and phagocytic cups in activated human neutrophils.",
"journal": "Journal of leukocyte biology",
"date": "1999",
"authors": "Dharmawardhane S, Brownson D, Lennartz M, Bokoch GM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "10496324",
"url": "https://glygen.org/publication/PubMed/10496324"
}
]
},
{
"title": "Cdk phosphorylation triggers sequential intramolecular interactions that progressively block Rb functions as cells move through G1.",
"journal": "Cell",
"date": "1999",
"authors": "Harbour JW, Luo RX, Dei Santi A, Postigo AA, Dean DC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "10499802",
"url": "https://glygen.org/publication/PubMed/10499802"
}
]
},
{
"title": "Requirement of ATM-dependent phosphorylation of brca1 in the DNA damage response to double-strand breaks.",
"journal": "Science (New York, N.Y.)",
"date": "1999",
"authors": "Cortez D, Wang Y, Qin J, Elledge SJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "10550055",
"url": "https://glygen.org/publication/PubMed/10550055"
}
]
},
{
"title": "Activation of LIM-kinase by Pak1 couples Rac/Cdc42 GTPase signalling to actin cytoskeletal dynamics.",
"journal": "Nature cell biology",
"date": "1999",
"authors": "Edwards DC, Sanders LC, Bokoch GM, Gill GN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "10559936",
"url": "https://glygen.org/publication/PubMed/10559936"
}
]
},
{
"title": "A novel regulatory mechanism of MAP kinases activation and nuclear translocation mediated by PKA and the PTP-SL tyrosine phosphatase.",
"journal": "The Journal of cell biology",
"date": "1999",
"authors": "Blanco-Aparicio C, Torres J, Pulido R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-525793",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-525793"
}
],
"reference": [
{
"type": "PubMed",
"id": "10601328",
"url": "https://glygen.org/publication/PubMed/10601328"
}
]
},
{
"title": "Autoinhibition and activation mechanisms of the Wiskott-Aldrich syndrome protein.",
"journal": "Nature",
"date": "2000",
"authors": "Kim AS, Kakalis LT, Abdul-Manan N, Liu GA, Rosen MK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "10724160",
"url": "https://glygen.org/publication/PubMed/10724160"
}
]
},
{
"title": "hCds1-mediated phosphorylation of BRCA1 regulates the DNA damage response.",
"journal": "Nature",
"date": "2000",
"authors": "Lee JS, Collins KM, Brown AL, Lee CH, Chung JH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "10724175",
"url": "https://glygen.org/publication/PubMed/10724175"
}
]
},
{
"title": "The human Rad52 protein exists as a heptameric ring.",
"journal": "Current biology : CB",
"date": "2000",
"authors": "Stasiak AZ, Larquet E, Stasiak A, Muller S, Engel A, Van Dyck E, West SC, Egelman EH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5685938",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685938"
}
],
"reference": [
{
"type": "PubMed",
"id": "10744977",
"url": "https://glygen.org/publication/PubMed/10744977"
}
]
},
{
"title": "ATM phosphorylates p95/nbs1 in an S-phase checkpoint pathway.",
"journal": "Nature",
"date": "2000",
"authors": "Lim DS, Kim ST, Xu B, Maser RS, Lin J, Petrini JH, Kastan MB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "10766245",
"url": "https://glygen.org/publication/PubMed/10766245"
}
]
},
{
"title": "GRB2 links signaling to actin assembly by enhancing interaction of neural Wiskott-Aldrich syndrome protein (N-WASp) with actin-related protein (ARP2/3) complex.",
"journal": "The Journal of biological chemistry",
"date": "2000",
"authors": "Carlier MF, Nioche P, Broutin-L'Hermite I, Boujemaa R, Le Clainche C, Egile C, Garbay C, Ducruix A, Sansonetti P, Pantaloni D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "10781580",
"url": "https://glygen.org/publication/PubMed/10781580"
}
]
},
{
"title": "ATM-dependent phosphorylation of nibrin in response to radiation exposure.",
"journal": "Nature genetics",
"date": "2000",
"authors": "Gatei M, Young D, Cerosaletti KM, Desai-Mehta A, Spring K, Kozlov S, Lavin MF, Gatti RA, Concannon P, Khanna K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "10802669",
"url": "https://glygen.org/publication/PubMed/10802669"
}
]
},
{
"title": "p38 and extracellular signal-regulated kinases regulate the myogenic program at multiple steps.",
"journal": "Molecular and cellular biology",
"date": "2000",
"authors": "Wu Z, Woodring PJ, Bhakta KS, Tamura K, Wen F, Feramisco JR, Karin M, Wang JY, Puri PL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-525793",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-525793"
}
],
"reference": [
{
"type": "PubMed",
"id": "10805738",
"url": "https://glygen.org/publication/PubMed/10805738"
}
]
},
{
"title": "Phosphorylation at serine 10, a major phosphorylation site of p27(Kip1), increases its protein stability.",
"journal": "The Journal of biological chemistry",
"date": "2000",
"authors": "Ishida N, Kitagawa M, Hatakeyama S, Nakayama K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "10831586",
"url": "https://glygen.org/publication/PubMed/10831586"
}
]
},
{
"title": "Role for ATM in DNA damage-induced phosphorylation of BRCA1.",
"journal": "Cancer research",
"date": "2000",
"authors": "Gatei M, Scott SP, Filippovitch I, Soronika N, Lavin MF, Weber B, Khanna KK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "10866324",
"url": "https://glygen.org/publication/PubMed/10866324"
}
]
},
{
"title": "A complex of N-WASP and WIP integrates signalling cascades that lead to actin polymerization.",
"journal": "Nature cell biology",
"date": "2000",
"authors": "Moreau V, Frischknecht F, Reckmann I, Vincentelli R, Rabut G, Stewart D, Way M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "10878810",
"url": "https://glygen.org/publication/PubMed/10878810"
}
]
},
{
"title": "Repulsive axon guidance: Abelson and Enabled play opposing roles downstream of the roundabout receptor.",
"journal": "Cell",
"date": "2000",
"authors": "Bashaw GJ, Kidd T, Murray D, Pawson T, Goodman CS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-428890",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-428890"
}
],
"reference": [
{
"type": "PubMed",
"id": "10892742",
"url": "https://glygen.org/publication/PubMed/10892742"
}
]
},
{
"title": "Precise binding of single-stranded DNA termini by human RAD52 protein.",
"journal": "The EMBO journal",
"date": "2000",
"authors": "Parsons CA, Baumann P, Van Dyck E, West SC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5685938",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685938"
}
],
"reference": [
{
"type": "PubMed",
"id": "10921897",
"url": "https://glygen.org/publication/PubMed/10921897"
}
]
},
{
"title": "A critical role for histone H2AX in recruitment of repair factors to nuclear foci after DNA damage.",
"journal": "Current biology : CB",
"date": "2000",
"authors": "Paull TT, Rogakou EP, Yamazaki V, Kirchgessner CU, Gellert M, Bonner WM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "10959836",
"url": "https://glygen.org/publication/PubMed/10959836"
}
]
},
{
"title": "c-Abl has high intrinsic tyrosine kinase activity that is stimulated by mutation of the Src homology 3 domain and by autophosphorylation at two distinct regulatory tyrosines.",
"journal": "The Journal of biological chemistry",
"date": "2000",
"authors": "Brasher BB, Van Etten RA",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "10964922",
"url": "https://glygen.org/publication/PubMed/10964922"
}
]
},
{
"title": "Ataxia telangiectasia-mutated phosphorylates Chk2 in vivo and in vitro.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2000",
"authors": "Matsuoka S, Rotman G, Ogawa A, Shiloh Y, Tamai K, Elledge SJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "10973490",
"url": "https://glygen.org/publication/PubMed/10973490"
}
]
},
{
"title": "Activation by Cdc42 and PIP(2) of Wiskott-Aldrich syndrome protein (WASp) stimulates actin nucleation by Arp2/3 complex.",
"journal": "The Journal of cell biology",
"date": "2000",
"authors": "Higgs HN, Pollard TD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "10995437",
"url": "https://glygen.org/publication/PubMed/10995437"
}
]
},
{
"title": "Threonine 68 is required for radiation-induced phosphorylation and activation of Cds1.",
"journal": "Nature cell biology",
"date": "2000",
"authors": "Melchionna R, Chen XB, Blasina A, McGowan CH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "11025670",
"url": "https://glygen.org/publication/PubMed/11025670"
}
]
},
{
"title": "Downregulation of cyclin D1 alters cdk 4- and cdk 2-specific phosphorylation of retinoblastoma protein.",
"journal": "Molecular cell biology research communications : MCBRC",
"date": "2000",
"authors": "Yu B, Lane ME, Pestell RG, Albanese C, Wadler S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "11032757",
"url": "https://glygen.org/publication/PubMed/11032757"
}
]
},
{
"title": "Multitasking in signal transduction by a promiscuous human Ins(3,4,5,6)P(4) 1-kinase/Ins(1,3,4)P(3) 5/6-kinase.",
"journal": "The Biochemical journal",
"date": "2000",
"authors": "Yang X, Shears SB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231"
}
],
"reference": [
{
"type": "PubMed",
"id": "11042108",
"url": "https://glygen.org/publication/PubMed/11042108"
}
]
},
{
"title": "Rabenosyn-5, a novel Rab5 effector, is complexed with hVPS45 and recruited to endosomes through a FYVE finger domain.",
"journal": "The Journal of cell biology",
"date": "2000",
"authors": "Nielsen E, Christoforidis S, Uttenweiler-Joseph S, Miaczynska M, Dewitte F, Wilm M, Hoflack B, Zerial M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231"
}
],
"reference": [
{
"type": "PubMed",
"id": "11062261",
"url": "https://glygen.org/publication/PubMed/11062261"
}
]
},
{
"title": "Analysis of cyclin D3-cdk4 complexes in fibroblasts expressing and lacking p27(kip1) and p21(cip1).",
"journal": "Molecular and cellular biology",
"date": "2000",
"authors": "Bagui TK, Jackson RJ, Agrawal D, Pledger WJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "11073976",
"url": "https://glygen.org/publication/PubMed/11073976"
}
]
},
{
"title": "Cbfa1 contributes to the osteoblast-specific expression of type I collagen genes.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Kern B, Shen J, Starbuck M, Karsenty G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8940973",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8940973"
}
],
"reference": [
{
"type": "PubMed",
"id": "11106645",
"url": "https://glygen.org/publication/PubMed/11106645"
}
]
},
{
"title": "Regulation of cell death by the Abl tyrosine kinase.",
"journal": "Oncogene",
"date": "2000",
"authors": "Wang J Y",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "11114745",
"url": "https://glygen.org/publication/PubMed/11114745"
}
]
},
{
"title": "Functional interactions between BRCA1 and the checkpoint kinase ATR during genotoxic stress.",
"journal": "Genes & development",
"date": "2000",
"authors": "Tibbetts RS, Cortez D, Brumbaugh KM, Scully R, Livingston D, Elledge SJ, Abraham RT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "11114888",
"url": "https://glygen.org/publication/PubMed/11114888"
}
]
},
{
"title": "Phosphorylation-dependent and -independent functions of p130 cooperate to evoke a sustained G1 block.",
"journal": "The EMBO journal",
"date": "2001",
"authors": "Hansen K, Farkas T, Lukas J, Holm K, Ronnstrand L, Bartek J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "11157749",
"url": "https://glygen.org/publication/PubMed/11157749"
}
]
},
{
"title": "A novel neural Wiskott-Aldrich syndrome protein (N-WASP) binding protein, WISH, induces Arp2/3 complex activation independent of Cdc42.",
"journal": "The Journal of cell biology",
"date": "2001",
"authors": "Fukuoka M, Suetsugu S, Miki H, Fukami K, Endo T, Takenawa T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "11157975",
"url": "https://glygen.org/publication/PubMed/11157975"
}
]
},
{
"title": "Cytoplasmic localization of p21Cip1/WAF1 by Akt-induced phosphorylation in HER-2/neu-overexpressing cells.",
"journal": "Nature cell biology",
"date": "2001",
"authors": "Zhou BP, Liao Y, Xia W, Spohn B, Lee MH, Hung MC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "11231573",
"url": "https://glygen.org/publication/PubMed/11231573"
}
]
},
{
"title": "The Arp2/3 complex nucleates actin filament branches from the sides of pre-existing filaments.",
"journal": "Nature cell biology",
"date": "2001",
"authors": "Amann KJ, Pollard TD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "11231582",
"url": "https://glygen.org/publication/PubMed/11231582"
}
]
},
{
"title": "Methylation of histone H3 lysine 9 creates a binding site for HP1 proteins.",
"journal": "Nature",
"date": "2001",
"authors": "Lachner M, O'Carroll D, Rea S, Mechtler K, Jenuwein T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231"
}
],
"reference": [
{
"type": "PubMed",
"id": "11242053",
"url": "https://glygen.org/publication/PubMed/11242053"
}
]
},
{
"title": "Phosphorylation of cofilin by LIM-kinase is necessary for semaphorin 3A-induced growth cone collapse.",
"journal": "Nature neuroscience",
"date": "2001",
"authors": "Aizawa H, Wakatsuki S, Ishii A, Moriyama K, Sasaki Y, Ohashi K, Sekine-Aizawa Y, Sehara-Fujisawa A, Mizuno K, Goshima Y, Yahara I",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "11276226",
"url": "https://glygen.org/publication/PubMed/11276226"
}
]
},
{
"title": "The mechanism of PAK activation. Autophosphorylation events in both regulatory and kinase domains control activity.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Chong C, Tan L, Lim L, Manser E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "11278486",
"url": "https://glygen.org/publication/PubMed/11278486"
}
]
},
{
"title": "WASP and WAVE family proteins: key molecules for rapid rearrangement of cortical actin filaments and cell movement.",
"journal": "Journal of cell science",
"date": "2001",
"authors": "Takenawa T, Miki H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "11329366",
"url": "https://glygen.org/publication/PubMed/11329366"
}
]
},
{
"title": "Nck and phosphatidylinositol 4,5-bisphosphate synergistically activate actin polymerization through the N-WASP-Arp2/3 pathway.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Rohatgi R, Nollau P, Ho HY, Kirschner MW, Mayer BJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "11340081",
"url": "https://glygen.org/publication/PubMed/11340081"
}
]
},
{
"title": "Cloning, mapping, and characterization of the human sorbin and SH3 domain containing 1 (SORBS1) gene: a protein associated with c-Abl during insulin signaling in the hepatoma cell line Hep3B.",
"journal": "Genomics",
"date": "2001",
"authors": "Lin W H, Huang C J, Liu M W, Chang H M, Chen Y J, Tai T Y, Chuang L M",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "11374898",
"url": "https://glygen.org/publication/PubMed/11374898"
}
]
},
{
"title": "The hCds1 (Chk2)-FHA domain is essential for a chain of phosphorylation events on hCds1 that is induced by ionizing radiation.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Lee CH, Chung JH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "11390408",
"url": "https://glygen.org/publication/PubMed/11390408"
}
]
},
{
"title": "Differential regulation of retinoblastoma tumor suppressor protein by G(1) cyclin-dependent kinase complexes in vivo.",
"journal": "Molecular and cellular biology",
"date": "2001",
"authors": "Ezhevsky SA, Ho A, Becker-Hapak M, Davis PK, Dowdy SF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "11416152",
"url": "https://glygen.org/publication/PubMed/11416152"
}
]
},
{
"title": "The retinoblastoma protein acts as a transcriptional coactivator required for osteogenic differentiation.",
"journal": "Molecular cell",
"date": "2001",
"authors": "Thomas DM, Carty SA, Piscopo DM, Lee JS, Wang WF, Forrester WC, Hinds PW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8940973",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8940973"
}
],
"reference": [
{
"type": "PubMed",
"id": "11545733",
"url": "https://glygen.org/publication/PubMed/11545733"
}
]
},
{
"title": "CR16 forms a complex with N-WASP in brain and is a novel member of a conserved proline-rich actin-binding protein family.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2001",
"authors": "Ho HY, Rohatgi R, Ma L, Kirschner MW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "11553796",
"url": "https://glygen.org/publication/PubMed/11553796"
}
]
},
{
"title": "Visualization of recombination intermediates produced by RAD52-mediated single-strand annealing.",
"journal": "EMBO reports",
"date": "2001",
"authors": "Van Dyck E, Stasiak AZ, Stasiak A, West SC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5685938",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685938"
}
],
"reference": [
{
"type": "PubMed",
"id": "11571269",
"url": "https://glygen.org/publication/PubMed/11571269"
}
]
},
{
"title": "ATM phosphorylates histone H2AX in response to DNA double-strand breaks.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Burma S, Chen BP, Murphy M, Kurimasa A, Chen DJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "11571274",
"url": "https://glygen.org/publication/PubMed/11571274"
}
]
},
{
"title": "Structure of a BRCA1-BARD1 heterodimeric RING-RING complex.",
"journal": "Nature structural biology",
"date": "2001",
"authors": "Brzovic PS, Rajagopal P, Hoyt DW, King MC, Klevit RE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "11573085",
"url": "https://glygen.org/publication/PubMed/11573085"
}
]
},
{
"title": "The E2F1-3 transcription factors are essential for cellular proliferation.",
"journal": "Nature",
"date": "2001",
"authors": "Wu L, Timmers C, Maiti B, Saavedra HI, Sang L, Chong GT, Nuckolls F, Giangrande P, Wright FA, Field SJ, Greenberg ME, Orkin S, Nevins JR, Robinson ML, Leone G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "11719808",
"url": "https://glygen.org/publication/PubMed/11719808"
}
]
},
{
"title": "RAD51C interacts with RAD51B and is central to a larger protein complex in vivo exclusive of RAD51.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Miller KA, Yoshikawa DM, McConnell IR, Clark R, Schild D, Albala JS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231"
}
],
"reference": [
{
"type": "PubMed",
"id": "11744692",
"url": "https://glygen.org/publication/PubMed/11744692"
}
]
},
{
"title": "Different WASP family proteins stimulate different Arp2/3 complex-dependent actin-nucleating activities.",
"journal": "Current biology : CB",
"date": "2001",
"authors": "Zalevsky J, Lempert L, Kranitz H, Mullins RD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "11747816",
"url": "https://glygen.org/publication/PubMed/11747816"
}
]
},
{
"title": "Mediator function of the human Rad51B-Rad51C complex in Rad51/RPA-catalyzed DNA strand exchange.",
"journal": "Genes & development",
"date": "2001",
"authors": "Sigurdsson S, Van Komen S, Bussen W, Schild D, Albala JS, Sung P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231"
}
],
"reference": [
{
"type": "PubMed",
"id": "11751636",
"url": "https://glygen.org/publication/PubMed/11751636"
}
]
},
{
"title": "Phosphorylation and structure-based functional studies reveal a positive and a negative role for the activation loop of the c-Abl tyrosine kinase.",
"journal": "Oncogene",
"date": "2001",
"authors": "Dorey K, Engen JR, Kretzschmar J, Wilm M, Neubauer G, Schindler T, Superti-Furga G",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519-1",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519-1"
}
],
"reference": [
{
"type": "PubMed",
"id": "11781820",
"url": "https://glygen.org/publication/PubMed/11781820"
}
]
},
{
"title": "BOC, an Ig superfamily member, associates with CDO to positively regulate myogenic differentiation.",
"journal": "The EMBO journal",
"date": "2002",
"authors": "Kang JS, Mulieri PJ, Hu Y, Taliana L, Krauss RS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-525793",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-525793"
}
],
"reference": [
{
"type": "PubMed",
"id": "11782431",
"url": "https://glygen.org/publication/PubMed/11782431"
}
]
},
{
"title": "Pak1 kinase homodimers are autoinhibited in trans and dissociated upon activation by Cdc42 and Rac1.",
"journal": "Molecular cell",
"date": "2002",
"authors": "Parrini MC, Lei M, Harrison SC, Mayer BJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "11804587",
"url": "https://glygen.org/publication/PubMed/11804587"
}
]
},
{
"title": "WICH, a novel verprolin homology domain-containing protein that functions cooperatively with N-WASP in actin-microspike formation.",
"journal": "Biochemical and biophysical research communications",
"date": "2002",
"authors": "Kato M, Miki H, Kurita S, Endo T, Nakagawa H, Miyamoto S, Takenawa T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "11829459",
"url": "https://glygen.org/publication/PubMed/11829459"
}
]
},
{
"title": "c-Abl is an effector of Src for growth factor-induced c-myc expression and DNA synthesis.",
"journal": "The EMBO journal",
"date": "2002",
"authors": "Furstoss O, Dorey K, Simon V, Barila D, Superti-Furga G, Roche S",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "11847100",
"url": "https://glygen.org/publication/PubMed/11847100"
}
]
},
{
"title": "Nuclear import and export signals in control of the p53-related protein p73.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Inoue T, Stuart J, Leno R, Maki CG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8939236",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236"
}
],
"reference": [
{
"type": "PubMed",
"id": "11847229",
"url": "https://glygen.org/publication/PubMed/11847229"
}
]
},
{
"title": "Dynamics of cytoskeletal proteins during Fcgamma receptor-mediated phagocytosis in macrophages.",
"journal": "Molecular biology of the cell",
"date": "2002",
"authors": "Diakonova M, Bokoch G, Swanson JA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "11854399",
"url": "https://glygen.org/publication/PubMed/11854399"
}
]
},
{
"title": "Reversal of growth suppression by p107 via direct phosphorylation by cyclin D1/cyclin-dependent kinase 4.",
"journal": "Molecular and cellular biology",
"date": "2002",
"authors": "Leng X, Noble M, Adams PD, Qin J, Harper JW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "11884610",
"url": "https://glygen.org/publication/PubMed/11884610"
}
]
},
{
"title": "Histone H2A variants H2AX and H2AZ.",
"journal": "Current opinion in genetics & development",
"date": "2002",
"authors": "Redon C, Pilch D, Rogakou E, Sedelnikova O, Newrock K, Bonner W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "11893489",
"url": "https://glygen.org/publication/PubMed/11893489"
}
]
},
{
"title": "The human beta-globin locus control region.",
"journal": "European journal of biochemistry",
"date": "2002",
"authors": "Levings PP, Bungert J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231"
}
],
"reference": [
{
"type": "PubMed",
"id": "11895428",
"url": "https://glygen.org/publication/PubMed/11895428"
}
]
},
{
"title": "Autoubiquitination of the BRCA1*BARD1 RING ubiquitin ligase.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Chen A, Kleiman FE, Manley JL, Ouchi T, Pan ZQ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "11927591",
"url": "https://glygen.org/publication/PubMed/11927591"
}
]
},
{
"title": "Genomic instability in mice lacking histone H2AX.",
"journal": "Science (New York, N.Y.)",
"date": "2002",
"authors": "Celeste A, Petersen S, Romanienko PJ, Fernandez-Capetillo O, Chen HT, Sedelnikova OA, Reina-San-Martin B, Coppola V, Meffre E, Difilippantonio MJ, Redon C, Pilch DR, Olaru A, Eckhaus M, Camerini-Otero RD, Tessarollo L, Livak F, Manova K, Bonner WM, Nussenzweig MC, Nussenzweig A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "11934988",
"url": "https://glygen.org/publication/PubMed/11934988"
}
]
},
{
"title": "Membrane topology and mitochondrial targeting of mitofusins, ubiquitous mammalian homologs of the transmembrane GTPase Fzo.",
"journal": "Journal of cell science",
"date": "2002",
"authors": "Rojo M, Legros F, Chateau D, Lombes A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231"
}
],
"reference": [
{
"type": "PubMed",
"id": "11950885",
"url": "https://glygen.org/publication/PubMed/11950885"
}
]
},
{
"title": "c-Abl tyrosine kinase regulates the human Rad9 checkpoint protein in response to DNA damage.",
"journal": "Molecular and cellular biology",
"date": "2002",
"authors": "Yoshida K, Komatsu K, Wang HG, Kufe D",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "11971963",
"url": "https://glygen.org/publication/PubMed/11971963"
}
]
},
{
"title": "A core-BRAF35 complex containing histone deacetylase mediates repression of neuronal-specific genes.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2002",
"authors": "Hakimi MA, Bochar DA, Chenoweth J, Lane WS, Mandel G, Shiekhattar R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231"
}
],
"reference": [
{
"type": "PubMed",
"id": "12032298",
"url": "https://glygen.org/publication/PubMed/12032298"
}
]
},
{
"title": "Myosin X is a downstream effector of PI(3)K during phagocytosis.",
"journal": "Nature cell biology",
"date": "2002",
"authors": "Cox D, Berg JS, Cammer M, Chinegwundoh JO, Dale BM, Cheney RE, Greenberg S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "12055636",
"url": "https://glygen.org/publication/PubMed/12055636"
}
]
},
{
"title": "May the force be with you: Myosin-X in phagocytosis.",
"journal": "Nature cell biology",
"date": "2002",
"authors": "Chavrier P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "12105426",
"url": "https://glygen.org/publication/PubMed/12105426"
}
]
},
{
"title": "Unconventional Rac-GEF activity is mediated through the Dock180-ELMO complex.",
"journal": "Nature cell biology",
"date": "2002",
"authors": "Brugnera E, Haney L, Grimsley C, Lu M, Walk SF, Tosello-Trampont AC, Macara IG, Madhani H, Fink GR, Ravichandran KS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231"
}
],
"reference": [
{
"type": "PubMed",
"id": "12134158",
"url": "https://glygen.org/publication/PubMed/12134158"
}
]
},
{
"title": "Analysis of the human replication protein A:Rad52 complex: evidence for crosstalk between RPA32, RPA70, Rad52 and DNA.",
"journal": "Journal of molecular biology",
"date": "2002",
"authors": "Jackson D, Dhar K, Wahl JK, Wold MS, Borgstahl GE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5685938",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685938"
}
],
"reference": [
{
"type": "PubMed",
"id": "12139939",
"url": "https://glygen.org/publication/PubMed/12139939"
}
]
},
{
"title": "Clinical resistance to the kinase inhibitor STI-571 in chronic myeloid leukemia by mutation of Tyr-253 in the Abl kinase domain P-loop.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2002",
"authors": "Roumiantsev S, Shah NP, Gorre ME, Nicoll J, Brasher BB, Sawyers CL, Van Etten RA",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "12149456",
"url": "https://glygen.org/publication/PubMed/12149456"
}
]
},
{
"title": "Rapid association of cytoskeletal remodeling proteins with the developing phagosomes of human neutrophils.",
"journal": "Histochemistry and cell biology",
"date": "2002",
"authors": "Robinson JM, Badwey JA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "12189515",
"url": "https://glygen.org/publication/PubMed/12189515"
}
]
},
{
"title": "Crystal structure of the homologous-pairing domain from the human Rad52 recombinase in the undecameric form.",
"journal": "Molecular cell",
"date": "2002",
"authors": "Kagawa W, Kurumizaka H, Ishitani R, Fukai S, Nureki O, Shibata T, Yokoyama S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5685938",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685938"
}
],
"reference": [
{
"type": "PubMed",
"id": "12191481",
"url": "https://glygen.org/publication/PubMed/12191481"
}
]
},
{
"title": "The WASP-binding protein WIRE has a role in the regulation of the actin filament system downstream of the platelet-derived growth factor receptor.",
"journal": "Experimental cell research",
"date": "2002",
"authors": "Aspenstrom P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "12213210",
"url": "https://glygen.org/publication/PubMed/12213210"
}
]
},
{
"title": "Correlation of biochemical properties with the oligomeric state of human rad52 protein.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Lloyd JA, Forget AL, Knight KL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5685938",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685938"
}
],
"reference": [
{
"type": "PubMed",
"id": "12226092",
"url": "https://glygen.org/publication/PubMed/12226092"
}
]
},
{
"title": "Serine phosphorylation of RUNX2 with novel potential functions as negative regulatory mechanisms.",
"journal": "EMBO reports",
"date": "2002",
"authors": "Wee HJ, Huang G, Shigesada K, Ito Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8940973",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8940973"
}
],
"reference": [
{
"type": "PubMed",
"id": "12231506",
"url": "https://glygen.org/publication/PubMed/12231506"
}
]
},
{
"title": "Phosphorylation of tyrosine 291 enhances the ability of WASp to stimulate actin polymerization and filopodium formation. Wiskott-Aldrich Syndrome protein.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Cory GO, Garg R, Cramer R, Ridley AJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "12235133",
"url": "https://glygen.org/publication/PubMed/12235133"
}
]
},
{
"title": "53BP1, a mediator of the DNA damage checkpoint.",
"journal": "Science (New York, N.Y.)",
"date": "2002",
"authors": "Wang B, Matsuoka S, Carpenter PB, Elledge SJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "12364621",
"url": "https://glygen.org/publication/PubMed/12364621"
}
]
},
{
"title": "Structure of the single-strand annealing domain of human RAD52 protein.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2002",
"authors": "Singleton MR, Wentzell LM, Liu Y, West SC, Wigley DB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5685938",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685938"
}
],
"reference": [
{
"type": "PubMed",
"id": "12370410",
"url": "https://glygen.org/publication/PubMed/12370410"
}
]
},
{
"title": "Regulation of ionizing radiation-induced Rad52 nuclear foci formation by c-Abl-mediated phosphorylation.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Kitao H, Yuan ZM",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "Reactome",
"id": "R-HSA-5685938",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685938"
}
],
"reference": [
{
"type": "PubMed",
"id": "12379650",
"url": "https://glygen.org/publication/PubMed/12379650"
}
]
},
{
"title": "Structure of a regulatory complex involving the Abl SH3 domain, the Crk SH2 domain, and a Crk-derived phosphopeptide.",
"journal": "Proc. Natl. Acad. Sci. U.S.A.",
"date": "2002",
"authors": "Donaldson LW, Gish G, Pawson T, Kay LE, Forman-Kay JD",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "12384576",
"url": "https://glygen.org/publication/PubMed/12384576"
}
]
},
{
"title": "Runx2 (Cbfa1, AML-3) interacts with histone deacetylase 6 and represses the p21(CIP1/WAF1) promoter.",
"journal": "Molecular and cellular biology",
"date": "2002",
"authors": "Westendorf JJ, Zaidi SK, Cascino JE, Kahler R, van Wijnen AJ, Lian JB, Yoshida M, Stein GS, Li X",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8940973",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8940973"
}
],
"reference": [
{
"type": "PubMed",
"id": "12391164",
"url": "https://glygen.org/publication/PubMed/12391164"
}
]
},
{
"title": "Complex formation by the human Rad51B and Rad51C DNA repair proteins and their activities in vitro.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Lio YC, Mazin AV, Kowalczykowski SC, Chen DJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231"
}
],
"reference": [
{
"type": "PubMed",
"id": "12427746",
"url": "https://glygen.org/publication/PubMed/12427746"
}
]
},
{
"title": "The pRb-related protein p130 is regulated by phosphorylation-dependent proteolysis via the protein-ubiquitin ligase SCF(Skp2).",
"journal": "Genes & development",
"date": "2002",
"authors": "Tedesco D, Lukas J, Reed SI",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "12435635",
"url": "https://glygen.org/publication/PubMed/12435635"
}
]
},
{
"title": "Activation of cyclin D1-kinase in murine fibroblasts lacking both p21(Cip1) and p27(Kip1).",
"journal": "Oncogene",
"date": "2002",
"authors": "Sugimoto M, Martin N, Wilks DP, Tamai K, Huot TJ, Pantoja C, Okumura K, Serrano M, Hara E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "12444543",
"url": "https://glygen.org/publication/PubMed/12444543"
}
]
},
{
"title": "DNA damage-induced G2-M checkpoint activation by histone H2AX and 53BP1.",
"journal": "Nature cell biology",
"date": "2002",
"authors": "Fernandez-Capetillo O, Chen HT, Celeste A, Ward I, Romanienko PJ, Morales JC, Naka K, Xia Z, Camerini-Otero RD, Motoyama N, Carpenter PB, Bonner WM, Chen J, Nussenzweig A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "12447390",
"url": "https://glygen.org/publication/PubMed/12447390"
}
]
},
{
"title": "Cbl-ArgBP2 complex mediates ubiquitination and degradation of c-Abl.",
"journal": "The Biochemical journal",
"date": "2003",
"authors": "Soubeyran P, Barac A, Szymkiewicz I, Dikic I",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "12475393",
"url": "https://glygen.org/publication/PubMed/12475393"
}
]
},
{
"title": "Activation of the E3 ligase function of the BRCA1/BARD1 complex by polyubiquitin chains.",
"journal": "The EMBO journal",
"date": "2002",
"authors": "Mallery DL, Vandenberg CJ, Hiom K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "12485996",
"url": "https://glygen.org/publication/PubMed/12485996"
}
]
},
{
"title": "Profiling of tyrosine phosphorylation pathways in human cells using mass spectrometry.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2003",
"authors": "Salomon AR, Ficarro SB, Brill LM, Brinker A, Phung QT, Ericson C, Sauer K, Brock A, Horn DM, Schultz PG, Peters EC",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519-1",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519-1"
}
],
"reference": [
{
"type": "PubMed",
"id": "12522270",
"url": "https://glygen.org/publication/PubMed/12522270"
}
]
},
{
"title": "Transcriptional coactivation of bone-specific transcription factor Cbfa1 by TAZ.",
"journal": "Molecular and cellular biology",
"date": "2003",
"authors": "Cui CB, Cooper LF, Yang X, Karsenty G, Aukhil I",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8940973",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8940973"
}
],
"reference": [
{
"type": "PubMed",
"id": "12529404",
"url": "https://glygen.org/publication/PubMed/12529404"
}
]
},
{
"title": "c-Abl is required for oxidative stress-induced phosphorylation of caveolin-1 on tyrosine 14.",
"journal": "Cellular signalling",
"date": "2003",
"authors": "Sanguinetti AR, Mastick CC",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "12531427",
"url": "https://glygen.org/publication/PubMed/12531427"
}
]
},
{
"title": "MDC1 is required for the intra-S-phase DNA damage checkpoint.",
"journal": "Nature",
"date": "2003",
"authors": "Goldberg M, Stucki M, Falck J, D'Amours D, Rahman D, Pappin D, Bartek J, Jackson SP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "12607003",
"url": "https://glygen.org/publication/PubMed/12607003"
}
]
},
{
"title": "MDC1 is a mediator of the mammalian DNA damage checkpoint.",
"journal": "Nature",
"date": "2003",
"authors": "Stewart GS, Wang B, Bignell CR, Taylor AM, Elledge SJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "12607005",
"url": "https://glygen.org/publication/PubMed/12607005"
}
]
},
{
"title": "Promyogenic members of the Ig and cadherin families associate to positively regulate differentiation.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2003",
"authors": "Kang JS, Feinleib JL, Knox S, Ketteringham MA, Krauss RS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-525793",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-525793"
}
],
"reference": [
{
"type": "PubMed",
"id": "12634428",
"url": "https://glygen.org/publication/PubMed/12634428"
}
]
},
{
"title": "Structural basis for the autoinhibition of c-Abl tyrosine kinase.",
"journal": "Cell",
"date": "2003",
"authors": "Nagar B, Hantschel O, Young MA, Scheffzek K, Veach D, Bornmann W, Clarkson B, Superti-Furga G, Kuriyan J",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "12654251",
"url": "https://glygen.org/publication/PubMed/12654251"
}
]
},
{
"title": "Presence of the BCR-ABL mutation Glu255Lys prior to STI571 (imatinib) treatment in patients with Ph+ acute lymphoblastic leukemia.",
"journal": "Blood",
"date": "2003",
"authors": "Hofmann WK, Komor M, Wassmann B, Jones LC, Gschaidmeier H, Hoelzer D, Koeffler HP, Ottmann OG",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "12663457",
"url": "https://glygen.org/publication/PubMed/12663457"
}
]
},
{
"title": "Abl interactor 1 promotes tyrosine 296 phosphorylation of mammalian enabled (Mena) by c-Abl kinase.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Tani K, Sato S, Sukezane T, Kojima H, Hirose H, Hanafusa H, Shishido T",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "12672821",
"url": "https://glygen.org/publication/PubMed/12672821"
}
]
},
{
"title": "Accumulation of checkpoint protein 53BP1 at DNA breaks involves its binding to phosphorylated histone H2AX.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Ward IM, Minn K, Jorda KG, Chen J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "12697768",
"url": "https://glygen.org/publication/PubMed/12697768"
}
]
},
{
"title": "ATP hydrolysis on actin-related protein 2/3 complex causes debranching of dendritic actin arrays.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2003",
"authors": "Le Clainche C, Pantaloni D, Carlier MF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "12743368",
"url": "https://glygen.org/publication/PubMed/12743368"
}
]
},
{
"title": "Two distinct phosphorylation pathways have additive effects on Abl family kinase activation.",
"journal": "Molecular and cellular biology",
"date": "2003",
"authors": "Tanis KQ, Veach D, Duewel HS, Bornmann WG, Koleske AJ",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "12748290",
"url": "https://glygen.org/publication/PubMed/12748290"
}
]
},
{
"title": "WRN interacts physically and functionally with the recombination mediator protein RAD52.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Baynton K, Otterlei M, Bjoras M, von Kobbe C, Bohr VA, Seeberg E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5685938",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685938"
}
],
"reference": [
{
"type": "PubMed",
"id": "12750383",
"url": "https://glygen.org/publication/PubMed/12750383"
}
]
},
{
"title": "A subset of ATM- and ATR-dependent phosphorylation events requires the BRCA1 protein.",
"journal": "The EMBO journal",
"date": "2003",
"authors": "Foray N, Marot D, Gabriel A, Randrianarison V, Carr AM, Perricaudet M, Ashworth A, Jeggo P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "12773400",
"url": "https://glygen.org/publication/PubMed/12773400"
}
]
},
{
"title": "Regulation of F-actin-dependent processes by the Abl family of tyrosine kinases.",
"journal": "J. Cell Sci.",
"date": "2003",
"authors": "Woodring Pamela J, Hunter Tony, Wang Jean Y J",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "12775773",
"url": "https://glygen.org/publication/PubMed/12775773"
}
]
},
{
"title": "Histone H2AX phosphorylation is dispensable for the initial recognition of DNA breaks.",
"journal": "Nature cell biology",
"date": "2003",
"authors": "Celeste A, Fernandez-Capetillo O, Kruhlak MJ, Pilch DR, Staudt DW, Lee A, Bonner RF, Bonner WM, Nussenzweig A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "12792649",
"url": "https://glygen.org/publication/PubMed/12792649"
}
]
},
{
"title": "Secondary structure of Src homology 2 domain of c-Abl by heteronuclear NMR spectroscopy in solution.",
"journal": "Proc. Natl. Acad. Sci. U.S.A.",
"date": "1992",
"authors": "Overduin M, Mayer B, Rios CB, Baltimore D, Cowburn D",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "1281542",
"url": "https://glygen.org/publication/PubMed/1281542"
}
]
},
{
"title": "Loss of Bard1, the heterodimeric partner of the Brca1 tumor suppressor, results in early embryonic lethality and chromosomal instability.",
"journal": "Molecular and cellular biology",
"date": "2003",
"authors": "McCarthy EE, Celebi JT, Baer R, Ludwig T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "12832489",
"url": "https://glygen.org/publication/PubMed/12832489"
}
]
},
{
"title": "The BRCA1/BARD1 heterodimer assembles polyubiquitin chains through an unconventional linkage involving lysine residue K6 of ubiquitin.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Wu-Baer F, Lagrazon K, Yuan W, Baer R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "12890688",
"url": "https://glygen.org/publication/PubMed/12890688"
}
]
},
{
"title": "Signal transduction by Fc gamma RIII (CD16) is mediated through the gamma chain.",
"journal": "The Journal of experimental medicine",
"date": "1992",
"authors": "Wirthmueller U, Kurosaki T, Murakami MS, Ravetch JV",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9664422",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664422"
}
],
"reference": [
{
"type": "PubMed",
"id": "1314888",
"url": "https://glygen.org/publication/PubMed/1314888"
}
]
},
{
"title": "Identification and properties of an atypical catalytic subunit (p34PSK-J3/cdk4) for mammalian D type G1 cyclins.",
"journal": "Cell",
"date": "1992",
"authors": "Matsushime H, Ewen ME, Strom DK, Kato JY, Hanks SK, Roussel MF, Sherr CJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "1423597",
"url": "https://glygen.org/publication/PubMed/1423597"
}
]
},
{
"title": "P27Kip1 and p21Cip1 are not required for the formation of active D cyclin-cdk4 complexes.",
"journal": "Molecular and cellular biology",
"date": "2003",
"authors": "Bagui TK, Mohapatra S, Haura E, Pledger WJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "14517297",
"url": "https://glygen.org/publication/PubMed/14517297"
}
]
},
{
"title": "BARD1 participates with BRCA1 in homology-directed repair of chromosome breaks.",
"journal": "Molecular and cellular biology",
"date": "2003",
"authors": "Westermark UK, Reyngold M, Olshen AB, Baer R, Jasin M, Moynahan ME",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "14560035",
"url": "https://glygen.org/publication/PubMed/14560035"
}
]
},
{
"title": "The cyclin D3-CDK4-p27kip1 holoenzyme in thyroid epithelial cells: activation by TSH, inhibition by TGFbeta, and phosphorylations of its subunits demonstrated by two-dimensional gel electrophoresis.",
"journal": "Experimental cell research",
"date": "2003",
"authors": "Coulonval K, Bockstaele L, Paternot S, Dumont JE, Roger PP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "14597415",
"url": "https://glygen.org/publication/PubMed/14597415"
}
]
},
{
"title": "Focal adhesion kinase regulation of N-WASP subcellular localization and function.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Wu X, Suetsugu S, Cooper LA, Takenawa T, Guan JL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "14676198",
"url": "https://glygen.org/publication/PubMed/14676198"
}
]
},
{
"title": "Physical and functional interaction between the XPF/ERCC1 endonuclease and hRad52.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Motycka TA, Bessho T, Post SM, Sung P, Tomkinson AE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5685938",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685938"
}
],
"reference": [
{
"type": "PubMed",
"id": "14734547",
"url": "https://glygen.org/publication/PubMed/14734547"
}
]
},
{
"title": "Tyrosine phosphorylation controls Runx2-mediated subnuclear targeting of YAP to repress transcription.",
"journal": "The EMBO journal",
"date": "2004",
"authors": "Zaidi SK, Sullivan AJ, Medina R, Ito Y, van Wijnen AJ, Stein JL, Lian JB, Stein GS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8940973",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8940973"
}
],
"reference": [
{
"type": "PubMed",
"id": "14765127",
"url": "https://glygen.org/publication/PubMed/14765127"
}
]
},
{
"title": "Rabenosyn-5 and EHD1 interact and sequentially regulate protein recycling to the plasma membrane.",
"journal": "Molecular biology of the cell",
"date": "2004",
"authors": "Naslavsky N, Boehm M, Backlund PS Jr, Caplan S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231"
}
],
"reference": [
{
"type": "PubMed",
"id": "15020713",
"url": "https://glygen.org/publication/PubMed/15020713"
}
]
},
{
"title": "The c-Abl tyrosine kinase phosphorylates the Fe65 adaptor protein to stimulate Fe65/amyloid precursor protein nuclear signaling.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Perkinton MS, Standen CL, Lau KF, Kesavapany S, Byers HL, Ward M, McLoughlin DM, Miller CC",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "15031292",
"url": "https://glygen.org/publication/PubMed/15031292"
}
]
},
{
"title": "Signalling to actin assembly via the WASP (Wiskott-Aldrich syndrome protein)-family proteins and the Arp2/3 complex.",
"journal": "The Biochemical journal",
"date": "2004",
"authors": "Millard TH, Sharp SJ, Machesky LM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "15040784",
"url": "https://glygen.org/publication/PubMed/15040784"
}
]
},
{
"title": "Three-dimensional solution structure of the src homology 2 domain of c-abl.",
"journal": "Cell",
"date": "1992",
"authors": "Overduin M, Rios C B, Mayer B J, Baltimore D, Cowburn D",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "1505033",
"url": "https://glygen.org/publication/PubMed/1505033"
}
]
},
{
"title": "Direct activation of the ATM protein kinase by the Mre11/Rad50/Nbs1 complex.",
"journal": "Science (New York, N.Y.)",
"date": "2004",
"authors": "Lee JH, Paull TT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "15064416",
"url": "https://glygen.org/publication/PubMed/15064416"
}
]
},
{
"title": "Mdc1 couples DNA double-strand break recognition by Nbs1 with its H2AX-dependent chromatin retention.",
"journal": "The EMBO journal",
"date": "2004",
"authors": "Lukas C, Melander F, Stucki M, Falck J, Bekker-Jensen S, Goldberg M, Lerenthal Y, Jackson SP, Bartek J, Lukas J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "15201865",
"url": "https://glygen.org/publication/PubMed/15201865"
}
]
},
{
"title": "The novel Cdc42 guanine nucleotide exchange factor, zizimin1, dimerizes via the Cdc42-binding CZH2 domain.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Meller N, Irani-Tehrani M, Ratnikov BI, Paschal BM, Schwartz MA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231"
}
],
"reference": [
{
"type": "PubMed",
"id": "15247287",
"url": "https://glygen.org/publication/PubMed/15247287"
}
]
},
{
"title": "H2AX: the histone guardian of the genome.",
"journal": "DNA repair",
"date": "2004",
"authors": "Fernandez-Capetillo O, Lee A, Nussenzweig M, Nussenzweig A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "15279782",
"url": "https://glygen.org/publication/PubMed/15279782"
}
]
},
{
"title": "The c-Fes tyrosine kinase cooperates with the breakpoint cluster region protein (Bcr) to induce neurite extension in a Rac- and Cdc42-dependent manner.",
"journal": "Exp. Cell Res.",
"date": "2004",
"authors": "Laurent CE, Smithgall TE",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "15302586",
"url": "https://glygen.org/publication/PubMed/15302586"
}
]
},
{
"title": "Fusion of NUP214 to ABL1 on amplified episomes in T-cell acute lymphoblastic leukemia.",
"journal": "Nature genetics",
"date": "2004",
"authors": "Graux C, Cools J, Melotte C, Quentmeier H, Ferrando A, Levine R, Vermeesch JR, Stul M, Dutta B, Boeckx N, Bosly A, Heimann P, Uyttebroeck A, Mentens N, Somers R, MacLeod RA, Drexler HG, Look AT, Gilliland DG, Michaux L, Vandenberghe P, Wlodarska I, Marynen P, Hagemeijer A",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "15361874",
"url": "https://glygen.org/publication/PubMed/15361874"
}
]
},
{
"title": "Evidence of ABL-kinase domain mutations in highly purified primitive stem cell populations of patients with chronic myelogenous leukemia.",
"journal": "Biochemical and biophysical research communications",
"date": "2004",
"authors": "Sorel N, Bonnet ML, Guillier M, Guilhot F, Brizard A, Turhan AG",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "15381060",
"url": "https://glygen.org/publication/PubMed/15381060"
}
]
},
{
"title": "Regulation of WASP/WAVE proteins: making a long story short.",
"journal": "The Journal of cell biology",
"date": "2004",
"authors": "Bompard G, Caron E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "15452139",
"url": "https://glygen.org/publication/PubMed/15452139"
}
]
},
{
"title": "Genetic steps of mammalian homologous repair with distinct mutagenic consequences.",
"journal": "Molecular and cellular biology",
"date": "2004",
"authors": "Stark JM, Pierce AJ, Oh J, Pastink A, Jasin M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5685938",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685938"
}
],
"reference": [
{
"type": "PubMed",
"id": "15485900",
"url": "https://glygen.org/publication/PubMed/15485900"
}
]
},
{
"title": "Combination of the histone deacetylase inhibitor LBH589 and the hsp90 inhibitor 17-AAG is highly active against human CML-BC cells and AML cells with activating mutation of FLT-3.",
"journal": "Blood",
"date": "2005",
"authors": "George P, Bali P, Annavarapu S, Scuto A, Fiskus W, Guo F, Sigua C, Sondarva G, Moscinski L, Atadja P, Bhalla K",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "15514006",
"url": "https://glygen.org/publication/PubMed/15514006"
}
]
},
{
"title": "Catalytic domains of tyrosine kinases determine the phosphorylation sites within c-Cbl.",
"journal": "FEBS letters",
"date": "2004",
"authors": "Grossmann AH, Kolibaba KS, Willis SG, Corbin AS, Langdon WS, Deininger MW, Druker BJ",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "15556646",
"url": "https://glygen.org/publication/PubMed/15556646"
}
]
},
{
"title": "Phosphorylation of p27Kip1 at Thr-157 interferes with its association with importin alpha during G1 and prevents nuclear re-entry.",
"journal": "The Journal of biological chemistry",
"date": "2005",
"authors": "Shin I, Rotty J, Wu FY, Arteaga CL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "15579463",
"url": "https://glygen.org/publication/PubMed/15579463"
}
]
},
{
"title": "c-Abl tyrosine kinase regulates caspase-9 autocleavage in the apoptotic response to DNA damage.",
"journal": "The Journal of biological chemistry",
"date": "2005",
"authors": "Raina D, Pandey P, Ahmad R, Bharti A, Ren J, Kharbanda S, Weichselbaum R, Kufe D",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "15657060",
"url": "https://glygen.org/publication/PubMed/15657060"
}
]
},
{
"title": "Abelson-interactor-1 promotes WAVE2 membrane translocation and Abelson-mediated tyrosine phosphorylation required for WAVE2 activation.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2005",
"authors": "Leng Y, Zhang J, Badour K, Arpaia E, Freeman S, Cheung P, Siu M, Siminovitch K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "15657136",
"url": "https://glygen.org/publication/PubMed/15657136"
}
]
},
{
"title": "A non-ATP-competitive inhibitor of BCR-ABL overrides imatinib resistance.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2005",
"authors": "Gumireddy K, Baker SJ, Cosenza SC, John P, Kang AD, Robell KA, Reddy MV, Reddy EP",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "15677719",
"url": "https://glygen.org/publication/PubMed/15677719"
}
]
},
{
"title": "The ubiquitin-protein ligase Itch regulates p73 stability.",
"journal": "The EMBO journal",
"date": "2005",
"authors": "Rossi M, De Laurenzi V, Munarriz E, Green DR, Liu YC, Vousden KH, Cesareni G, Melino G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8939236",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236"
}
],
"reference": [
{
"type": "PubMed",
"id": "15678106",
"url": "https://glygen.org/publication/PubMed/15678106"
}
]
},
{
"title": "Role of c-Abl in the DNA damage stress response.",
"journal": "Cell Res.",
"date": "2005",
"authors": "Shaul Yosef, Ben-Yehoyada Merav",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "15686624",
"url": "https://glygen.org/publication/PubMed/15686624"
}
]
},
{
"title": "JNK phosphorylation of 14-3-3 proteins regulates nuclear targeting of c-Abl in the apoptotic response to DNA damage.",
"journal": "Nature cell biology",
"date": "2005",
"authors": "Yoshida K, Yamaguchi T, Natsume T, Kufe D, Miki Y",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "iPTMnet",
"id": "P00519-1",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519-1"
}
],
"reference": [
{
"type": "PubMed",
"id": "15696159",
"url": "https://glygen.org/publication/PubMed/15696159"
}
]
},
{
"title": "Zizimin2: a novel, DOCK180-related Cdc42 guanine nucleotide exchange factor expressed predominantly in lymphocytes.",
"journal": "FEBS letters",
"date": "2005",
"authors": "Nishikimi A, Meller N, Uekawa N, Isobe K, Schwartz MA, Maruyama M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231"
}
],
"reference": [
{
"type": "PubMed",
"id": "15710388",
"url": "https://glygen.org/publication/PubMed/15710388"
}
]
},
{
"title": "RIN1 is an ABL tyrosine kinase activator and a regulator of epithelial-cell adhesion and migration.",
"journal": "Current biology : CB",
"date": "2005",
"authors": "Hu H, Bliss JM, Wang Y, Colicelli J",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "15886098",
"url": "https://glygen.org/publication/PubMed/15886098"
}
]
},
{
"title": "Mutations in NOTCH1 cause aortic valve disease.",
"journal": "Nature",
"date": "2005",
"authors": "Garg V, Muth AN, Ransom JF, Schluterman MK, Barnes R, King IN, Grossfeld PD, Srivastava D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8940973",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8940973"
}
],
"reference": [
{
"type": "PubMed",
"id": "16025100",
"url": "https://glygen.org/publication/PubMed/16025100"
}
]
},
{
"title": "Assessment and follow-up of the proportion of T315I mutant BCR-ABL transcripts can guide appropriate therapeutic decision making in CML patients.",
"journal": "Leukemia research",
"date": "2005",
"authors": "Hayette S, Michallet M, Baille ML, Magaud JP, Nicolini FE",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "16038734",
"url": "https://glygen.org/publication/PubMed/16038734"
}
]
},
{
"title": "Is AMN-107 a step forward from imatinib in the treatment of chronic myeloid leukaemia?",
"journal": "Expert opinion on investigational drugs",
"date": "2005",
"authors": "Doggrell SA",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "16050798",
"url": "https://glygen.org/publication/PubMed/16050798"
}
]
},
{
"title": "Mammalian CARMIL inhibits actin filament capping by capping protein.",
"journal": "Developmental cell",
"date": "2005",
"authors": "Yang C, Pring M, Wear MA, Huang M, Cooper JA, Svitkina TM, Zigmond SH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231"
}
],
"reference": [
{
"type": "PubMed",
"id": "16054028",
"url": "https://glygen.org/publication/PubMed/16054028"
}
]
},
{
"title": "T315I-mutated Bcr-Abl in chronic myeloid leukemia and imatinib: insights from a computational study.",
"journal": "Molecular cancer therapeutics",
"date": "2005",
"authors": "Pricl S, Fermeglia M, Ferrone M, Tamborini E",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "16093432",
"url": "https://glygen.org/publication/PubMed/16093432"
}
]
},
{
"title": "TAZ, a transcriptional modulator of mesenchymal stem cell differentiation.",
"journal": "Science (New York, N.Y.)",
"date": "2005",
"authors": "Hong JH, Hwang ES, McManus MT, Amsterdam A, Tian Y, Kalmukova R, Mueller E, Benjamin T, Spiegelman BM, Sharp PA, Hopkins N, Yaffe MB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8940973",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8940973"
}
],
"reference": [
{
"type": "PubMed",
"id": "16099986",
"url": "https://glygen.org/publication/PubMed/16099986"
}
]
},
{
"title": "DNA damage regulates Chk2 association with chromatin.",
"journal": "The Journal of biological chemistry",
"date": "2005",
"authors": "Li J, Stern DF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "16150728",
"url": "https://glygen.org/publication/PubMed/16150728"
}
]
},
{
"title": "Tyrosine phosphorylation modulates binding preference to cyclin-dependent kinases and subcellular localization of p27Kip1 in the acute promyelocytic leukemia cell line NB4.",
"journal": "Blood",
"date": "2006",
"authors": "Kardinal C, Dangers M, Kardinal A, Koch A, Brandt DT, Tamura T, Welte K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "16195327",
"url": "https://glygen.org/publication/PubMed/16195327"
}
]
},
{
"title": "Mechanism of filament nucleation and branch stability revealed by the structure of the Arp2/3 complex at actin branch junctions.",
"journal": "PLoS biology",
"date": "2005",
"authors": "Egile C, Rouiller I, Xu XP, Volkmann N, Li R, Hanein D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "16262445",
"url": "https://glygen.org/publication/PubMed/16262445"
}
]
},
{
"title": "Inducible processing of interferon regulatory factor-2.",
"journal": "Molecular and cellular biology",
"date": "1992",
"authors": "Palombella VJ, Maniatis T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231"
}
],
"reference": [
{
"type": "PubMed",
"id": "1630448",
"url": "https://glygen.org/publication/PubMed/1630448"
}
]
},
{
"title": "MDC1 directly binds phosphorylated histone H2AX to regulate cellular responses to DNA double-strand breaks.",
"journal": "Cell",
"date": "2005",
"authors": "Stucki M, Clapperton JA, Mohammad D, Yaffe MB, Smerdon SJ, Jackson SP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "16377563",
"url": "https://glygen.org/publication/PubMed/16377563"
}
]
},
{
"title": "[Analysis of ABL tyrosine kinase point mutations in imatinib treated chronic myelogenous leukemia patients].",
"journal": "Zhonghua yi xue za zhi",
"date": "2005",
"authors": "Qin YZ, Liu YR, Li JL, Ruan GR, Zhu HH, Jiang Q, Fu JY, Lu Y, Chang Y, Li LD, Huang XJ, Chen SS, Qiu JY",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "16405837",
"url": "https://glygen.org/publication/PubMed/16405837"
}
]
},
{
"title": "Structure of the kinase domain of an imatinib-resistant Abl mutant in complex with the Aurora kinase inhibitor VX-680.",
"journal": "Cancer research",
"date": "2006-01-15",
"authors": "Young Matthew A, Shah Neil P, Chao Luke H, Seeliger Markus, Milanov Zdravko V, Biggs William H, Treiber Daniel K, Patel Hitesh K, Zarrinkar Patrick P, Lockhart David J, Sawyers Charles L, Kuriyan John",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "16424036",
"url": "https://glygen.org/publication/PubMed/16424036"
}
]
},
{
"title": "MDC1 maintains genomic stability by participating in the amplification of ATM-dependent DNA damage signals.",
"journal": "Molecular cell",
"date": "2006",
"authors": "Lou Z, Minter-Dykhouse K, Franco S, Gostissa M, Rivera MA, Celeste A, Manis JP, van Deursen J, Nussenzweig A, Paull TT, Alt FW, Chen J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "16427009",
"url": "https://glygen.org/publication/PubMed/16427009"
}
]
},
{
"title": "A common phosphotyrosine signature for the Bcr-Abl kinase.",
"journal": "Blood",
"date": "2006",
"authors": "Goss VL, Lee KA, Moritz A, Nardone J, Spek EJ, MacNeill J, Rush J, Comb MJ, Polakiewicz RD",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519-1",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519-1"
}
],
"reference": [
{
"type": "PubMed",
"id": "16497976",
"url": "https://glygen.org/publication/PubMed/16497976"
}
]
},
{
"title": "Organization of the SH3-SH2 unit in active and inactive forms of the c-Abl tyrosine kinase.",
"journal": "Molecular cell",
"date": "2006",
"authors": "Nagar B, Hantschel O, Seeliger M, Davies JM, Weis WI, Superti-Furga G, Kuriyan J",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "16543148",
"url": "https://glygen.org/publication/PubMed/16543148"
}
]
},
{
"title": "Requirements for Vav guanine nucleotide exchange factors and Rho GTPases in FcgammaR- and complement-mediated phagocytosis.",
"journal": "Immunity",
"date": "2006",
"authors": "Hall AB, Gakidis MA, Glogauer M, Wilsbacher JL, Gao S, Swat W, Brugge JS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "16546099",
"url": "https://glygen.org/publication/PubMed/16546099"
}
]
},
{
"title": "A Src-like inactive conformation in the abl tyrosine kinase domain.",
"journal": "PLoS Biol.",
"date": "2006",
"authors": "Levinson Nicholas M, Kuchment Olga, Shen Kui, Young Matthew A, Koldobskiy Michael, Karplus Martin, Cole Philip A, Kuriyan John",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "16640460",
"url": "https://glygen.org/publication/PubMed/16640460"
}
]
},
{
"title": "Hsp90 increases LIM kinase activity by promoting its homo-dimerization.",
"journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology",
"date": "2006",
"authors": "Li R, Soosairajah J, Harari D, Citri A, Price J, Ng HL, Morton CJ, Parker MW, Yarden Y, Bernard O",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "16641196",
"url": "https://glygen.org/publication/PubMed/16641196"
}
]
},
{
"title": "Mutation status and clinical outcome of 89 imatinib mesylate-resistant chronic myelogenous leukemia patients: a retrospective analysis from the French intergroup of CML (Fi(phi)-LMC GROUP).",
"journal": "Leukemia",
"date": "2006",
"authors": "Nicolini FE, Corm S, Le QH, Sorel N, Hayette S, Bories D, Leguay T, Roy L, Giraudier S, Tulliez M, Facon T, Mahon FX, Cayuela JM, Rousselot P, Michallet M, Preudhomme C, Guilhot F, Roche-Lestienne C",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "16642048",
"url": "https://glygen.org/publication/PubMed/16642048"
}
]
},
{
"title": "c-Abl acetylation by histone acetyltransferases regulates its nuclear-cytoplasmic localization.",
"journal": "EMBO reports",
"date": "2006",
"authors": "di Bari MG, Ciuffini L, Mingardi M, Testi R, Soddu S, Barila D",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "16648821",
"url": "https://glygen.org/publication/PubMed/16648821"
}
]
},
{
"title": "DNA damage-induced BARD1 phosphorylation is critical for the inhibition of messenger RNA processing by BRCA1/BARD1 complex.",
"journal": "Cancer research",
"date": "2006",
"authors": "Kim HS, Li H, Cevher M, Parmelee A, Fonseca D, Kleiman FE, Lee SB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "16651405",
"url": "https://glygen.org/publication/PubMed/16651405"
}
]
},
{
"title": "Interaction between c-Abl and Arg tyrosine kinases and proteasome subunit PSMA7 regulates proteasome degradation.",
"journal": "Molecular cell",
"date": "2006",
"authors": "Liu X, Huang W, Li C, Li P, Yuan J, Li X, Qiu XB, Ma Q, Cao C",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "16678104",
"url": "https://glygen.org/publication/PubMed/16678104"
}
]
},
{
"title": "Optimization of WAVE2 complex-induced actin polymerization by membrane-bound IRSp53, PIP(3), and Rac.",
"journal": "The Journal of cell biology",
"date": "2006",
"authors": "Suetsugu S, Kurisu S, Oikawa T, Yamazaki D, Oda A, Takenawa T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "16702231",
"url": "https://glygen.org/publication/PubMed/16702231"
}
]
},
{
"title": "SATB2 is a multifunctional determinant of craniofacial patterning and osteoblast differentiation.",
"journal": "Cell",
"date": "2006",
"authors": "Dobreva G, Chahrour M, Dautzenberg M, Chirivella L, Kanzler B, Farinas I, Karsenty G, Grosschedl R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8940973",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8940973"
}
],
"reference": [
{
"type": "PubMed",
"id": "16751105",
"url": "https://glygen.org/publication/PubMed/16751105"
}
]
},
{
"title": "Regulated activating Thr172 phosphorylation of cyclin-dependent kinase 4(CDK4): its relationship with cyclins and CDK `inhibitors`.",
"journal": "Molecular and cellular biology",
"date": "2006",
"authors": "Bockstaele L, Kooken H, Libert F, Paternot S, Dumont JE, de Launoit Y, Roger PP, Coulonval K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "16782892",
"url": "https://glygen.org/publication/PubMed/16782892"
}
]
},
{
"title": "Arp2/3 ATP hydrolysis: to branch or to debranch?",
"journal": "Nature cell biology",
"date": "2006",
"authors": "Kovar DR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "16880808",
"url": "https://glygen.org/publication/PubMed/16880808"
}
]
},
{
"title": "MUC1 oncoprotein blocks nuclear targeting of c-Abl in the apoptotic response to DNA damage.",
"journal": "The EMBO journal",
"date": "2006",
"authors": "Raina D, Ahmad R, Kumar S, Ren J, Yoshida K, Kharbanda S, Kufe D",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519-1",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519-1"
}
],
"reference": [
{
"type": "PubMed",
"id": "16888623",
"url": "https://glygen.org/publication/PubMed/16888623"
}
]
},
{
"title": "Src family kinases phosphorylate the Bcr-Abl SH3-SH2 region and modulate Bcr-Abl transforming activity.",
"journal": "The Journal of biological chemistry",
"date": "2006",
"authors": "Meyn MA 3rd, Wilson MB, Abdi FA, Fahey N, Schiavone AP, Wu J, Hochrein JM, Engen JR, Smithgall TE",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "16912036",
"url": "https://glygen.org/publication/PubMed/16912036"
}
]
},
{
"title": "Heterogeneity in detecting Abl kinase mutations and better sensitivity using circulating plasma RNA.",
"journal": "Leukemia",
"date": "2006",
"authors": "Ma W, Kantarjian H, Jilani I, Gorre M, Bhalla K, Ottmann O, Giles F, Albitar M",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "16932346",
"url": "https://glygen.org/publication/PubMed/16932346"
}
]
},
{
"title": "Abl tyrosine kinase regulates endocytosis of the epidermal growth factor receptor.",
"journal": "The Journal of biological chemistry",
"date": "2006",
"authors": "Tanos B, Pendergast AM",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "16943190",
"url": "https://glygen.org/publication/PubMed/16943190"
}
]
},
{
"title": "MK-0457, a novel kinase inhibitor, is active in patients with chronic myeloid leukemia or acute lymphocytic leukemia with the T315I BCR-ABL mutation.",
"journal": "Blood",
"date": "2007",
"authors": "Giles FJ, Cortes J, Jones D, Bergstrom D, Kantarjian H, Freedman SJ",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "16990603",
"url": "https://glygen.org/publication/PubMed/16990603"
}
]
},
{
"title": "A novel Bcr-Abl splice isoform is associated with the L248V mutation in CML patients with acquired resistance to imatinib.",
"journal": "Leukemia",
"date": "2006",
"authors": "Gruber FX, Hjorth-Hansen H, Mikkola I, Stenke L, Johansen T",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "17008892",
"url": "https://glygen.org/publication/PubMed/17008892"
}
]
},
{
"title": "Varying response to escalating the dose of imatinib in patients with CML who `acquire` a BCR-ABL M244V mutant allele.",
"journal": "Blood",
"date": "2006",
"authors": "Anand M, Khorashad J, Marin D, Apperley JF, Goldman JM, Kaeda JS",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "17021308",
"url": "https://glygen.org/publication/PubMed/17021308"
}
]
},
{
"title": "Dock4 is regulated by RhoG and promotes Rac-dependent cell migration.",
"journal": "Experimental cell research",
"date": "2006",
"authors": "Hiramoto K, Negishi M, Katoh H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231"
}
],
"reference": [
{
"type": "PubMed",
"id": "17027967",
"url": "https://glygen.org/publication/PubMed/17027967"
}
]
},
{
"title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.",
"journal": "Cell",
"date": "2006",
"authors": "Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "iPTMnet",
"id": "P00519-1",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519-1"
}
],
"reference": [
{
"type": "PubMed",
"id": "17081983",
"url": "https://glygen.org/publication/PubMed/17081983"
}
]
},
{
"title": "Regulation of CDK4.",
"journal": "Cell division",
"date": "2006",
"authors": "Bockstaele L, Coulonval K, Kooken H, Paternot S, Roger PP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "17092340",
"url": "https://glygen.org/publication/PubMed/17092340"
}
]
},
{
"title": "Presence or the emergence of a F317L BCR-ABL mutation may be associated with resistance to dasatinib in Philadelphia chromosome-positive leukemia.",
"journal": "Journal of clinical oncology : official journal of the American Society of Clinical Oncology",
"date": "2006",
"authors": "Soverini S, Martinelli G, Colarossi S, Gnani A, Castagnetti F, Rosti G, Bosi C, Paolini S, Rondoni M, Piccaluga PP, Palandri F, Giannoulia P, Marzocchi G, Luatti S, Testoni N, Iacobucci I, Cilloni D, Saglio G, Baccarani M",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "17114651",
"url": "https://glygen.org/publication/PubMed/17114651"
}
]
},
{
"title": "Rottlerin synergistically enhances imatinib-induced apoptosis of BCR/ABL-expressing cells through its mitochondrial uncoupling effect independent of protein kinase C-delta.",
"journal": "Oncogene",
"date": "2007",
"authors": "Kurosu T, Tsuji K, Kida A, Koyama T, Yamamoto M, Miura O",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "17130834",
"url": "https://glygen.org/publication/PubMed/17130834"
}
]
},
{
"title": "Structural biology contributions to the discovery of drugs to treat chronic myelogenous leukaemia.",
"journal": "Acta Crystallogr. D",
"date": "2007",
"authors": "Cowan-Jacob Sandra W, Fendrich Gabriele, Floersheimer Andreas, Furet Pascal, Liebetanz Janis, Rummel Gabriele, Rheinberger Paul, Centeleghe Mario, Fabbro Doriano, Manley Paul W",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "17164530",
"url": "https://glygen.org/publication/PubMed/17164530"
}
]
},
{
"title": "Lim kinases, regulators of actin dynamics.",
"journal": "The international journal of biochemistry & cell biology",
"date": "2007",
"authors": "Bernard O",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "17188549",
"url": "https://glygen.org/publication/PubMed/17188549"
}
]
},
{
"title": "Contribution of ABL kinase domain mutations to imatinib resistance in different subsets of Philadelphia-positive patients: by the GIMEMA Working Party on Chronic Myeloid Leukemia.",
"journal": "Clinical cancer research : an official journal of the American Association for Cancer Research",
"date": "2006",
"authors": "Soverini S, Colarossi S, Gnani A, Rosti G, Castagnetti F, Poerio A, Iacobucci I, Amabile M, Abruzzese E, Orlandi E, Radaelli F, Ciccone F, Tiribelli M, di Lorenzo R, Caracciolo C, Izzo B, Pane F, Saglio G, Baccarani M, Martinelli G",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "17189410",
"url": "https://glygen.org/publication/PubMed/17189410"
}
]
},
{
"title": "Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry.",
"journal": "Molecular & cellular proteomics : MCP",
"date": "2007",
"authors": "Wissing J, Jansch L, Nimtz M, Dieterich G, Hornberger R, Keri G, Wehland J, Daub H",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519-1",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519-1"
}
],
"reference": [
{
"type": "PubMed",
"id": "17192257",
"url": "https://glygen.org/publication/PubMed/17192257"
}
]
},
{
"title": "Dock6, a Dock-C subfamily guanine nucleotide exchanger, has the dual specificity for Rac1 and Cdc42 and regulates neurite outgrowth.",
"journal": "Experimental cell research",
"date": "2007",
"authors": "Miyamoto Y, Yamauchi J, Sanbe A, Tanoue A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231"
}
],
"reference": [
{
"type": "PubMed",
"id": "17196961",
"url": "https://glygen.org/publication/PubMed/17196961"
}
]
},
{
"title": "Effect of WAVE2 phosphorylation on activation of the Arp2/3 complex.",
"journal": "Journal of biochemistry",
"date": "2007",
"authors": "Nakanishi O, Suetsugu S, Yamazaki D, Takenawa T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "17202194",
"url": "https://glygen.org/publication/PubMed/17202194"
}
]
},
{
"title": "Cdk-inhibitory activity and stability of p27Kip1 are directly regulated by oncogenic tyrosine kinases.",
"journal": "Cell",
"date": "2007",
"authors": "Grimmler M, Wang Y, Mund T, Cilensek Z, Keidel EM, Waddell MB, Jakel H, Kullmann M, Kriwacki RW, Hengst L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "17254966",
"url": "https://glygen.org/publication/PubMed/17254966"
}
]
},
{
"title": "p27 phosphorylation by Src regulates inhibition of cyclin E-Cdk2.",
"journal": "Cell",
"date": "2007",
"authors": "Chu I, Sun J, Arnaout A, Kahn H, Hanna W, Narod S, Sun P, Tan CK, Hengst L, Slingerland J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "17254967",
"url": "https://glygen.org/publication/PubMed/17254967"
}
]
},
{
"title": "A critical role for cortactin phosphorylation by Abl-family kinases in PDGF-induced dorsal-wave formation.",
"journal": "Current biology : CB",
"date": "2007",
"authors": "Boyle SN, Michaud GA, Schweitzer B, Predki PF, Koleske AJ",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "17306540",
"url": "https://glygen.org/publication/PubMed/17306540"
}
]
},
{
"title": "Role of CrkII in Fcgamma receptor-mediated phagocytosis.",
"journal": "The Journal of biological chemistry",
"date": "2007",
"authors": "Lee WL, Cosio G, Ireton K, Grinstein S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "17308335",
"url": "https://glygen.org/publication/PubMed/17308335"
}
]
},
{
"title": "Patterns of somatic mutation in human cancer genomes.",
"journal": "Nature",
"date": "2007",
"authors": "Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "17344846",
"url": "https://glygen.org/publication/PubMed/17344846"
}
]
},
{
"title": "Emerging strategies for the treatment of mutant Bcr-Abl T315I myeloid leukemia.",
"journal": "Clinical lymphoma & myeloma",
"date": "2007",
"authors": "Mughal TI, Goldman JM",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "17382017",
"url": "https://glygen.org/publication/PubMed/17382017"
}
]
},
{
"title": "Inhibition of heat shock protein 90 prolongs survival of mice with BCR-ABL-T315I-induced leukemia and suppresses leukemic stem cells.",
"journal": "Blood",
"date": "2007",
"authors": "Peng C, Brain J, Hu Y, Goodrich A, Kong L, Grayzel D, Pak R, Read M, Li S",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "17395781",
"url": "https://glygen.org/publication/PubMed/17395781"
}
]
},
{
"title": "Crystallization by capillary counter-diffusion and structure determination of the N114A mutant of the SH3 domain of Abl tyrosine kinase complexed with a high-affinity peptide ligand.",
"journal": "Acta Crystallogr. D",
"date": "2007",
"authors": "C\u00e1mara-Artigas Ana, Palencia Andr\u00e9s, Mart\u00ednez Jos\u00e9 C, Luque Irene, Gavira Jos\u00e9 Antonio, Garc\u00eda-Ruiz Juan Manuel",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "17452790",
"url": "https://glygen.org/publication/PubMed/17452790"
}
]
},
{
"title": "ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.",
"journal": "Science (New York, N.Y.)",
"date": "2007",
"authors": "Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "17525332",
"url": "https://glygen.org/publication/PubMed/17525332"
}
]
},
{
"title": "Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response.",
"journal": "Science (New York, N.Y.)",
"date": "2007",
"authors": "Wang B, Matsuoka S, Ballif BA, Zhang D, Smogorzewska A, Gygi SP, Elledge SJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "17525340",
"url": "https://glygen.org/publication/PubMed/17525340"
}
]
},
{
"title": "BCR-ABL(T315I) transcript disappearance in an imatinib-resistant CML patient treated with homoharringtonine: a new therapeutic challenge?",
"journal": "Leukemia",
"date": "2007",
"authors": "Legros L, Hayette S, Nicolini FE, Raynaud S, Chabane K, Magaud JP, Cassuto JP, Michallet M",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "17541396",
"url": "https://glygen.org/publication/PubMed/17541396"
}
]
},
{
"title": "Characterisation of the sites of DNA damage-induced 53BP1 phosphorylation catalysed by ATM and ATR.",
"journal": "DNA repair",
"date": "2007",
"authors": "Jowsey P, Morrice NA, Hastie CJ, McLauchlan H, Toth R, Rouse J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "17553757",
"url": "https://glygen.org/publication/PubMed/17553757"
}
]
},
{
"title": "c-Abl-mediated phosphorylation of WAVE3 is required for lamellipodia formation and cell migration.",
"journal": "The Journal of biological chemistry",
"date": "2007",
"authors": "Sossey-Alaoui K, Li X, Cowell JK",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "17623672",
"url": "https://glygen.org/publication/PubMed/17623672"
}
]
},
{
"title": "Heat shock protein 90: a potential therapeutic target in leukemic progenitor and stem cells harboring mutant BCR-ABL resistant to kinase inhibitors.",
"journal": "Cell cycle (Georgetown, Tex.)",
"date": "2007",
"authors": "Peng C, Li D, Li S",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "17671436",
"url": "https://glygen.org/publication/PubMed/17671436"
}
]
},
{
"title": "Clinical outcome of 27 imatinib mesylate-resistant chronic myelogenous leukemia patients harboring a T315I BCR-ABL mutation.",
"journal": "Haematologica",
"date": "2007",
"authors": "Nicolini FE, Hayette S, Corm S, Bachy E, Bories D, Tulliez M, Guilhot F, Legros L, Maloisel F, Kiladjian JJ, Mahon FX, Le QH, Michallet M, Roche-Lestienne C, Preudhomme C",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "17768119",
"url": "https://glygen.org/publication/PubMed/17768119"
}
]
},
{
"title": "Structural requirements for the BARD1 tumor suppressor in chromosomal stability and homology-directed DNA repair.",
"journal": "The Journal of biological chemistry",
"date": "2007",
"authors": "Laufer M, Nandula SV, Modi AP, Wang S, Jasin M, Murty VV, Ludwig T, Baer R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "17848578",
"url": "https://glygen.org/publication/PubMed/17848578"
}
]
},
{
"title": "Interferon-alpha or homoharringtonine as salvage treatment for chronic myeloid leukemia patients who acquire the T315I BCR-ABL mutation.",
"journal": "Blood",
"date": "2007",
"authors": "de Lavallade H, Khorashad JS, Davis HP, Milojkovic D, Kaeda JS, Goldman JM, Apperley JF, Marin D",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "17881650",
"url": "https://glygen.org/publication/PubMed/17881650"
}
]
},
{
"title": "Differential modification of p27Kip1 controls its cyclin D-cdk4 inhibitory activity.",
"journal": "Molecular and cellular biology",
"date": "2008",
"authors": "James MK, Ray A, Leznova D, Blain SW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "17908796",
"url": "https://glygen.org/publication/PubMed/17908796"
}
]
},
{
"title": "The ERCC1/XPF endonuclease is required for efficient single-strand annealing and gene conversion in mammalian cells.",
"journal": "Nucleic acids research",
"date": "2008",
"authors": "Al-Minawi AZ, Saleh-Gohari N, Helleday T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5685938",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685938"
}
],
"reference": [
{
"type": "PubMed",
"id": "17962301",
"url": "https://glygen.org/publication/PubMed/17962301"
}
]
},
{
"title": "RNF8 ubiquitylates histones at DNA double-strand breaks and promotes assembly of repair proteins.",
"journal": "Cell",
"date": "2007",
"authors": "Mailand N, Bekker-Jensen S, Faustrup H, Melander F, Bartek J, Lukas C, Lukas J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "18001824",
"url": "https://glygen.org/publication/PubMed/18001824"
}
]
},
{
"title": "RNF8 transduces the DNA-damage signal via histone ubiquitylation and checkpoint protein assembly.",
"journal": "Cell",
"date": "2007",
"authors": "Huen MS, Grant R, Manke I, Minn K, Yu X, Yaffe MB, Chen J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "18001825",
"url": "https://glygen.org/publication/PubMed/18001825"
}
]
},
{
"title": "Orchestration of the DNA-damage response by the RNF8 ubiquitin ligase.",
"journal": "Science (New York, N.Y.)",
"date": "2007",
"authors": "Kolas NK, Chapman JR, Nakada S, Ylanko J, Chahwan R, Sweeney FD, Panier S, Mendez M, Wildenhain J, Thomson TM, Pelletier L, Jackson SP, Durocher D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "18006705",
"url": "https://glygen.org/publication/PubMed/18006705"
}
]
},
{
"title": "FcgammaRIII mediates immunoglobulin G-induced interleukin-10 and is required for chronic Leishmania mexicana lesions.",
"journal": "Infection and immunity",
"date": "2008",
"authors": "Thomas BN, Buxbaum LU",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9664422",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664422"
}
],
"reference": [
{
"type": "PubMed",
"id": "18070890",
"url": "https://glygen.org/publication/PubMed/18070890"
}
]
},
{
"title": "Ubc13/Rnf8 ubiquitin ligases control foci formation of the Rap80/Abraxas/Brca1/Brcc36 complex in response to DNA damage.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2007",
"authors": "Wang B, Elledge SJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "18077395",
"url": "https://glygen.org/publication/PubMed/18077395"
}
]
},
{
"title": "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer.",
"journal": "Cell",
"date": "2007",
"authors": "Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "18083107",
"url": "https://glygen.org/publication/PubMed/18083107"
}
]
},
{
"title": "Phosphorylation of c-Abl by protein kinase Pak2 regulates differential binding of ABI2 and CRK.",
"journal": "Biochemistry",
"date": "2008",
"authors": "Jung JH, Pendergast AM, Zipfel PA, Traugh JA",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "18161990",
"url": "https://glygen.org/publication/PubMed/18161990"
}
]
},
{
"title": "Emerging roles of Abl family tyrosine kinases in microbial pathogenesis.",
"journal": "Trends Biochem. Sci.",
"date": "2008",
"authors": "Backert Steffen, Feller Stephan M, Wessler Silja",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "18182299",
"url": "https://glygen.org/publication/PubMed/18182299"
}
]
},
{
"title": "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.",
"journal": "Journal of proteome research",
"date": "2008",
"authors": "Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "18220336",
"url": "https://glygen.org/publication/PubMed/18220336"
}
]
},
{
"title": "Second generation Abl kinase inhibitors and novel compounds to eliminate the Bcr-Abl/T315I clone.",
"journal": "Recent patents on anti-cancer drug discovery",
"date": "2006",
"authors": "Kimura S",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "18221045",
"url": "https://glygen.org/publication/PubMed/18221045"
}
]
},
{
"title": "Simultaneous targeting of Aurora kinases and Bcr-Abl kinase by the small molecule inhibitor PHA-739358 is effective against imatinib-resistant BCR-ABL mutations including T315I.",
"journal": "Blood",
"date": "2008",
"authors": "Gontarewicz A, Balabanov S, Keller G, Colombo R, Graziano A, Pesenti E, Benten D, Bokemeyer C, Fiedler W, Moll J, Brummendorf TH",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "18268096",
"url": "https://glygen.org/publication/PubMed/18268096"
}
]
},
{
"title": "Yap1 phosphorylation by c-Abl is a critical step in selective activation of proapoptotic genes in response to DNA damage.",
"journal": "Molecular cell",
"date": "2008",
"authors": "Levy D, Adamovich Y, Reuven N, Shaul Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8939236",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236"
}
],
"reference": [
{
"type": "PubMed",
"id": "18280240",
"url": "https://glygen.org/publication/PubMed/18280240"
}
]
},
{
"title": "The E2F transcription factor is a cellular target for the RB protein.",
"journal": "Cell",
"date": "1991",
"authors": "Chellappan SP, Hiebert S, Mudryj M, Horowitz JM, Nevins JR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "1828392",
"url": "https://glygen.org/publication/PubMed/1828392"
}
]
},
{
"title": "The retinoblastoma protein copurifies with E2F-I, an E1A-regulated inhibitor of the transcription factor E2F.",
"journal": "Cell",
"date": "1991",
"authors": "Bagchi S, Weinmann R, Raychaudhuri P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "1828393",
"url": "https://glygen.org/publication/PubMed/1828393"
}
]
},
{
"title": "The T/E1A-binding domain of the retinoblastoma product can interact selectively with a sequence-specific DNA-binding protein.",
"journal": "Cell",
"date": "1991",
"authors": "Chittenden T, Livingston DM, Kaelin WG Jr",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "1828394",
"url": "https://glygen.org/publication/PubMed/1828394"
}
]
},
{
"title": "Allosteric inhibition of the nonMyristoylated c-Abl tyrosine kinase by phosphopeptides derived from Abi1/Hssh3bp1.",
"journal": "Biochimica et biophysica acta",
"date": "2008",
"authors": "Xiong X, Cui P, Hossain S, Xu R, Warner B, Guo X, An X, Debnath AK, Cowburn D, Kotula L",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "18328268",
"url": "https://glygen.org/publication/PubMed/18328268"
}
]
},
{
"title": "SGX393 inhibits the CML mutant Bcr-AblT315I and preempts in vitro resistance when combined with nilotinib or dasatinib.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2008",
"authors": "O'Hare T, Eide CA, Tyner JW, Corbin AS, Wong MJ, Buchanan S, Holme K, Jessen KA, Tang C, Lewis HA, Romero RD, Burley SK, Deininger MW",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "18367669",
"url": "https://glygen.org/publication/PubMed/18367669"
}
]
},
{
"title": "Effective killing of Gleevec-resistant CML cells with T315I mutation by a natural compound PEITC through redox-mediated mechanism.",
"journal": "Leukemia",
"date": "2008",
"authors": "Zhang H, Trachootham D, Lu W, Carew J, Giles FJ, Keating MJ, Arlinghaus RB, Huang P",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "18385754",
"url": "https://glygen.org/publication/PubMed/18385754"
}
]
},
{
"title": "Regulation of actin assembly associated with protrusion and adhesion in cell migration.",
"journal": "Physiological reviews",
"date": "2008",
"authors": "Le Clainche C, Carlier MF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "18391171",
"url": "https://glygen.org/publication/PubMed/18391171"
}
]
},
{
"title": "Switching cyclin D-Cdk4 kinase activity on and off.",
"journal": "Cell cycle (Georgetown, Tex.)",
"date": "2008",
"authors": "Blain SW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "18414028",
"url": "https://glygen.org/publication/PubMed/18414028"
}
]
},
{
"title": "The basal-like mammary carcinomas induced by Brca1 or Bard1 inactivation implicate the BRCA1/BARD1 heterodimer in tumor suppression.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2008",
"authors": "Shakya R, Szabolcs M, McCarthy E, Ospina E, Basso K, Nandula S, Murty V, Baer R, Ludwig T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "18443292",
"url": "https://glygen.org/publication/PubMed/18443292"
}
]
},
{
"title": "Motif-specific sampling of phosphoproteomes.",
"journal": "Journal of proteome research",
"date": "2008",
"authors": "Ruse CI, McClatchy DB, Lu B, Cociorva D, Motoyama A, Park SK, Yates JR 3rd",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519-1",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519-1"
}
],
"reference": [
{
"type": "PubMed",
"id": "18452278",
"url": "https://glygen.org/publication/PubMed/18452278"
}
]
},
{
"title": "Patched1 haploinsufficiency increases adult bone mass and modulates Gli3 repressor activity.",
"journal": "Developmental cell",
"date": "2008",
"authors": "Ohba S, Kawaguchi H, Kugimiya F, Ogasawara T, Kawamura N, Saito T, Ikeda T, Fujii K, Miyajima T, Kuramochi A, Miyashita T, Oda H, Nakamura K, Takato T, Chung UI",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8940973",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8940973"
}
],
"reference": [
{
"type": "PubMed",
"id": "18477452",
"url": "https://glygen.org/publication/PubMed/18477452"
}
]
},
{
"title": "PHA-680626 exhibits anti-proliferative and pro-apoptotic activity on Imatinib-resistant chronic myeloid leukemia cell lines and primary CD34+ cells by inhibition of both Bcr-Abl tyrosine kinase and Aurora kinases.",
"journal": "Leukemia research",
"date": "2008",
"authors": "Gontarewicz A, Balabanov S, Keller G, Panse J, Schafhausen P, Bokemeyer C, Fiedler W, Moll J, Brummendorf TH",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "18514829",
"url": "https://glygen.org/publication/PubMed/18514829"
}
]
},
{
"title": "Hierarchy of nonhomologous end-joining, single-strand annealing and gene conversion at site-directed DNA double-strand breaks.",
"journal": "Nucleic acids research",
"date": "2008",
"authors": "Mansour WY, Schumacher S, Rosskopf R, Rhein T, Schmidt-Petersen F, Gatzemeier F, Haag F, Borgmann K, Willers H, Dahm-Daphi J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5685938",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685938"
}
],
"reference": [
{
"type": "PubMed",
"id": "18539610",
"url": "https://glygen.org/publication/PubMed/18539610"
}
]
},
{
"title": "ERCC1-XPF endonuclease facilitates DNA double-strand break repair.",
"journal": "Molecular and cellular biology",
"date": "2008",
"authors": "Ahmad A, Robinson AR, Duensing A, van Drunen E, Beverloo HB, Weisberg DB, Hasty P, Hoeijmakers JH, Niedernhofer LJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5685938",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685938"
}
],
"reference": [
{
"type": "PubMed",
"id": "18541667",
"url": "https://glygen.org/publication/PubMed/18541667"
}
]
},
{
"title": "A new rapid and sensitive assay for detecting the T315I BCR-ABL kinase domain mutation in chronic myeloid leukaemia.",
"journal": "Journal of clinical pathology",
"date": "2008",
"authors": "Khorashad JS, Thelwell N, Milojkovic D, Marin D, Watson JA, Goldman JM, Apperley JF, Foroni L, Reid AG",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "18587017",
"url": "https://glygen.org/publication/PubMed/18587017"
}
]
},
{
"title": "Kinase domain point mutations in Philadelphia chromosome-positive acute lymphoblastic leukemia emerge after therapy with BCR-ABL kinase inhibitors.",
"journal": "Cancer",
"date": "2008",
"authors": "Jones D, Thomas D, Yin CC, O'Brien S, Cortes JE, Jabbour E, Breeden M, Giles FJ, Zhao W, Kantarjian HM",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "18615627",
"url": "https://glygen.org/publication/PubMed/18615627"
}
]
},
{
"title": "Regulation of Chk2 ubiquitination and signaling through autophosphorylation of serine 379.",
"journal": "Molecular and cellular biology",
"date": "2008",
"authors": "Lovly CM, Yan L, Ryan CE, Takada S, Piwnica-Worms H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "18644861",
"url": "https://glygen.org/publication/PubMed/18644861"
}
]
},
{
"title": "A quantitative atlas of mitotic phosphorylation.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2008",
"authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "iPTMnet",
"id": "P00519-1",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519-1"
}
],
"reference": [
{
"type": "PubMed",
"id": "18669648",
"url": "https://glygen.org/publication/PubMed/18669648"
}
]
},
{
"title": "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.",
"journal": "Molecular cell",
"date": "2008",
"authors": "Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "iPTMnet",
"id": "P00519-1",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519-1"
}
],
"reference": [
{
"type": "PubMed",
"id": "18691976",
"url": "https://glygen.org/publication/PubMed/18691976"
}
]
},
{
"title": "A regulatory circuit controlling Itch-mediated p73 degradation by Runx.",
"journal": "The Journal of biological chemistry",
"date": "2008",
"authors": "Levy D, Reuven N, Shaul Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8939236",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236"
}
],
"reference": [
{
"type": "PubMed",
"id": "18701449",
"url": "https://glygen.org/publication/PubMed/18701449"
}
]
},
{
"title": "Immobilized metal affinity chromatography revisited: pH/acid control toward high selectivity in phosphoproteomics.",
"journal": "Journal of proteome research",
"date": "2008",
"authors": "Tsai CF, Wang YT, Chen YR, Lai CY, Lin PY, Pan KT, Chen JY, Khoo KH, Chen YJ",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519-1",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519-1"
}
],
"reference": [
{
"type": "PubMed",
"id": "18707149",
"url": "https://glygen.org/publication/PubMed/18707149"
}
]
},
{
"title": "Phosphorylation of p27Kip1 regulates assembly and activation of cyclin D1-Cdk4.",
"journal": "Molecular and cellular biology",
"date": "2008",
"authors": "Larrea MD, Liang J, Da Silva T, Hong F, Shao SH, Han K, Dumont D, Slingerland JM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "18710949",
"url": "https://glygen.org/publication/PubMed/18710949"
}
]
},
{
"title": "BCR/ABL and other kinases from chronic myeloproliferative disorders stimulate single-strand annealing, an unfaithful DNA double-strand break repair.",
"journal": "Cancer research",
"date": "2008",
"authors": "Cramer K, Nieborowska-Skorska M, Koptyra M, Slupianek A, Penserga ET, Eaves CJ, Aulitzky W, Skorski T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5685938",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685938"
}
],
"reference": [
{
"type": "PubMed",
"id": "18757400",
"url": "https://glygen.org/publication/PubMed/18757400"
}
]
},
{
"title": "Abl tyrosine kinase inhibitors for overriding Bcr-Abl/T315I: from the second to third generation.",
"journal": "Expert review of anticancer therapy",
"date": "2008",
"authors": "Tanaka R, Kimura S",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "18759691",
"url": "https://glygen.org/publication/PubMed/18759691"
}
]
},
{
"title": "Tyrosine phosphorylation in the SH3 domain disrupts negative regulatory interactions within the c-Abl kinase core.",
"journal": "Journal of molecular biology",
"date": "2008",
"authors": "Chen S, O'Reilly LP, Smithgall TE, Engen JR",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "18775435",
"url": "https://glygen.org/publication/PubMed/18775435"
}
]
},
{
"title": "TTK/Mps1 controls nuclear targeting of c-Abl by 14-3-3-coupled phosphorylation in response to oxidative stress.",
"journal": "Oncogene",
"date": "2008",
"authors": "Nihira K, Taira N, Miki Y, Yoshida K",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "18794806",
"url": "https://glygen.org/publication/PubMed/18794806"
}
]
},
{
"title": "Characteristics and outcome of chronic myeloid leukemia patients with F317L BCR-ABL kinase domain mutation after therapy with tyrosine kinase inhibitors.",
"journal": "Blood",
"date": "2008",
"authors": "Jabbour E, Kantarjian HM, Jones D, Reddy N, O'Brien S, Garcia-Manero G, Burger J, Cortes J",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "18818391",
"url": "https://glygen.org/publication/PubMed/18818391"
}
]
},
{
"title": "Migratory localization of cyclin D2-Cdk4 complex suggests a spatial regulation of the G1-S transition.",
"journal": "Cell structure and function",
"date": "2008",
"authors": "Wang Z, Xie Y, Zhang L, Zhang H, An X, Wang T, Meng A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "18827403",
"url": "https://glygen.org/publication/PubMed/18827403"
}
]
},
{
"title": "Abl kinases regulate autophagy by promoting the trafficking and function of lysosomal components.",
"journal": "The Journal of biological chemistry",
"date": "2008-12-19",
"authors": "Yogalingam Gouri, Pendergast Ann Marie",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "18945674",
"url": "https://glygen.org/publication/PubMed/18945674"
}
]
},
{
"title": "NFBD1/MDC1, 53BP1 and BRCA1 have both redundant and unique roles in the ATM pathway.",
"journal": "Cell cycle (Georgetown, Tex.)",
"date": "2008",
"authors": "Wilson KA, Stern DF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "19001859",
"url": "https://glygen.org/publication/PubMed/19001859"
}
]
},
{
"title": "p27Kip1 inhibits cyclin D-cyclin-dependent kinase 4 by two independent modes.",
"journal": "Molecular and cellular biology",
"date": "2009",
"authors": "Ray A, James MK, Larochelle S, Fisher RP, Blain SW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "19075005",
"url": "https://glygen.org/publication/PubMed/19075005"
}
]
},
{
"title": "WSTF regulates the H2A.X DNA damage response via a novel tyrosine kinase activity.",
"journal": "Nature",
"date": "2009",
"authors": "Xiao A, Li H, Shechter D, Ahn SH, Fabrizio LA, Erdjument-Bromage H, Ishibe-Murakami S, Wang B, Tempst P, Hofmann K, Patel DJ, Elledge SJ, Allis CD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "19092802",
"url": "https://glygen.org/publication/PubMed/19092802"
}
]
},
{
"title": "BRCA1-associated protein 1 interferes with BRCA1/BARD1 RING heterodimer activity.",
"journal": "Cancer research",
"date": "2009",
"authors": "Nishikawa H, Wu W, Koike A, Kojima R, Gomi H, Fukuda M, Ohta T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "19117993",
"url": "https://glygen.org/publication/PubMed/19117993"
}
]
},
{
"title": "Protein phosphatase 5 regulates the function of 53BP1 after neocarzinostatin-induced DNA damage.",
"journal": "The Journal of biological chemistry",
"date": "2009",
"authors": "Kang Y, Lee JH, Hoan NN, Sohn HM, Chang IY, You HJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "19176521",
"url": "https://glygen.org/publication/PubMed/19176521"
}
]
},
{
"title": "The RIDDLE syndrome protein mediates a ubiquitin-dependent signaling cascade at sites of DNA damage.",
"journal": "Cell",
"date": "2009",
"authors": "Stewart GS, Panier S, Townsend K, Al-Hakim AK, Kolas NK, Miller ES, Nakada S, Ylanko J, Olivarius S, Mendez M, Oldreive C, Wildenhain J, Tagliaferro A, Pelletier L, Taubenheim N, Durandy A, Byrd PJ, Stankovic T, Taylor AM, Durocher D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "19203578",
"url": "https://glygen.org/publication/PubMed/19203578"
}
]
},
{
"title": "RNF168 binds and amplifies ubiquitin conjugates on damaged chromosomes to allow accumulation of repair proteins.",
"journal": "Cell",
"date": "2009",
"authors": "Doil C, Mailand N, Bekker-Jensen S, Menard P, Larsen DH, Pepperkok R, Ellenberg J, Panier S, Durocher D, Bartek J, Lukas J, Lukas C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "19203579",
"url": "https://glygen.org/publication/PubMed/19203579"
}
]
},
{
"title": "Tyrosine dephosphorylation of H2AX modulates apoptosis and survival decisions.",
"journal": "Nature",
"date": "2009",
"authors": "Cook PJ, Ju BG, Telese F, Wang X, Glass CK, Rosenfeld MG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "19234442",
"url": "https://glygen.org/publication/PubMed/19234442"
}
]
},
{
"title": "Triptolide inhibits Bcr-Abl transcription and induces apoptosis in STI571-resistant chronic myelogenous leukemia cells harboring T315I mutation.",
"journal": "Clinical cancer research : an official journal of the American Association for Cancer Research",
"date": "2009",
"authors": "Shi X, Jin Y, Cheng C, Zhang H, Zou W, Zheng Q, Lu Z, Chen Q, Lai Y, Pan J",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "19240172",
"url": "https://glygen.org/publication/PubMed/19240172"
}
]
},
{
"title": "NBA1, a new player in the Brca1 A complex, is required for DNA damage resistance and checkpoint control.",
"journal": "Genes & development",
"date": "2009",
"authors": "Wang B, Hurov K, Hofmann K, Elledge SJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "19261749",
"url": "https://glygen.org/publication/PubMed/19261749"
}
]
},
{
"title": "Lnk inhibits myeloproliferative disorder-associated JAK2 mutant, JAK2V617F.",
"journal": "Journal of leukocyte biology",
"date": "2009",
"authors": "Gery S, Cao Q, Gueller S, Xing H, Tefferi A, Koeffler HP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231"
}
],
"reference": [
{
"type": "PubMed",
"id": "19293402",
"url": "https://glygen.org/publication/PubMed/19293402"
}
]
},
{
"title": "Inhibitory effects of omacetaxine on leukemic stem cells and BCR-ABL-induced chronic myeloid leukemia and acute lymphoblastic leukemia in mice.",
"journal": "Leukemia",
"date": "2009",
"authors": "Chen Y, Hu Y, Michaels S, Segal D, Brown D, Li S",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "19322212",
"url": "https://glygen.org/publication/PubMed/19322212"
}
]
},
{
"title": "Dephosphorylation of the C-terminal tyrosyl residue of the DNA damage-related histone H2A.X is mediated by the protein phosphatase eyes absent.",
"journal": "The Journal of biological chemistry",
"date": "2009",
"authors": "Krishnan N, Jeong DG, Jung SK, Ryu SE, Xiao A, Allis CD, Kim SJ, Tonks NK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "19351884",
"url": "https://glygen.org/publication/PubMed/19351884"
}
]
},
{
"title": "Large-scale proteomics analysis of the human kinome.",
"journal": "Molecular & cellular proteomics : MCP",
"date": "2009",
"authors": "Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "19369195",
"url": "https://glygen.org/publication/PubMed/19369195"
}
]
},
{
"title": "Presence of a new BCR-ABL kinase domain mutation, C330G in an imatinib naive patient with chronic myeloid leukemia: very low prevalence of BCR-ABL kinase domain mutations in patients with chronic myeloid leukemia from eastern India.",
"journal": "Leukemia & lymphoma",
"date": "2009",
"authors": "Kuila N, Dash N, Sahoo DP, Pattnayak NC, Biswas G, Chakraborty S",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "19373669",
"url": "https://glygen.org/publication/PubMed/19373669"
}
]
},
{
"title": "NF-kappaB inhibition triggers death of imatinib-sensitive and imatinib-resistant chronic myeloid leukemia cells including T315I Bcr-Abl mutants.",
"journal": "International journal of cancer",
"date": "2009",
"authors": "Lounnas N, Frelin C, Gonthier N, Colosetti P, Sirvent A, Cassuto JP, Berthier F, Sirvent N, Rousselot P, Dreano M, Peyron JF, Imbert V",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "19378338",
"url": "https://glygen.org/publication/PubMed/19378338"
}
]
},
{
"title": "Unc119 protects from Shigella infection by inhibiting the Abl family kinases.",
"journal": "PLoS ONE",
"date": "2009",
"authors": "Vepachedu R, Karim Z, Patel O, Goplen N, Alam R",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "19381274",
"url": "https://glygen.org/publication/PubMed/19381274"
}
]
},
{
"title": "Repression of Runx2 by androgen receptor (AR) in osteoblasts and prostate cancer cells: AR binds Runx2 and abrogates its recruitment to DNA.",
"journal": "Molecular endocrinology (Baltimore, Md.)",
"date": "2009",
"authors": "Baniwal SK, Khalid O, Sir D, Buchanan G, Coetzee GA, Frenkel B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8940973",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8940973"
}
],
"reference": [
{
"type": "PubMed",
"id": "19389811",
"url": "https://glygen.org/publication/PubMed/19389811"
}
]
},
{
"title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.",
"journal": "Analytical chemistry",
"date": "2009",
"authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519-1",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519-1"
}
],
"reference": [
{
"type": "PubMed",
"id": "19413330",
"url": "https://glygen.org/publication/PubMed/19413330"
}
]
},
{
"title": "Combined inhibition of MEK and mammalian target of rapamycin abolishes phosphorylation of cyclin-dependent kinase 4 in glioblastoma cell lines and prevents their proliferation.",
"journal": "Cancer research",
"date": "2009",
"authors": "Paternot S, Roger PP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "19458076",
"url": "https://glygen.org/publication/PubMed/19458076"
}
]
},
{
"title": "Differential regulation of cyclin-dependent kinase 4 (CDK4) and CDK6, evidence that CDK4 might not be activated by CDK7, and design of a CDK6 activating mutation.",
"journal": "Molecular and cellular biology",
"date": "2009",
"authors": "Bockstaele L, Bisteau X, Paternot S, Roger PP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "19487459",
"url": "https://glygen.org/publication/PubMed/19487459"
}
]
},
{
"title": "Dasatinib in chronic myeloid leukemia: a review.",
"journal": "Therapeutics and clinical risk management",
"date": "2009",
"authors": "Aguilera DG, Tsimberidou AM",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "19536317",
"url": "https://glygen.org/publication/PubMed/19536317"
}
]
},
{
"title": "KW-2449, a novel multikinase inhibitor, suppresses the growth of leukemia cells with FLT3 mutations or T315I-mutated BCR/ABL translocation.",
"journal": "Blood",
"date": "2009",
"authors": "Shiotsu Y, Kiyoi H, Ishikawa Y, Tanizaki R, Shimizu M, Umehara H, Ishii K, Mori Y, Ozeki K, Minami Y, Abe A, Maeda H, Akiyama T, Kanda Y, Sato Y, Akinaga S, Naoe T",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "19541823",
"url": "https://glygen.org/publication/PubMed/19541823"
}
]
},
{
"title": "Nuclear localization of p38 MAPK in response to DNA damage.",
"journal": "International journal of biological sciences",
"date": "2009",
"authors": "Wood CD, Thornton TM, Sabio G, Davis RA, Rincon M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-525793",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-525793"
}
],
"reference": [
{
"type": "PubMed",
"id": "19564926",
"url": "https://glygen.org/publication/PubMed/19564926"
}
]
},
{
"title": "New SRC/ABL inhibitors for chronic myeloid leukemia therapy show selectivity for T315I ABL mutant CD34(+) cells.",
"journal": "Investigational new drugs",
"date": "2010",
"authors": "Santucci MA, Mancini M, Corradi V, Lacobucci I, Martinelli G, Botta M, Schenone S",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "19629392",
"url": "https://glygen.org/publication/PubMed/19629392"
}
]
},
{
"title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.",
"journal": "Molecular & cellular proteomics : MCP",
"date": "2009",
"authors": "Pan C, Olsen JV, Daub H, Mann M",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519-1",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519-1"
}
],
"reference": [
{
"type": "PubMed",
"id": "19651622",
"url": "https://glygen.org/publication/PubMed/19651622"
}
]
},
{
"title": "Chronic myeloid leukemia in the tyrosine kinase inhibitor era: what is the best therapy?",
"journal": "Current oncology reports",
"date": "2009",
"authors": "Quintas-Cardama A, Cortes J",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "19679008",
"url": "https://glygen.org/publication/PubMed/19679008"
}
]
},
{
"title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.",
"journal": "Science signaling",
"date": "2009",
"authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "19690332",
"url": "https://glygen.org/publication/PubMed/19690332"
}
]
},
{
"title": "Targeting autophagy: a novel anticancer strategy with therapeutic implications for imatinib resistance.",
"journal": "Biologics : targets & therapy",
"date": "2008",
"authors": "Carew JS, Nawrocki ST, Giles FJ, Cleveland JL",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "19707354",
"url": "https://glygen.org/publication/PubMed/19707354"
}
]
},
{
"title": "Cdc42 regulates Fc gamma receptor-mediated phagocytosis through the activation and phosphorylation of Wiskott-Aldrich syndrome protein (WASP) and neural-WASP.",
"journal": "Molecular biology of the cell",
"date": "2009",
"authors": "Park H, Cox D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "19741094",
"url": "https://glygen.org/publication/PubMed/19741094"
}
]
},
{
"title": "Dynamic change of T315I BCR-ABL kinase domain mutation in Korean chronic myeloid leukaemia patients during treatment with Abl tyrosine kinase inhibitors.",
"journal": "Hematological oncology",
"date": "2010",
"authors": "Kim WS, Kim D, Kim DW, Kweon IY, Kim SH, Goh HG, Park SH, Lee J",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "19768693",
"url": "https://glygen.org/publication/PubMed/19768693"
}
]
},
{
"title": "Structure and activation mechanism of the CHK2 DNA damage checkpoint kinase.",
"journal": "Molecular cell",
"date": "2009",
"authors": "Cai Z, Chehab NH, Pavletich NP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "19782031",
"url": "https://glygen.org/publication/PubMed/19782031"
}
]
},
{
"title": "Identification and functional characterization of ERK/MAPK phosphorylation sites in the Runx2 transcription factor.",
"journal": "The Journal of biological chemistry",
"date": "2009",
"authors": "Ge C, Xiao G, Jiang D, Yang Q, Hatch NE, Roca H, Franceschi RT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8940973",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8940973"
}
],
"reference": [
{
"type": "PubMed",
"id": "19801668",
"url": "https://glygen.org/publication/PubMed/19801668"
}
]
},
{
"title": "Major molecular response achieved with dasatinib in a CML patient with F317L BCR-ABL kinase domain mutation.",
"journal": "Leukemia research",
"date": "2010",
"authors": "Faber E, Mojzikova R, Plachy R, Rozmanova S, Stastny M, Divoka M, Jarosova M, Indrak K, Divoky V",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "19811824",
"url": "https://glygen.org/publication/PubMed/19811824"
}
]
},
{
"title": "Epidemiologic study on survival of chronic myeloid leukemia and Ph(+) acute lymphoblastic leukemia patients with BCR-ABL T315I mutation.",
"journal": "Blood",
"date": "2009",
"authors": "Nicolini FE, Mauro MJ, Martinelli G, Kim DW, Soverini S, Muller MC, Hochhaus A, Cortes J, Chuah C, Dufva IH, Apperley JF, Yagasaki F, Pearson JD, Peter S, Sanz Rodriguez C, Preudhomme C, Giles F, Goldman JM, Zhou W",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "19843886",
"url": "https://glygen.org/publication/PubMed/19843886"
}
]
},
{
"title": "AP24534, a pan-BCR-ABL inhibitor for chronic myeloid leukemia, potently inhibits the T315I mutant and overcomes mutation-based resistance.",
"journal": "Cancer cell",
"date": "2009",
"authors": "O'Hare T, Shakespeare WC, Zhu X, Eide CA, Rivera VM, Wang F, Adrian LT, Zhou T, Huang WS, Xu Q, Metcalf CA 3rd, Tyner JW, Loriaux MM, Corbin AS, Wardwell S, Ning Y, Keats JA, Wang Y, Sundaramoorthi R, Thomas M, Zhou D, Snodgrass J, Commodore L, Sawyer TK, Dalgarno DC, Deininger MW, Druker BJ, Clackson T",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "19878872",
"url": "https://glygen.org/publication/PubMed/19878872"
}
]
},
{
"title": "Cbl-associated protein is tyrosine phosphorylated by c-Abl and c-Src kinases.",
"journal": "BMC cell biology",
"date": "2009",
"authors": "Fernow I, Tomasovic A, Siehoff-Icking A, Tikkanen R",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "19891780",
"url": "https://glygen.org/publication/PubMed/19891780"
}
]
},
{
"title": "Multiple myeloma phosphotyrosine proteomic profile associated with FGFR3 expression, ligand activation, and drug inhibition.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2009",
"authors": "St-Germain JR, Taylor P, Tong J, Jin LL, Nikolic A, Stewart II, Ewing RM, Dharsee M, Li Z, Trudel S, Moran MF",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519-1",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519-1"
}
],
"reference": [
{
"type": "PubMed",
"id": "19901323",
"url": "https://glygen.org/publication/PubMed/19901323"
}
]
},
{
"title": "Role of interfacial water molecules in proline-rich ligand recognition by the Src homology 3 domain of Abl.",
"journal": "J. Biol. Chem.",
"date": "2010",
"authors": "Palencia Andres, Camara-Artigas Ana, Pisabarro M Teresa, Martinez Jose C, Luque Irene",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "19906645",
"url": "https://glygen.org/publication/PubMed/19906645"
}
]
},
{
"title": "A Cdc42 activation cycle coordinated by PI 3-kinase during Fc receptor-mediated phagocytosis.",
"journal": "Molecular biology of the cell",
"date": "2010",
"authors": "Beemiller P, Zhang Y, Mohan S, Levinsohn E, Gaeta I, Hoppe AD, Swanson JA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "19955216",
"url": "https://glygen.org/publication/PubMed/19955216"
}
]
},
{
"title": "New targets for Ph+ leukaemia therapy.",
"journal": "Best practice & research. Clinical haematology",
"date": "2009",
"authors": "Martinelli G, Iacobucci I, Papayannidis C, Soverini S",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "19959093",
"url": "https://glygen.org/publication/PubMed/19959093"
}
]
},
{
"title": "Frequency of BCR-ABL gene mutations in Polish patients with chronic myeloid leukemia treated with imatinib: a final report of the MAPTEST study.",
"journal": "Polskie Archiwum Medycyny Wewnetrznej",
"date": "2009",
"authors": "Lewandowski K, Warzocha K, Hellmann A, Skotnicki A, Prejzner W, Foryciarz K, Sacha T, Gniot M, Majewski M, Solarska I, Nowak G, Wasag B, Kobelski M, Scibiorski C, Siemiatkowski M, Lewandowska M, Komarnicki M",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "20010464",
"url": "https://glygen.org/publication/PubMed/20010464"
}
]
},
{
"title": "Mammalian SUMO E3-ligases PIAS1 and PIAS4 promote responses to DNA double-strand breaks.",
"journal": "Nature",
"date": "2009",
"authors": "Galanty Y, Belotserkovskaya R, Coates J, Polo S, Miller KM, Jackson SP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "20016603",
"url": "https://glygen.org/publication/PubMed/20016603"
}
]
},
{
"title": "HERC2 coordinates ubiquitin-dependent assembly of DNA repair factors on damaged chromosomes.",
"journal": "Nature cell biology",
"date": "2010",
"authors": "Bekker-Jensen S, Rendtlew Danielsen J, Fugger K, Gromova I, Nerstedt A, Lukas C, Bartek J, Lukas J, Mailand N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "20023648",
"url": "https://glygen.org/publication/PubMed/20023648"
}
]
},
{
"title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.",
"journal": "Science signaling",
"date": "2010",
"authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519-1",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519-1"
}
],
"reference": [
{
"type": "PubMed",
"id": "20068231",
"url": "https://glygen.org/publication/PubMed/20068231"
}
]
},
{
"title": "Rb inactivation in cell cycle and cancer: the puzzle of highly regulated activating phosphorylation of CDK4 versus constitutively active CDK-activating kinase.",
"journal": "Cell cycle (Georgetown, Tex.)",
"date": "2010",
"authors": "Paternot S, Bockstaele L, Bisteau X, Kooken H, Coulonval K, Roger PP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "20107323",
"url": "https://glygen.org/publication/PubMed/20107323"
}
]
},
{
"title": "N-cadherin ligation, but not Sonic hedgehog binding, initiates Cdo-dependent p38alpha/beta MAPK signaling in skeletal myoblasts.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2010",
"authors": "Lu M, Krauss RS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-525793",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-525793"
}
],
"reference": [
{
"type": "PubMed",
"id": "20160094",
"url": "https://glygen.org/publication/PubMed/20160094"
}
]
},
{
"title": "New opportunities to treat the T315I-Bcr-Abl mutant in chronic myeloid leukaemia: tyrosine kinase inhibitors and molecules that act by alternative mechanisms.",
"journal": "Current medicinal chemistry",
"date": "2010",
"authors": "Schenone S, Brullo C, Botta M",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "20166937",
"url": "https://glygen.org/publication/PubMed/20166937"
}
]
},
{
"title": "Bortezomib decreases Rb phosphorylation and induces caspase-dependent apoptosis in Imatinib-sensitive and -resistant Bcr-Abl1-expressing cells.",
"journal": "Oncogene",
"date": "2010",
"authors": "Albero MP, Vaquer JM, Andreu EJ, Villanueva JJ, Franch L, Ivorra C, Poch E, Agirre X, Prosper F, Perez-Roger I",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "20305692",
"url": "https://glygen.org/publication/PubMed/20305692"
}
]
},
{
"title": "The UBXN1 protein associates with autoubiquitinated forms of the BRCA1 tumor suppressor and inhibits its enzymatic function.",
"journal": "Molecular and cellular biology",
"date": "2010",
"authors": "Wu-Baer F, Ludwig T, Baer R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "20351172",
"url": "https://glygen.org/publication/PubMed/20351172"
}
]
},
{
"title": "A potent and highly specific FN3 monobody inhibitor of the Abl SH2 domain.",
"journal": "Nature structural & molecular biology",
"date": "2010-04",
"authors": "Wojcik John, Hantschel Oliver, Grebien Florian, Kaupe Ines, Bennett Keiryn L, Barkinge John, Jones Richard B, Koide Akiko, Superti-Furga Giulio, Koide Shohei",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "20357770",
"url": "https://glygen.org/publication/PubMed/20357770"
}
]
},
{
"title": "c-Abl, Lamellipodin, and Ena/VASP proteins cooperate in dorsal ruffling of fibroblasts and axonal morphogenesis.",
"journal": "Current biology : CB",
"date": "2010",
"authors": "Michael M, Vehlow A, Navarro C, Krause M",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "20417104",
"url": "https://glygen.org/publication/PubMed/20417104"
}
]
},
{
"title": "A T315I mutation in e19a2 BCR/ABL1 chronic myeloid leukemia responding to dasatinib.",
"journal": "Leukemia research",
"date": "2010",
"authors": "Cea M, Cirmena G, Garuti A, Rocco I, Palermo C, Cagnetta A, Moran E, Colombo N, Grasso R, Fugazza G, Gobbi M, Nencioni A, Ballestrero A, Patrone F",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "20447687",
"url": "https://glygen.org/publication/PubMed/20447687"
}
]
},
{
"title": "Pristimerin induces apoptosis in imatinib-resistant chronic myelogenous leukemia cells harboring T315I mutation by blocking NF-kappaB signaling and depleting Bcr-Abl.",
"journal": "Molecular cancer",
"date": "2010",
"authors": "Lu Z, Jin Y, Chen C, Li J, Cao Q, Pan J",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "20482842",
"url": "https://glygen.org/publication/PubMed/20482842"
}
]
},
{
"title": "Rapid and sensitive allele-specific (AS)-RT-PCR assay for detection of T315I mutation in chronic myeloid leukemia patients treated with tyrosine-kinase inhibitors.",
"journal": "Clinical and experimental medicine",
"date": "2011",
"authors": "Manrique Arechavaleta G, Scholl V, Perez V, Bittencourt R, Moellmann A, Hassan R, Seuanez HN, Dobbin J, Martinez L, Renault IZ, Uriarte R",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "20512393",
"url": "https://glygen.org/publication/PubMed/20512393"
}
]
},
{
"title": "Regulation of mouse steroidogenesis by WHISTLE and JMJD1C through histone methylation balance.",
"journal": "Nucleic acids research",
"date": "2010",
"authors": "Kim SM, Kim JY, Choe NW, Cho IH, Kim JR, Kim DW, Seol JE, Lee SE, Kook H, Nam KI, Kook H, Bhak YY, Seo SB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231"
}
],
"reference": [
{
"type": "PubMed",
"id": "20530532",
"url": "https://glygen.org/publication/PubMed/20530532"
}
]
},
{
"title": "Stem cell transplantation for patients with chronic myeloid leukemia resistant to tyrosine kinase inhibitors with BCR-ABL kinase domain mutation T315I.",
"journal": "Cancer",
"date": "2010",
"authors": "Velev N, Cortes J, Champlin R, Jones D, Rondon G, Giralt S, Borthakur G, Kantarjian HM, De Lima M",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "20564073",
"url": "https://glygen.org/publication/PubMed/20564073"
}
]
},
{
"title": "Mutation-specific control of BCR-ABL T315I positive leukemia with a recombinant yeast-based therapeutic vaccine in a murine model.",
"journal": "Vaccine",
"date": "2010",
"authors": "Bui MR, Hodson V, King T, Leopold D, Dai S, Fiolkoski V, Oakes S, Duke R, Apelian D, Franzusoff A, DeGregori J",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "20619375",
"url": "https://glygen.org/publication/PubMed/20619375"
}
]
},
{
"title": "Regulation of immune cell homeostasis by type I interferons.",
"journal": "Cytokine & growth factor reviews",
"date": "2010",
"authors": "Mattei F, Schiavoni G, Tough DF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231"
}
],
"reference": [
{
"type": "PubMed",
"id": "20627800",
"url": "https://glygen.org/publication/PubMed/20627800"
}
]
},
{
"title": "B55alpha PP2A holoenzymes modulate the phosphorylation status of the retinoblastoma-related protein p107 and its activation.",
"journal": "The Journal of biological chemistry",
"date": "2010",
"authors": "Jayadeva G, Kurimchak A, Garriga J, Sotillo E, Davis AJ, Haines DS, Mumby M, Grana X",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "20663872",
"url": "https://glygen.org/publication/PubMed/20663872"
}
]
},
{
"title": "Diverse somatic mutation patterns and pathway alterations in human cancers.",
"journal": "Nature",
"date": "2010",
"authors": "Kan Z, Jaiswal BS, Stinson J, Janakiraman V, Bhatt D, Stern HM, Yue P, Haverty PM, Bourgon R, Zheng J, Moorhead M, Chaudhuri S, Tomsho LP, Peters BA, Pujara K, Cordes S, Davis DP, Carlton VE, Yuan W, Li L, Wang W, Eigenbrot C, Kaminker JS, Eberhard DA, Waring P, Schuster SC, Modrusan Z, Zhang Z, Stokoe D, de Sauvage FJ, Faham M, Seshagiri S",
"evidence": [
{
"database": "dbSNP",
"id": "rs775748939",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775748939"
}
],
"reference": [
{
"type": "PubMed",
"id": "20668451",
"url": "https://glygen.org/publication/PubMed/20668451"
}
]
},
{
"title": "Longitudinal studies of SRC family kinases in imatinib- and dasatinib-resistant chronic myelogenous leukemia patients.",
"journal": "Leukemia research",
"date": "2011",
"authors": "Hayette S, Chabane K, Michallet M, Michallat E, Cony-Makhoul P, Salesse S, Maguer-Satta V, Magaud JP, Nicolini FE",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "20673586",
"url": "https://glygen.org/publication/PubMed/20673586"
}
]
},
{
"title": "Rb regulates fate choice and lineage commitment in vivo.",
"journal": "Nature",
"date": "2010",
"authors": "Calo E, Quintero-Estades JA, Danielian PS, Nedelcu S, Berman SD, Lees JA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8940973",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8940973"
}
],
"reference": [
{
"type": "PubMed",
"id": "20686481",
"url": "https://glygen.org/publication/PubMed/20686481"
}
]
},
{
"title": "ABL tyrosine kinases: evolution of function, regulation, and specificity.",
"journal": "Sci. Signal.",
"date": "2010",
"authors": "Colicelli John",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "20841568",
"url": "https://glygen.org/publication/PubMed/20841568"
}
]
},
{
"title": "Structural and functional analysis of cyclin D1 reveals p27 and substrate inhibitor binding requirements.",
"journal": "ACS chemical biology",
"date": "2010",
"authors": "Liu S, Bolger JK, Kirkland LO, Premnath PN, McInnes C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "20843055",
"url": "https://glygen.org/publication/PubMed/20843055"
}
]
},
{
"title": "Abl tyrosine kinase phosphorylates nonmuscle Myosin light chain kinase to regulate endothelial barrier function.",
"journal": "Mol. Biol. Cell",
"date": "2010",
"authors": "Dudek SM, Chiang ET, Camp SM, Guo Y, Zhao J, Brown ME, Singleton PA, Wang L, Desai A, Arce FT, Lal R, Van Eyk JE, Imam SZ, Garcia JG",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "20861316",
"url": "https://glygen.org/publication/PubMed/20861316"
}
]
},
{
"title": "Maf promotes osteoblast differentiation in mice by mediating the age-related switch in mesenchymal cell differentiation.",
"journal": "The Journal of clinical investigation",
"date": "2010",
"authors": "Nishikawa K, Nakashima T, Takeda S, Isogai M, Hamada M, Kimura A, Kodama T, Yamaguchi A, Owen MJ, Takahashi S, Takayanagi H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8940973",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8940973"
}
],
"reference": [
{
"type": "PubMed",
"id": "20877012",
"url": "https://glygen.org/publication/PubMed/20877012"
}
]
},
{
"title": "Combinatorial transcriptional control in blood stem/progenitor cells: genome-wide analysis of ten major transcriptional regulators.",
"journal": "Cell stem cell",
"date": "2010",
"authors": "Wilson NK, Foster SD, Wang X, Knezevic K, Schutte J, Kaimakis P, Chilarska PM, Kinston S, Ouwehand WH, Dzierzak E, Pimanda JE, de Bruijn MF, Gottgens B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8939236",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236"
}
],
"reference": [
{
"type": "PubMed",
"id": "20887958",
"url": "https://glygen.org/publication/PubMed/20887958"
}
]
},
{
"title": "Extensive analysis of the T315I substitution and detection of additional ABL mutations in progenitors and primitive stem cell compartment in a patient with tyrosine kinase inhibitor-resistant chronic myeloid leukemia.",
"journal": "Leukemia & lymphoma",
"date": "2010",
"authors": "Chomel JC, Sorel N, Bonnet ML, Bertrand A, Brizard F, Roy L, Guilhot F, Turhan AG",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "20929330",
"url": "https://glygen.org/publication/PubMed/20929330"
}
]
},
{
"title": "p57Kip2 is a downstream effector of BCR-ABL kinase inhibitors in chronic myelogenous leukemia cells.",
"journal": "Carcinogenesis",
"date": "2011",
"authors": "Borriello A, Caldarelli I, Bencivenga D, Cucciolla V, Oliva A, Usala E, Danise P, Ronzoni L, Perrotta S, Della Ragione F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "20952511",
"url": "https://glygen.org/publication/PubMed/20952511"
}
]
},
{
"title": "Expanded distribution of the T315I mutation among hematopoietic stem cells and progenitors in a chronic myeloid leukemia patient during imatinib treatment.",
"journal": "International journal of hematology",
"date": "2010",
"authors": "Minami Y, Kajiguchi T, Abe A, Ohno T, Kiyoi H, Naoe T",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "20963643",
"url": "https://glygen.org/publication/PubMed/20963643"
}
]
},
{
"title": "The durable clearance of the T315I BCR-ABL mutated clone in chronic phase chronic myelogenous leukemia patients on omacetaxine allows tyrosine kinase inhibitor rechallenge.",
"journal": "Clinical lymphoma, myeloma & leukemia",
"date": "2010",
"authors": "Nicolini FE, Chomel JC, Roy L, Legros L, Chabane K, Ducastelle S, Nicolas-Virelizier E, Michallet M, Tigaud I, Magaud JP, Turhan A, Guilhot F, Hayette S",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "21030353",
"url": "https://glygen.org/publication/PubMed/21030353"
}
]
},
{
"title": "IgG1 is pathogenic in Leishmania mexicana infection.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "2010",
"authors": "Chu N, Thomas BN, Patel SR, Buxbaum LU",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9664422",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664422"
}
],
"reference": [
{
"type": "PubMed",
"id": "21037092",
"url": "https://glygen.org/publication/PubMed/21037092"
}
]
},
{
"title": "Carboxyamidotriazole inhibits cell growth of imatinib-resistant chronic myeloid leukaemia cells including T315I Bcr-Abl mutant by a redox-mediated mechanism.",
"journal": "Cancer letters",
"date": "2011",
"authors": "Corrado C, Raimondo S, Flugy AM, Fontana S, Santoro A, Stassi G, Marfia A, Iovino F, Arlinghaus R, Kohn EC, Leo GD, Alessandro R",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "21041018",
"url": "https://glygen.org/publication/PubMed/21041018"
}
]
},
{
"title": "The novel Aurora A kinase inhibitor MLN8237 is active in resistant chronic myeloid leukaemia and significantly increases the efficacy of nilotinib.",
"journal": "Journal of cellular and molecular medicine",
"date": "2011",
"authors": "Kelly KR, Ecsedy J, Medina E, Mahalingam D, Padmanabhan S, Nawrocki ST, Giles FJ, Carew JS",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "21091633",
"url": "https://glygen.org/publication/PubMed/21091633"
}
]
},
{
"title": "Zfp521 controls bone mass by HDAC3-dependent attenuation of Runx2 activity.",
"journal": "The Journal of cell biology",
"date": "2010",
"authors": "Hesse E, Saito H, Kiviranta R, Correa D, Yamana K, Neff L, Toben D, Duda G, Atfi A, Geoffroy V, Horne WC, Baron R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8940973",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8940973"
}
],
"reference": [
{
"type": "PubMed",
"id": "21173110",
"url": "https://glygen.org/publication/PubMed/21173110"
}
]
},
{
"title": "NBA1/MERIT40 and BRE interaction is required for the integrity of two distinct deubiquitinating enzyme BRCC36-containing complexes.",
"journal": "The Journal of biological chemistry",
"date": "2011",
"authors": "Hu X, Kim JA, Castillo A, Huang M, Liu J, Wang B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "21282113",
"url": "https://glygen.org/publication/PubMed/21282113"
}
]
},
{
"title": "MMSET regulates histone H4K20 methylation and 53BP1 accumulation at DNA damage sites.",
"journal": "Nature",
"date": "2011",
"authors": "Pei H, Zhang L, Luo K, Qin Y, Chesi M, Fei F, Bergsagel PL, Wang L, You Z, Lou Z",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "21293379",
"url": "https://glygen.org/publication/PubMed/21293379"
}
]
},
{
"title": "ERK-MAPK drives lamellipodia protrusion by activating the WAVE2 regulatory complex.",
"journal": "Molecular cell",
"date": "2011",
"authors": "Mendoza MC, Er EE, Zhang W, Ballif BA, Elliott HL, Danuser G, Blenis J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "21419341",
"url": "https://glygen.org/publication/PubMed/21419341"
}
]
},
{
"title": "Phosphorylation of p27Kip1 by JAK2 directly links cytokine receptor signaling to cell cycle control.",
"journal": "Oncogene",
"date": "2011",
"authors": "Jakel H, Weinl C, Hengst L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "21423214",
"url": "https://glygen.org/publication/PubMed/21423214"
}
]
},
{
"title": "ABL1 fusion genes in hematological malignancies: a review.",
"journal": "European journal of haematology",
"date": "2011",
"authors": "De Braekeleer E, Douet-Guilbert N, Rowe D, Bown N, Morel F, Berthou C, Ferec C, De Braekeleer M",
"evidence": [
{
"database": "RefSeq",
"id": "NP_005148",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_005148"
}
],
"reference": [
{
"type": "PubMed",
"id": "21435002",
"url": "https://glygen.org/publication/PubMed/21435002"
}
]
},
{
"title": "A pyrosequencing-based test for detection and relative quantification of the BCR-ABL1 T315I point mutation.",
"journal": "Journal of clinical pathology",
"date": "2011",
"authors": "Schumacher JA, Szankasi P, Bahler DW, Ho AK, Kelley TW",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "21486895",
"url": "https://glygen.org/publication/PubMed/21486895"
}
]
},
{
"title": "Genome-wide analysis of simultaneous GATA1/2, RUNX1, FLI1, and SCL binding in megakaryocytes identifies hematopoietic regulators.",
"journal": "Developmental cell",
"date": "2011",
"authors": "Tijssen MR, Cvejic A, Joshi A, Hannah RL, Ferreira R, Forrai A, Bellissimo DC, Oram SH, Smethurst PA, Wilson NK, Wang X, Ottersbach K, Stemple DL, Green AR, Ouwehand WH, Gottgens B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8939236",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236"
}
],
"reference": [
{
"type": "PubMed",
"id": "21571218",
"url": "https://glygen.org/publication/PubMed/21571218"
}
]
},
{
"title": "Chronic myeloid leukemia patients with F317L BCR-ABL kinase domain mutation are resistant to dasatinib: is that true for all the patients?",
"journal": "Leukemia research",
"date": "2011",
"authors": "Eskazan AE, Soysal T, Erbilgin Y, Ozbek U, Ferhanoglu B",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "21605905",
"url": "https://glygen.org/publication/PubMed/21605905"
}
]
},
{
"title": "[Is AP24534 (Ponatinib) the next treatment of Philadelphia chromosome-positive acute lymphoblastic leukemia?].",
"journal": "Bulletin du cancer",
"date": "2011",
"authors": "Thomas X",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "21700550",
"url": "https://glygen.org/publication/PubMed/21700550"
}
]
},
{
"title": "Incomplete folding upon binding mediates Cdk4/cyclin D complex activation by tyrosine phosphorylation of inhibitor p27 protein.",
"journal": "The Journal of biological chemistry",
"date": "2011",
"authors": "Ou L, Ferreira AM, Otieno S, Xiao L, Bashford D, Kriwacki RW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "21715330",
"url": "https://glygen.org/publication/PubMed/21715330"
}
]
},
{
"title": "Tyrosine phosphorylation enhances RAD52-mediated annealing by modulating its DNA binding.",
"journal": "The EMBO journal",
"date": "2011",
"authors": "Honda M, Okuno Y, Yoo J, Ha T, Spies M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5685938",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685938"
}
],
"reference": [
{
"type": "PubMed",
"id": "21804533",
"url": "https://glygen.org/publication/PubMed/21804533"
}
]
},
{
"title": "Differential phosphorylation of c-Abl in cell cycle determined by cdc2 kinase and phosphatase activity.",
"journal": "Science",
"date": "1990",
"authors": "Kipreos ET, Wang JY",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "iPTMnet",
"id": "P00519-1",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519-1"
}
],
"reference": [
{
"type": "PubMed",
"id": "2183353",
"url": "https://glygen.org/publication/PubMed/2183353"
}
]
},
{
"title": "Mitochondrial GTP-AMP phosphotransferase. 2. Kinetic and equilibrium dialysis studies.",
"journal": "European journal of biochemistry",
"date": "1979",
"authors": "Tomasselli AG, Noda LH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231"
}
],
"reference": [
{
"type": "PubMed",
"id": "218813",
"url": "https://glygen.org/publication/PubMed/218813"
}
]
},
{
"title": "Acquisition of the novel ABL kinase domain mutation T315L in a relapsed Philadelphia-positive acute lymphoblastic leukemia patient.",
"journal": "Leukemia research",
"date": "2012",
"authors": "How GF, Muller MC, Lim LC",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "21899886",
"url": "https://glygen.org/publication/PubMed/21899886"
}
]
},
{
"title": "Additional chromosome abnormalities, BCR-ABL tyrosine kinase domain mutations and clinical outcome in Hungarian tyrosine kinase inhibitor-resistant chronic myelogenous leukemia patients.",
"journal": "Acta haematologica",
"date": "2012",
"authors": "Meggyesi N, Kozma A, Halm G, Nahajevszky S, Batai A, Fekete S, Barta A, Ujj G, Lueff S, Sipos A, Adam E, Bors A, Remenyi P, Masszi T, Tordai A, Andrikovics H",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "22005133",
"url": "https://glygen.org/publication/PubMed/22005133"
}
]
},
{
"title": "The ability of MLL to bind RUNX1 and methylate H3K4 at PU.1 regulatory regions is impaired by MDS/AML-associated RUNX1/AML1 mutations.",
"journal": "Blood",
"date": "2011",
"authors": "Huang G, Zhao X, Wang L, Elf S, Xu H, Zhao X, Sashida G, Zhang Y, Liu Y, Lee J, Menendez S, Yang Y, Yan X, Zhang P, Tenen DG, Osato M, Hsieh JJ, Nimer SD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8939236",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236"
}
],
"reference": [
{
"type": "PubMed",
"id": "22012064",
"url": "https://glygen.org/publication/PubMed/22012064"
}
]
},
{
"title": "Antileukemic effects of AMPK activators on BCR-ABL-expressing cells.",
"journal": "Blood",
"date": "2011",
"authors": "Vakana E, Altman JK, Glaser H, Donato NJ, Platanias LC",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "22021366",
"url": "https://glygen.org/publication/PubMed/22021366"
}
]
},
{
"title": "Structural mechanism of the phosphorylation-dependent dimerization of the MDC1 forkhead-associated domain.",
"journal": "Nucleic acids research",
"date": "2012",
"authors": "Liu J, Luo S, Zhao H, Liao J, Li J, Yang C, Xu B, Stern DF, Xu X, Ye K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "22234877",
"url": "https://glygen.org/publication/PubMed/22234877"
}
]
},
{
"title": "Successful treatment of a chronic-phase T-315I-mutated chronic myelogenous leukemia patient with a combination of imatinib and interferon-alfa.",
"journal": "International journal of hematology",
"date": "2012",
"authors": "Itonaga H, Tsushima H, Hata T, Matsuo E, Imanishi D, Imaizumi Y, Kawaguchi Y, Fukushima T, Doi Y, Mori S, Kamihira S, Tomonaga M, Miyazaki Y",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "22262141",
"url": "https://glygen.org/publication/PubMed/22262141"
}
]
},
{
"title": "Efficacy and safety of nilotinib in Japanese patients with imatinib-resistant or -intolerant Ph+ CML or relapsed/refractory Ph+ ALL: a 36-month analysis of a phase I and II study.",
"journal": "International journal of hematology",
"date": "2012",
"authors": "Usuki K, Tojo A, Maeda Y, Kobayashi Y, Matsuda A, Ohyashiki K, Nakaseko C, Kawaguchi T, Tanaka H, Miyamura K, Miyazaki Y, Okamoto S, Oritani K, Okada M, Usui N, Nagai T, Amagasaki T, Wanajo A, Naoe T",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "22359103",
"url": "https://glygen.org/publication/PubMed/22359103"
}
]
},
{
"title": "RNF8- and RNF168-dependent degradation of KDM4A/JMJD2A triggers 53BP1 recruitment to DNA damage sites.",
"journal": "The EMBO journal",
"date": "2012",
"authors": "Mallette FA, Mattiroli F, Cui G, Young LC, Hendzel MJ, Mer G, Sixma TK, Richard S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "22373579",
"url": "https://glygen.org/publication/PubMed/22373579"
}
]
},
{
"title": "Indirubin derivatives induce apoptosis of chronic myelogenous leukemia cells involving inhibition of Stat5 signaling.",
"journal": "Molecular oncology",
"date": "2012",
"authors": "Nam S, Scuto A, Yang F, Chen W, Park S, Yoo HS, Konig H, Bhatia R, Cheng X, Merz KH, Eisenbrand G, Jove R",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "22387217",
"url": "https://glygen.org/publication/PubMed/22387217"
}
]
},
{
"title": "Emerging therapies in chronic myeloid leukemia.",
"journal": "Current cancer drug targets",
"date": "2012",
"authors": "Gora-Tybor J",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "22483154",
"url": "https://glygen.org/publication/PubMed/22483154"
}
]
},
{
"title": "Structural and spectroscopic analysis of the kinase inhibitor bosutinib and an isomer of bosutinib binding to the Abl tyrosine kinase domain.",
"journal": "PloS one",
"date": "2012",
"authors": "Levinson NM, Boxer SG",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "22493660",
"url": "https://glygen.org/publication/PubMed/22493660"
}
]
},
{
"title": "DNA damage-inducible SUMOylation of HERC2 promotes RNF8 binding via a novel SUMO-binding Zinc finger.",
"journal": "The Journal of cell biology",
"date": "2012",
"authors": "Danielsen JR, Povlsen LK, Villumsen BH, Streicher W, Nilsson J, Wikstrom M, Bekker-Jensen S, Mailand N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "22508508",
"url": "https://glygen.org/publication/PubMed/22508508"
}
]
},
{
"title": "Molecular insights into the function of RING finger (RNF)-containing proteins hRNF8 and hRNF168 in Ubc13/Mms2-dependent ubiquitylation.",
"journal": "The Journal of biological chemistry",
"date": "2012",
"authors": "Campbell SJ, Edwards RA, Leung CC, Neculai D, Hodge CD, Dhe-Paganon S, Glover JN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "22589545",
"url": "https://glygen.org/publication/PubMed/22589545"
}
]
},
{
"title": "MK-0457, an Aurora kinase and BCR-ABL inhibitor, is active in patients with BCR-ABL T315I leukemia.",
"journal": "Leukemia",
"date": "2013",
"authors": "Giles FJ, Swords RT, Nagler A, Hochhaus A, Ottmann OG, Rizzieri DA, Talpaz M, Clark J, Watson P, Xiao A, Zhao B, Bergstrom D, Le Coutre PD, Freedman SJ, Cortes JE",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "22772060",
"url": "https://glygen.org/publication/PubMed/22772060"
}
]
},
{
"title": "Abl family kinases modulate T cell-mediated inflammation and chemokine-induced migration through the adaptor HEF1 and the GTPase Rap1.",
"journal": "Science signaling",
"date": "2012",
"authors": "Gu JJ, Lavau CP, Pugacheva E, Soderblom EJ, Moseley MA, Pendergast AM",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "22810897",
"url": "https://glygen.org/publication/PubMed/22810897"
}
]
},
{
"title": "Phase 2 study of subcutaneous omacetaxine mepesuccinate after TKI failure in patients with chronic-phase CML with T315I mutation.",
"journal": "Blood",
"date": "2012",
"authors": "Cortes J, Lipton JH, Rea D, Digumarti R, Chuah C, Nanda N, Benichou AC, Craig AR, Michallet M, Nicolini FE, Kantarjian H",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "22896000",
"url": "https://glygen.org/publication/PubMed/22896000"
}
]
},
{
"title": "Core transcriptional regulatory circuit controlled by the TAL1 complex in human T cell acute lymphoblastic leukemia.",
"journal": "Cancer cell",
"date": "2012",
"authors": "Sanda T, Lawton LN, Barrasa MI, Fan ZP, Kohlhammer H, Gutierrez A, Ma W, Tatarek J, Ahn Y, Kelliher MA, Jamieson CH, Staudt LM, Young RA, Look AT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8939236",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236"
}
],
"reference": [
{
"type": "PubMed",
"id": "22897851",
"url": "https://glygen.org/publication/PubMed/22897851"
}
]
},
{
"title": "Dual recognition of phosphoserine and phosphotyrosine in histone variant H2A.X by DNA damage response protein MCPH1.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2012",
"authors": "Singh N, Basnet H, Wiltshire TD, Mohammad DH, Thompson JR, Heroux A, Botuyan MV, Yaffe MB, Couch FJ, Rosenfeld MG, Mer G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "22908299",
"url": "https://glygen.org/publication/PubMed/22908299"
}
]
},
{
"title": "Mutated BCR-ABL generates immunogenic T-cell epitopes in CML patients.",
"journal": "Clinical cancer research : an official journal of the American Association for Cancer Research",
"date": "2012",
"authors": "Cai A, Keskin DB, DeLuca DS, Alonso A, Zhang W, Zhang GL, Hammond NN, Nardi V, Stone RM, Neuberg D, Sidney J, Brusic V, Wu CJ",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "22912393",
"url": "https://glygen.org/publication/PubMed/22912393"
}
]
},
{
"title": "RNF168 ubiquitinates K13-15 on H2A/H2AX to drive DNA damage signaling.",
"journal": "Cell",
"date": "2012",
"authors": "Mattiroli F, Vissers JH, van Dijk WJ, Ikpa P, Citterio E, Vermeulen W, Marteijn JA, Sixma TK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "22980979",
"url": "https://glygen.org/publication/PubMed/22980979"
}
]
},
{
"title": "Tyrosine phosphorylation of a SNARE protein, Syntaxin 17: Implications for membrane trafficking in the early secretory pathway.",
"journal": "Biochim. Biophys. Acta",
"date": "2012",
"authors": "Muppirala M, Gupta V, Swarup G",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "23006999",
"url": "https://glygen.org/publication/PubMed/23006999"
}
]
},
{
"title": "Tyrosine phosphorylation of the p21 cyclin-dependent kinase inhibitor facilitates the development of proneural glioma.",
"journal": "The Journal of biological chemistry",
"date": "2012",
"authors": "Hukkelhoven E, Liu Y, Yeh N, Ciznadija D, Blain SW, Koff A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "23007395",
"url": "https://glygen.org/publication/PubMed/23007395"
}
]
},
{
"title": "Systems-pharmacology dissection of a drug synergy in imatinib-resistant CML.",
"journal": "Nature chemical biology",
"date": "2012",
"authors": "Winter GE, Rix U, Carlson SM, Gleixner KV, Grebien F, Gridling M, Muller AC, Breitwieser FP, Bilban M, Colinge J, Valent P, Bennett KL, White FM, Superti-Furga G",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "23023260",
"url": "https://glygen.org/publication/PubMed/23023260"
}
]
},
{
"title": "The quantitative level of T315I mutated BCR-ABL predicts for major molecular response to second-line nilotinib or dasatinib treatment in patients with chronic myeloid leukemia.",
"journal": "Haematologica",
"date": "2013",
"authors": "Lange T, Ernst T, Gruber FX, Maier J, Cross M, Muller MC, Niederwieser D, Hochhaus A, Pfirrmann M",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "23065514",
"url": "https://glygen.org/publication/PubMed/23065514"
}
]
},
{
"title": "[Chronic myeloid leukemia and imatinib: Experience at the Lome Campus teaching hospital (Togo)].",
"journal": "Medecine et sante tropicales",
"date": "2012",
"authors": "Segbena AY, Kueviakoe IM, Agbetiafa K, Padaro E, Layibo Y, Dorkenoo A, Agbo YM, Bories D",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "23174189",
"url": "https://glygen.org/publication/PubMed/23174189"
}
]
},
{
"title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.",
"journal": "Journal of proteome research",
"date": "2013",
"authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "23186163",
"url": "https://glygen.org/publication/PubMed/23186163"
}
]
},
{
"title": "Clinical roundtable monograph: Emerging treatment options for TKI-resistant chronic myelogenous leukemia.",
"journal": "Clinical advances in hematology & oncology : H&O",
"date": "2012",
"authors": "Cortes J, Radich J, Mauro MJ",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "23187745",
"url": "https://glygen.org/publication/PubMed/23187745"
}
]
},
{
"title": "Biological effects of T315I-mutated BCR-ABL in an embryonic stem cell-derived hematopoiesis model.",
"journal": "Experimental hematology",
"date": "2013",
"authors": "Melkus M, Bennaceur-Griscelli A, Valogne Y, Flamant S, Chomel JC, Sorel N, Bonnet ML, Deininger MW, Mitjavila-Garcia MT, Turhan AG",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "23287417",
"url": "https://glygen.org/publication/PubMed/23287417"
}
]
},
{
"title": "Identification of GZD824 as an orally bioavailable inhibitor that targets phosphorylated and nonphosphorylated breakpoint cluster region-Abelson (Bcr-Abl) kinase and overcomes clinically acquired mutation-induced resistance against imatinib.",
"journal": "Journal of medicinal chemistry",
"date": "2013",
"authors": "Ren X, Pan X, Zhang Z, Wang D, Lu X, Li Y, Wen D, Long H, Luo J, Feng Y, Zhuang X, Zhang F, Liu J, Leng F, Lang X, Bai Y, She M, Tu Z, Pan J, Ding K",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "23301703",
"url": "https://glygen.org/publication/PubMed/23301703"
}
]
},
{
"title": "Evaluation of T315I mutation frequency in chronic myeloid leukemia patients after imatinib resistance.",
"journal": "Hematology (Amsterdam, Netherlands)",
"date": "2013",
"authors": "Chahardouli B, Zaker F, Mousavi SA, Kazemi A, Ostadali M, Nadali F, Rostami S, Alimoghaddam K, Ghavamzade A",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "23540562",
"url": "https://glygen.org/publication/PubMed/23540562"
}
]
},
{
"title": "[The different characteristics of ABL kinase domain mutation in the Chinese Han nationality imatinib resistant Philadelphia chromosome-positive acute lymphoblastic leukemia and chronic myeloid leukemia].",
"journal": "Zhonghua xue ye xue za zhi = Zhonghua xueyexue zazhi",
"date": "2013",
"authors": "Shen HJ, He J, Qiu QC, Cen JN, Pan JL, Yao L, Ding ZX, Chen Y, Chen ZX",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "23597459",
"url": "https://glygen.org/publication/PubMed/23597459"
}
]
},
{
"title": "A Cdk7-Cdk4 T-loop phosphorylation cascade promotes G1 progression.",
"journal": "Molecular cell",
"date": "2013",
"authors": "Schachter MM, Merrick KA, Larochelle S, Hirschi A, Zhang C, Shokat KM, Rubin SM, Fisher RP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "23622515",
"url": "https://glygen.org/publication/PubMed/23622515"
}
]
},
{
"title": "Leishmania mexicana infection induces IgG to parasite surface glycoinositol phospholipids that can induce IL-10 in mice and humans.",
"journal": "PLoS neglected tropical diseases",
"date": "2013",
"authors": "Buxbaum LU",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9664422",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664422"
}
],
"reference": [
{
"type": "PubMed",
"id": "23675550",
"url": "https://glygen.org/publication/PubMed/23675550"
}
]
},
{
"title": "CDK4 T172 phosphorylation is central in a CDK7-dependent bidirectional CDK4/CDK2 interplay mediated by p21 phosphorylation at the restriction point.",
"journal": "PLoS genetics",
"date": "2013",
"authors": "Bisteau X, Paternot S, Colleoni B, Ecker K, Coulonval K, De Groote P, Declercq W, Hengst L, Roger PP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "23737759",
"url": "https://glygen.org/publication/PubMed/23737759"
}
]
},
{
"title": "Rapid Evolution to Blast Crisis Associated with a Q252H ABL1 Kinase Domain Mutation in e19a2 BCR-ABL1 Chronic Myeloid Leukaemia.",
"journal": "Case reports in hematology",
"date": "2013",
"authors": "McCarron SL, Maher K, Kelly J, Ryan MF, Langabeer SE",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "24109527",
"url": "https://glygen.org/publication/PubMed/24109527"
}
]
},
{
"title": "Combination of bortezomib and mitotic inhibitors down-modulate Bcr-Abl and efficiently eliminates tyrosine-kinase inhibitor sensitive and resistant Bcr-Abl-positive leukemic cells.",
"journal": "PloS one",
"date": "2013",
"authors": "Bucur O, Stancu AL, Goganau I, Petrescu SM, Pennarun B, Bertomeu T, Dewar R, Khosravi-Far R",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "24155950",
"url": "https://glygen.org/publication/PubMed/24155950"
}
]
},
{
"title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.",
"journal": "Journal of proteomics",
"date": "2014",
"authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "24275569",
"url": "https://glygen.org/publication/PubMed/24275569"
}
]
},
{
"title": "Dasatinib May Override F317L BCR-ABL Kinase Domain Mutation in Patients with Chronic Myeloid Leukemia.",
"journal": "Turkish journal of haematology : official journal of Turkish Society of Haematology",
"date": "2013",
"authors": "Eskazan AE, Soysal T",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "24385789",
"url": "https://glygen.org/publication/PubMed/24385789"
}
]
},
{
"title": "Bosutinib: a second-generation tyrosine kinase inhibitor for chronic myelogenous leukemia.",
"journal": "The Annals of pharmacotherapy",
"date": "2013",
"authors": "Stansfield L, Hughes TE, Walsh-Chocolaad TL",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "24396109",
"url": "https://glygen.org/publication/PubMed/24396109"
}
]
},
{
"title": "Genetic characterization of the role of the Cip/Kip family of proteins as cyclin-dependent kinase inhibitors and assembly factors.",
"journal": "Molecular and cellular biology",
"date": "2014",
"authors": "Cerqueira A, Martin A, Symonds CE, Odajima J, Dubus P, Barbacid M, Santamaria D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "24515438",
"url": "https://glygen.org/publication/PubMed/24515438"
}
]
},
{
"title": "[Pilot treatment for 13 BCR-ABL positive leukemia patients with T315I mutation].",
"journal": "Zhonghua xue ye xue za zhi = Zhonghua xueyexue zazhi",
"date": "2014",
"authors": "Zhou M, Sha X, Qiu H, Cen J, Shen H, Sun A, Wu D",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "24606661",
"url": "https://glygen.org/publication/PubMed/24606661"
}
]
},
{
"title": "HS-438, a new inhibitor of imatinib-resistant BCR-ABL T315I mutation in chronic myeloid leukemia.",
"journal": "Cancer letters",
"date": "2014",
"authors": "Yun SM, Jung KH, Kim SJ, Fang Z, Son MK, Yan HH, Lee H, Kim J, Shin S, Hong S, Hong SS",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "24657654",
"url": "https://glygen.org/publication/PubMed/24657654"
}
]
},
{
"title": "Role of MERIT40 in stabilization of BRCA1 complex: a protein-protein interaction study.",
"journal": "Biochemical and biophysical research communications",
"date": "2014",
"authors": "Vikrant, Sawant UU, Varma AK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "24667604",
"url": "https://glygen.org/publication/PubMed/24667604"
}
]
},
{
"title": "Human Fc gamma RIII (CD16). Isoforms with distinct allelic expression, extracellular domains, and membrane linkages on polymorphonuclear and natural killer cells.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "1989",
"authors": "Edberg JC, Redecha PB, Salmon JE, Kimberly RP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9664422",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664422"
}
],
"reference": [
{
"type": "PubMed",
"id": "2474607",
"url": "https://glygen.org/publication/PubMed/2474607"
}
]
},
{
"title": "Ponatinib: a third-generation inhibitor for the treatment of CML.",
"journal": "Recent results in cancer research. Fortschritte der Krebsforschung. Progres dans les recherches sur le cancer",
"date": "2014",
"authors": "Wehrle J, Pahl HL, von Bubnoff N",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "24756787",
"url": "https://glygen.org/publication/PubMed/24756787"
}
]
},
{
"title": "Cyclin D activates the Rb tumor suppressor by mono-phosphorylation.",
"journal": "eLife",
"date": "2014",
"authors": "Narasimha AM, Kaulich M, Shapiro GS, Choi YJ, Sicinski P, Dowdy SF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "24876129",
"url": "https://glygen.org/publication/PubMed/24876129"
}
]
},
{
"title": "[Treatment of two chronic myeloid leukemia patients with V299L mutation by using nilotinib].",
"journal": "Zhongguo shi yan xue ye xue za zhi",
"date": "2014",
"authors": "Yang XC, Qiu HX, Zhang SJ, Wang JJ, Ouyang Y, Pan LQ, Qiao C, Li JY",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "24989279",
"url": "https://glygen.org/publication/PubMed/24989279"
}
]
},
{
"title": "Targeting transcription regulation in cancer with a covalent CDK7 inhibitor.",
"journal": "Nature",
"date": "2014",
"authors": "Kwiatkowski N, Zhang T, Rahl PB, Abraham BJ, Reddy J, Ficarro SB, Dastur A, Amzallag A, Ramaswamy S, Tesar B, Jenkins CE, Hannett NM, McMillin D, Sanda T, Sim T, Kim ND, Look T, Mitsiades CS, Weng AP, Brown JR, Benes CH, Marto JA, Young RA, Gray NS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8939236",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236"
}
],
"reference": [
{
"type": "PubMed",
"id": "25043025",
"url": "https://glygen.org/publication/PubMed/25043025"
}
]
},
{
"title": "A phase 2 study of MK-0457 in patients with BCR-ABL T315I mutant chronic myelogenous leukemia and philadelphia chromosome-positive acute lymphoblastic leukemia.",
"journal": "Blood cancer journal",
"date": "2014",
"authors": "Seymour JF, Kim DW, Rubin E, Haregewoin A, Clark J, Watson P, Hughes T, Dufva I, Jimenez JL, Mahon FX, Rousselot P, Cortes J, Martinelli G, Papayannidis C, Nagler A, Giles FJ",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "25127392",
"url": "https://glygen.org/publication/PubMed/25127392"
}
]
},
{
"title": "[Correlation between point mutation in ABL kinase and clinical outcome of chronic myeloid leukemia patients].",
"journal": "Zhonghua xue ye xue za zhi = Zhonghua xueyexue zazhi",
"date": "2014",
"authors": "Gao G, Xu N, Yin C, Zhou X, Xiao Y, Li L, Liao L, Cao R, Xu D, Meng F, Liu X",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "25152116",
"url": "https://glygen.org/publication/PubMed/25152116"
}
]
},
{
"title": "Increased genomic instability may contribute to the development of kinase domain mutations in chronic myeloid leukemia.",
"journal": "International journal of hematology",
"date": "2014",
"authors": "Sweet K, Al Ali NH, Dalia SM, Komrokji RS, Crescentini RM, Tinsley S, Lancet JE, Papenhausen PR, Zhang L, Pinilla-Ibarz J",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "25281405",
"url": "https://glygen.org/publication/PubMed/25281405"
}
]
},
{
"title": "Patients with Philadelphia-positive leukemia with Y253H or F359V mutation have a high risk of developing new mutations in the setting of dasatinib resistance.",
"journal": "Leukemia & lymphoma",
"date": "2015",
"authors": "Jiang Q, Qin YZ, Lai YY, Jiang H, Wang J, Huang XJ",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "25379619",
"url": "https://glygen.org/publication/PubMed/25379619"
}
]
},
{
"title": "Oncogene regulation. An oncogenic super-enhancer formed through somatic mutation of a noncoding intergenic element.",
"journal": "Science (New York, N.Y.)",
"date": "2014",
"authors": "Mansour MR, Abraham BJ, Anders L, Berezovskaya A, Gutierrez A, Durbin AD, Etchin J, Lawton L, Sallan SE, Silverman LB, Loh ML, Hunger SP, Sanda T, Young RA, Look AT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8939236",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236"
}
],
"reference": [
{
"type": "PubMed",
"id": "25394790",
"url": "https://glygen.org/publication/PubMed/25394790"
}
]
},
{
"title": "N-terminal mutations activate the leukemogenic potential of the myristoylated form of c-abl.",
"journal": "EMBO J.",
"date": "1989",
"authors": "Jackson P, Baltimore D",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "2542016",
"url": "https://glygen.org/publication/PubMed/2542016"
}
]
},
{
"title": "Efficacy of molecular response at 1 or 3 months after the initiation of dasatinib treatment can predict an improved response to dasatinib in imatinib-resistant or imatinib-intolerant Japanese patients with chronic myelogenous leukemia during the chronic phase.",
"journal": "Journal of clinical and experimental hematopathology : JCEH",
"date": "2014",
"authors": "Inokuchi K, Kumagai T, Matsuki E, Ohashi K, Shinagawa A, Hatta Y, Takeuchi J, Yoshida C, Wakita H, Kozai Y, Shirasugi Y, Fujisawa S, Iwase O, Yano S, Okamoto S, Oba K, Sakamoto J, Sakamaki H",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "25501110",
"url": "https://glygen.org/publication/PubMed/25501110"
}
]
},
{
"title": "[BCR-ABL T315I mutant acute lymphoblastic leukemia in 3 children].",
"journal": "Zhonghua er ke za zhi = Chinese journal of pediatrics",
"date": "2014",
"authors": "Hui H, Lu A, Zhang L",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "25582480",
"url": "https://glygen.org/publication/PubMed/25582480"
}
]
},
{
"title": "Hyperdiploidy associated with T315I mutation in BCR-ABL kinase domain in an accelerated phase-chronic myeloid leukemia case.",
"journal": "Molecular cytogenetics",
"date": "2014",
"authors": "Al-Achkar W, Moassass F, Ikhtiar A, Liehr T, Othman MA, Wafa A",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "25621010",
"url": "https://glygen.org/publication/PubMed/25621010"
}
]
},
{
"title": "Brk/Protein tyrosine kinase 6 phosphorylates p27KIP1, regulating the activity of cyclin D-cyclin-dependent kinase 4.",
"journal": "Molecular and cellular biology",
"date": "2015",
"authors": "Patel P, Asbach B, Shteyn E, Gomez C, Coltoff A, Bhuyan S, Tyner AL, Wagner R, Blain SW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "25733683",
"url": "https://glygen.org/publication/PubMed/25733683"
}
]
},
{
"title": "E255K and G250E mutation appearing in a patient with e19a2 chronic myeloid leukemia resistant to imatinib.",
"journal": "Clinical laboratory",
"date": "2015",
"authors": "Li C, Wang Y, Xu D, Zhang P, Ding X, Zhang N, Xiao M, Huang L, Meng L",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "25807654",
"url": "https://glygen.org/publication/PubMed/25807654"
}
]
},
{
"title": "Ucma, a direct transcriptional target of Runx2 and Osterix, promotes osteoblast differentiation and nodule formation.",
"journal": "Osteoarthritis and cartilage",
"date": "2015",
"authors": "Lee YJ, Park SY, Lee SJ, Boo YC, Choi JY, Kim JE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8940973",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8940973"
}
],
"reference": [
{
"type": "PubMed",
"id": "25865393",
"url": "https://glygen.org/publication/PubMed/25865393"
}
]
},
{
"title": "CD-200 induces apoptosis and inhibits Bcr-Abl signaling in imatinib-resistant chronic myeloid leukemia with T315I mutation.",
"journal": "International journal of oncology",
"date": "2015",
"authors": "Fang Z, Jung KH, Yan HH, Kim SJ, Son MK, Rumman M, Lee H, Kim KW, Yoo HD, Hong SS",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "25963192",
"url": "https://glygen.org/publication/PubMed/25963192"
}
]
},
{
"title": "Treatment with dasatinib or nilotinib in chronic myeloid leukemia patients who failed to respond to two previously administered tyrosine kinase inhibitors--a single center experience.",
"journal": "Clinics (Sao Paulo, Brazil)",
"date": "2015",
"authors": "Ribeiro BF, Miranda EC, Albuquerque DM, Delamain MT, Oliveira-Duarte G, Almeida MH, Vergilio B, Silveira RA, Oliveira-Duarte V, Lorand-Metze I, De Souza CA, Pagnano KB",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "26247667",
"url": "https://glygen.org/publication/PubMed/26247667"
}
]
},
{
"title": "ABL SH3 mutant inhibits BCR-ABL activity and increases imatinib sensitivity by targeting RIN1 protein in CML cell.",
"journal": "Cancer letters",
"date": "2015",
"authors": "Liu X, Li Y, Wen L, Tao K, Xiao Q, Cao W, Huang Z, Gao M, Li H, Wang F, Feng W",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "26321052",
"url": "https://glygen.org/publication/PubMed/26321052"
}
]
},
{
"title": "Characterizing of Four Common BCR-ABL Kinase Domain Mutations (T315I, Y253H, M351T and E255K) in Iranian Chronic Myelogenous Leukemia Patients With Imatinib Resistance.",
"journal": "Iranian journal of cancer prevention",
"date": "2015",
"authors": "Rejali L, Poopak B, Hasanzad M, Sheikhsofla F, Varnoosfaderani AS, Safari N, Rabieipoor S",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "26413254",
"url": "https://glygen.org/publication/PubMed/26413254"
}
]
},
{
"title": "Nilotinib rapidly reverses breakpoint cluster region-Abelson oncogene fusion gene and M244V mutations in a patient with chronic myelogenous leukemia: A case report.",
"journal": "Experimental and therapeutic medicine",
"date": "2015",
"authors": "Shen X, Zhang M, Shen Y, Shi W, Liu W, Wei WU",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "26622510",
"url": "https://glygen.org/publication/PubMed/26622510"
}
]
},
{
"title": "Properties and catalytic activities of MICAL1, the flavoenzyme involved in cytoskeleton dynamics, and modulation by its CH, LIM and C-terminal domains.",
"journal": "Archives of biochemistry and biophysics",
"date": "2016",
"authors": "Vitali T, Maffioli E, Tedeschi G, Vanoni MA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231"
}
],
"reference": [
{
"type": "PubMed",
"id": "26845023",
"url": "https://glygen.org/publication/PubMed/26845023"
}
]
},
{
"title": "Metabolic characterization of imatinib-resistant BCR-ABL T315I chronic myeloid leukemia cells indicates down-regulation of glycolytic pathway and low ROS production.",
"journal": "Leukemia & lymphoma",
"date": "2016",
"authors": "Ko BW, Han J, Heo JY, Jang Y, Kim SJ, Kim J, Lee MJ, Ryu MJ, Song IC, Jo YS, Kweon GR",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "26854822",
"url": "https://glygen.org/publication/PubMed/26854822"
}
]
},
{
"title": "Nucleotide sequence analysis of human abl and bcr-abl cDNAs.",
"journal": "Oncogene",
"date": "1989",
"authors": "Fainstein E, Einat M, Gokkel E, Marcelle C, Croce C M, Gale R P, Canaani E",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "2687768",
"url": "https://glygen.org/publication/PubMed/2687768"
}
]
},
{
"title": "Bone and Muscle Endocrine Functions: Unexpected Paradigms of Inter-organ Communication.",
"journal": "Cell",
"date": "2016",
"authors": "Karsenty G, Olson EN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8940973",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8940973"
}
],
"reference": [
{
"type": "PubMed",
"id": "26967290",
"url": "https://glygen.org/publication/PubMed/26967290"
}
]
},
{
"title": "Allogeneic Stem Cell Transplantation for Patients with T315I BCR-ABL Mutated Chronic Myeloid Leukemia.",
"journal": "Biology of blood and marrow transplantation : journal of the American Society for Blood and Marrow Transplantation",
"date": "2016",
"authors": "Xu LP, Xu ZL, Zhang XH, Chen H, Chen YH, Han W, Chen Y, Wang FR, Wang JZ, Wang Y, Yan CH, Mo XD, Liu KY, Huang XJ",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "26995693",
"url": "https://glygen.org/publication/PubMed/26995693"
}
]
},
{
"title": "SCL/TAL1 in Hematopoiesis and Cellular Reprogramming.",
"journal": "Current topics in developmental biology",
"date": "2016",
"authors": "Hoang T, Lambert JA, Martin R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8939236",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236"
}
],
"reference": [
{
"type": "PubMed",
"id": "27137657",
"url": "https://glygen.org/publication/PubMed/27137657"
}
]
},
{
"title": "Combination of panobinostat with ponatinib synergistically overcomes imatinib-resistant CML cells.",
"journal": "Cancer science",
"date": "2016",
"authors": "Matsuda Y, Yamauchi T, Hosono N, Uzui K, Negoro E, Morinaga K, Nishi R, Yoshida A, Kimura S, Maekawa T, Ueda T",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "27166836",
"url": "https://glygen.org/publication/PubMed/27166836"
}
]
},
{
"title": "A novel tubulin polymerization inhibitor, MPT0B206, downregulates Bcr-Abl expression and induces apoptosis in imatinib-sensitive and imatinib-resistant CML cells.",
"journal": "Apoptosis : an international journal on programmed cell death",
"date": "2016",
"authors": "Chen CW, Lee YL, Liou JP, Liu YH, Liu CW, Chen TY, Huang HM",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "27344662",
"url": "https://glygen.org/publication/PubMed/27344662"
}
]
},
{
"title": "A cascade screening approach for the identification of Bcr-Abl myristate pocket binders active against wild type and T315I mutant.",
"journal": "Bioorganic & medicinal chemistry letters",
"date": "2016",
"authors": "Radi M, Schneider R, Fallacara AL, Botta L, Crespan E, Tintori C, Maga G, Kissova M, Calgani A, Richters A, Musumeci F, Rauh D, Schenone S",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "27374241",
"url": "https://glygen.org/publication/PubMed/27374241"
}
]
},
{
"title": "Sensitivity of imatinib-resistant T315I BCR-ABL CML to a synergistic combination of ponatinib and forskolin treatment.",
"journal": "Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine",
"date": "2016",
"authors": "Oaxaca DM, Yang-Reid SA, Ross JA, Rodriguez G, Staniswalis JG, Kirken RA",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "27444277",
"url": "https://glygen.org/publication/PubMed/27444277"
}
]
},
{
"title": "PBA2, a novel inhibitor of imatinib-resistant BCR-ABL T315I mutation in chronic myeloid leukemia.",
"journal": "Cancer letters",
"date": "2016",
"authors": "Gupta P, Kathawala RJ, Wei L, Wang F, Wang X, Druker BJ, Fu LW, Chen ZS",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "27720778",
"url": "https://glygen.org/publication/PubMed/27720778"
}
]
},
{
"title": "Reciprocal stabilization of ABL and TAZ regulates osteoblastogenesis through transcription factor RUNX2.",
"journal": "The Journal of clinical investigation",
"date": "2016",
"authors": "Matsumoto Y, La Rose J, Kent OA, Wagner MJ, Narimatsu M, Levy AD, Omar MH, Tong J, Krieger JR, Riggs E, Storozhuk Y, Pasquale J, Ventura M, Yeganeh B, Post M, Moran MF, Grynpas MD, Wrana JL, Superti-Furga G, Koleske AJ, Pendergast AM, Rottapel R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8940973",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8940973"
}
],
"reference": [
{
"type": "PubMed",
"id": "27797343",
"url": "https://glygen.org/publication/PubMed/27797343"
}
]
},
{
"title": "A new fused transcript in Philadelphia chromosome positive acute lymphocytic leukaemia.",
"journal": "Nature",
"date": "1987",
"authors": "Fainstein E, Marcelle C, Rosner A, Canaani E, Gale RP, Dreazen O, Smith SD, Croce CM",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "2825022",
"url": "https://glygen.org/publication/PubMed/2825022"
}
]
},
{
"title": "Germline mutations in ABL1 cause an autosomal dominant syndrome characterized by congenital heart defects and skeletal malformations.",
"journal": "Nature genetics",
"date": "2017",
"authors": "Wang X, Charng WL, Chen CA, Rosenfeld JA, Al Shamsi A, Al-Gazali L, McGuire M, Mew NA, Arnold GL, Qu C, Ding Y, Muzny DM, Gibbs RA, Eng CM, Walkiewicz M, Xia F, Plon SE, Lupski JR, Schaaf CP, Yang Y",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "28288113",
"url": "https://glygen.org/publication/PubMed/28288113"
}
]
},
{
"title": "MPT0B002, a novel microtubule inhibitor, downregulates T315I mutant Bcr-Abl and induces apoptosis of imatinib-resistant chronic myeloid leukemia cells.",
"journal": "Investigational new drugs",
"date": "2017",
"authors": "Yeh YY, Liou JP, Lee YL, Lin JY, Huang HM",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "28349229",
"url": "https://glygen.org/publication/PubMed/28349229"
}
]
},
{
"title": "Differential regulation of PKD isoforms in oxidative stress conditions through phosphorylation of a conserved Tyr in the P+1 loop.",
"journal": "Scientific reports",
"date": "2017",
"authors": "Cobbaut M, Derua R, Doppler H, Lou HJ, Vandoninck S, Storz P, Turk BE, Seufferlein T, Waelkens E, Janssens V, Van Lint J",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "28428613",
"url": "https://glygen.org/publication/PubMed/28428613"
}
]
},
{
"title": "Quantitative proteomics identifies altered O-GlcNAcylation of structural, synaptic and memory-associated proteins in Alzheimer's disease.",
"journal": "The Journal of pathology",
"date": "2017",
"authors": "Wang S, Yang F, Petyuk VA, Shukla AK, Monroe ME, Gritsenko MA, Rodland KD, Smith RD, Qian WJ, Gong CX, Liu T",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "P00519",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "28657654",
"url": "https://glygen.org/publication/PubMed/28657654"
}
]
},
{
"title": "Mutant p53 dictates the oncogenic activity of c-Abl in triple-negative breast cancers.",
"journal": "Cell death & disease",
"date": "2017",
"authors": "Morrison CD, Chang JC, Keri RA, Schiemann WP",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "28661474",
"url": "https://glygen.org/publication/PubMed/28661474"
}
]
},
{
"title": "The clonal evolution of two distinct T315I-positive BCR-ABL1 subclones in a Philadelphia-positive acute lymphoblastic leukemia failing multiple lines of therapy: a case report.",
"journal": "BMC cancer",
"date": "2017",
"authors": "De Benedittis C, Papayannidis C, Venturi C, Abbenante MC, Paolini S, Parisi S, Sartor C, Cavo M, Martinelli G, Soverini S",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "28779753",
"url": "https://glygen.org/publication/PubMed/28779753"
}
]
},
{
"title": "Antitumor Effects of Blocking Protein Neddylation in T315I-BCR-ABL Leukemia Cells and Leukemia Stem Cells.",
"journal": "Cancer research",
"date": "2018",
"authors": "Liu C, Nie D, Li J, Du X, Lu Y, Li Y, Zhou J, Jin Y, Pan J",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "29321163",
"url": "https://glygen.org/publication/PubMed/29321163"
}
]
},
{
"title": "Anthelmintic niclosamide suppresses transcription of BCR-ABL fusion oncogene via disabling Sp1 and induces apoptosis in imatinib-resistant CML cells harboring T315I mutant.",
"journal": "Cell death & disease",
"date": "2018",
"authors": "Jin B, Wang C, Shen Y, Pan J",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "29358661",
"url": "https://glygen.org/publication/PubMed/29358661"
}
]
},
{
"title": "Characteristics and outcome of chronic myeloid leukemia patients with E255K/V BCR-ABL kinase domain mutations.",
"journal": "International journal of hematology",
"date": "2018",
"authors": "Naqvi K, Cortes JE, Luthra R, O'Brien S, Wierda W, Borthakur G, Kadia T, Garcia-Manero G, Ravandi F, Rios MB, Dellasala S, Pierce S, Jabbour E, Patel K, Kantarjian H",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "29464484",
"url": "https://glygen.org/publication/PubMed/29464484"
}
]
},
{
"title": "Extramedullary Blast Crisis in a Patient with T315I BCR-ABL Mutated Chronic Myeloid Leukemia.",
"journal": "Clinical laboratory",
"date": "2018",
"authors": "Zhang J, Zhang X, Lu Y, Jiao J, Chen Y, Lin D",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "29479884",
"url": "https://glygen.org/publication/PubMed/29479884"
}
]
},
{
"title": "Taxodione induces apoptosis in BCR-ABL-positive cells through ROS generation.",
"journal": "Biochemical pharmacology",
"date": "2018",
"authors": "Uchihara Y, Tago K, Taguchi H, Narukawa Y, Kiuchi F, Tamura H, Funakoshi-Tago M",
"evidence": [
{
"database": "Entrez",
"id": "25",
"url": "https://www.ncbi.nlm.nih.gov/gene/25"
}
],
"reference": [
{
"type": "PubMed",
"id": "29859988",
"url": "https://glygen.org/publication/PubMed/29859988"
}
]
},
{
"title": "Quantitative Profiling of Protein O-GlcNAcylation Sites by an Isotope-Tagged Cleavable Linker.",
"journal": "ACS chemical biology",
"date": "2018",
"authors": "Qin K, Zhu Y, Qin W, Gao J, Shao X, Wang YL, Zhou W, Wang C, Chen X",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "P00519",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P00519"
},
{
"database": "O-GlcNAc Atlas",
"id": "P00519",
"url": "https://oglcnac.org/atlas/detail/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "30059200",
"url": "https://glygen.org/publication/PubMed/30059200"
}
]
},
{
"title": "Alternative splicing of RNAs transcribed from the human abl gene and from the bcr-abl fused gene.",
"journal": "Cell",
"date": "1986",
"authors": "Shtivelman E, Lifshitz B, Gale RP, Roe BA, Canaani E",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "3021337",
"url": "https://glygen.org/publication/PubMed/3021337"
}
]
},
{
"title": "Helicobacter pylori-controlled c-Abl localization promotes cell migration and limits apoptosis.",
"journal": "Cell communication and signaling : CCS",
"date": "2019",
"authors": "Posselt G, Wiesauer M, Chichirau BE, Engler D, Krisch LM, Gadermaier G, Briza P, Schneider S, Boccellato F, Meyer TF, Hauser-Kronberger C, Neureiter D, Muller A, Wessler S",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "30704478",
"url": "https://glygen.org/publication/PubMed/30704478"
}
]
},
{
"title": "A Code of Mono-phosphorylation Modulates the Function of RB.",
"journal": "Molecular cell",
"date": "2019",
"authors": "Sanidas I, Morris R, Fella KA, Rumde PH, Boukhali M, Tai EC, Ting DT, Lawrence MS, Haas W, Dyson NJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "30711375",
"url": "https://glygen.org/publication/PubMed/30711375"
}
]
},
{
"title": "Functional interplay between NF-\u03baB-inducing kinase and c-Abl kinases limits response to Aurora inhibitors in multiple myeloma.",
"journal": "Haematologica",
"date": "2019-12",
"authors": "Mazzera Laura, Abeltino Manuela, Lombardi Guerino, Cantoni Anna Maria, Ria Roberto, Ricca Micaela, Saltarella Ilaria, Naponelli Valeria, Rizzi Federica Maria Angela, Perris Roberto, Corradi Attilio, Vacca Angelo, Bonati Antonio, Lunghi Paolo",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "30948493",
"url": "https://glygen.org/publication/PubMed/30948493"
}
]
},
{
"title": "USP10 modulates the SKP2/Bcr-Abl axis via stabilizing SKP2 in chronic myeloid leukemia.",
"journal": "Cell discovery",
"date": "2019",
"authors": "Liao Y, Liu N, Xia X, Guo Z, Li Y, Jiang L, Zhou R, Tang D, Huang H, Liu J",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "31044085",
"url": "https://glygen.org/publication/PubMed/31044085"
}
]
},
{
"title": "Aspartate Residues Far from the Active Site Drive O-GlcNAc Transferase Substrate Selection.",
"journal": "Journal of the American Chemical Society",
"date": "2019",
"authors": "Joiner CM, Levine ZG, Aonbangkhen C, Woo CM, Walker S",
"evidence": [
{
"database": "O-GlcNAc Atlas",
"id": "P00519",
"url": "https://oglcnac.org/atlas/detail/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "31373491",
"url": "https://glygen.org/publication/PubMed/31373491"
}
]
},
{
"title": "Transient Hysteresis in CDK4/6 Activity Underlies Passage of the Restriction Point in G1.",
"journal": "Molecular cell",
"date": "2019",
"authors": "Chung M, Liu C, Yang HW, Koberlin MS, Cappell SD, Meyer T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "31543423",
"url": "https://glygen.org/publication/PubMed/31543423"
}
]
},
{
"title": "Regulated expression of a gene encoding a nuclear factor, IRF-1, that specifically binds to IFN-beta gene regulatory elements.",
"journal": "Cell",
"date": "1988",
"authors": "Miyamoto M, Fujita T, Kimura Y, Maruyama M, Harada H, Sudo Y, Miyata T, Taniguchi T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231"
}
],
"reference": [
{
"type": "PubMed",
"id": "3409321",
"url": "https://glygen.org/publication/PubMed/3409321"
}
]
},
{
"title": "An Optimized Isotopic Photocleavable Tagging Strategy for Site-Specific and Quantitative Profiling of Protein O-GlcNAcylation in Colorectal Cancer Metastasis.",
"journal": "ACS chemical biology",
"date": "2022",
"authors": "Liu J, Hao Y, Wang C, Jin Y, Yang Y, Gu J, Chen X",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "P00519",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "35254053",
"url": "https://glygen.org/publication/PubMed/35254053"
}
]
},
{
"title": "Histone demethylase PHF8 facilitates the development of chronic myeloid leukaemia by directly targeting BCR::ABL1.",
"journal": "British journal of haematology",
"date": "2023-09",
"authors": "Feng Huimin, Fu Yue, Cui Zelong, Zhou Minran, Zhang Lu, Gao Zhenxing, Ma Sai, Chen Chunyan",
"evidence": [
{
"database": "RefSeq",
"id": "NP_005148",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_005148"
}
],
"reference": [
{
"type": "PubMed",
"id": "37469124",
"url": "https://glygen.org/publication/PubMed/37469124"
}
]
},
{
"title": "Spectrum of BCR-ABL mutations in Azerbaijanian imatinib-resistant patients with chronic myeloid leukemia.",
"journal": "Pathology oncology research : POR",
"date": "2023",
"authors": "Hasanova Aypara, Asadov Chingiz, Karimova Nigar, Shirinova Aytan, Aliyeva Gunay, Alimirzoyeva Zohra",
"evidence": [
{
"database": "RefSeq",
"id": "NP_005148",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_005148"
}
],
"reference": [
{
"type": "PubMed",
"id": "38188610",
"url": "https://glygen.org/publication/PubMed/38188610"
}
]
},
{
"title": "Homology between phosphotyrosine acceptor site of human c-abl and viral oncogene products.",
"journal": "Nature",
"date": "1983",
"authors": "Groffen J, Heisterkamp N, Reynolds F H, Stephenson J R",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "6191223",
"url": "https://glygen.org/publication/PubMed/6191223"
}
]
},
{
"title": "Sequence analysis of the mutation at codon 834 and the sequence variation of codon 837 of c-abl gene.",
"journal": "Leukemia",
"date": "1994",
"authors": "Inokuchi K, Futaki M, Dan K, Nomura T",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "7545908",
"url": "https://glygen.org/publication/PubMed/7545908"
}
]
},
{
"title": "Sequence and analysis of the human ABL gene, the BCR gene, and regions involved in the Philadelphia chromosomal translocation.",
"journal": "Genomics",
"date": "1995",
"authors": "Chissoe S L, Bodenteich A, Wang Y F, Wang Y P, Burian D, Clifton S W, Crabtree J, Freeman A, Iyer K, Jian L",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "7665185",
"url": "https://glygen.org/publication/PubMed/7665185"
}
]
},
{
"title": "Regulation of the retinoblastoma protein-related p107 by G1 cyclin complexes.",
"journal": "Genes & development",
"date": "1995",
"authors": "Beijersbergen RL, Carlee L, Kerkhoven RM, Bernards R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "7797074",
"url": "https://glygen.org/publication/PubMed/7797074"
}
]
},
{
"title": "Kiz-1, a protein with LIM zinc finger and kinase domains, is expressed mainly in neurons.",
"journal": "Cell growth & differentiation : the molecular biology journal of the American Association for Cancer Research",
"date": "1994",
"authors": "Bernard O, Ganiatsas S, Kannourakis G, Dringen R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "7848918",
"url": "https://glygen.org/publication/PubMed/7848918"
}
]
},
{
"title": "Two distinct osteoblast-specific cis-acting elements control expression of a mouse osteocalcin gene.",
"journal": "Molecular and cellular biology",
"date": "1995",
"authors": "Ducy P, Karsenty G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8940973",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8940973"
}
],
"reference": [
{
"type": "PubMed",
"id": "7891679",
"url": "https://glygen.org/publication/PubMed/7891679"
}
]
},
{
"title": "Homology modeling of the Abl-SH3 domain.",
"journal": "Proteins",
"date": "1994",
"authors": "Pisabarro M T, Ortiz A R, Serrano L, Wade R C",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "7892170",
"url": "https://glygen.org/publication/PubMed/7892170"
}
]
},
{
"title": "Cyclic AMP-induced G1 phase arrest mediated by an inhibitor (p27Kip1) of cyclin-dependent kinase 4 activation.",
"journal": "Cell",
"date": "1994",
"authors": "Kato JY, Matsuoka M, Polyak K, Massague J, Sherr CJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "7954814",
"url": "https://glygen.org/publication/PubMed/7954814"
}
]
},
{
"title": "Identification of G1 kinase activity for cdk6, a novel cyclin D partner.",
"journal": "Molecular and cellular biology",
"date": "1994",
"authors": "Meyerson M, Harlow E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "8114739",
"url": "https://glygen.org/publication/PubMed/8114739"
}
]
},
{
"title": "Regulation of cyclin D-dependent kinase 4 (cdk4) by cdk4-activating kinase.",
"journal": "Molecular and cellular biology",
"date": "1994",
"authors": "Kato JY, Matsuoka M, Strom DK, Sherr CJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "8139570",
"url": "https://glygen.org/publication/PubMed/8139570"
}
]
},
{
"title": "The retinoblastoma protein binds to a family of E2F transcription factors.",
"journal": "Molecular and cellular biology",
"date": "1993",
"authors": "Lees JA, Saito M, Vidal M, Valentine M, Look T, Harlow E, Dyson N, Helin K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "8246996",
"url": "https://glygen.org/publication/PubMed/8246996"
}
]
},
{
"title": "A bipartite nuclear localization signal in the retinoblastoma gene product and its importance for biological activity.",
"journal": "Molecular and cellular biology",
"date": "1993",
"authors": "Zacksenhaus E, Bremner R, Phillips RA, Gallie BL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "8336704",
"url": "https://glygen.org/publication/PubMed/8336704"
}
]
},
{
"title": "SH1 domain autophosphorylation of P210 BCR/ABL is required for transformation but not growth factor independence.",
"journal": "Molecular and cellular biology",
"date": "1993",
"authors": "Pendergast AM, Gishizky ML, Havlik MH, Witte ON",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "8441409",
"url": "https://glygen.org/publication/PubMed/8441409"
}
]
},
{
"title": "Regions of the retinoblastoma gene product required for its interaction with the E2F transcription factor are necessary for E2 promoter repression and pRb-mediated growth suppression.",
"journal": "Molecular and cellular biology",
"date": "1993",
"authors": "Hiebert SW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "8497257",
"url": "https://glygen.org/publication/PubMed/8497257"
}
]
},
{
"title": "The solution structure of Abl SH3, and its relationship to SH2 in the SH(32) construct.",
"journal": "Structure",
"date": "1995",
"authors": "Gosser Y Q, Zheng J, Overduin M, Mayer B J, Cowburn D",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "8590002",
"url": "https://glygen.org/publication/PubMed/8590002"
}
]
},
{
"title": "Isolation of inositol 1,3,4-trisphosphate 5/6-kinase, cDNA cloning and expression of the recombinant enzyme.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Wilson MP, Majerus PW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231"
}
],
"reference": [
{
"type": "PubMed",
"id": "8662638",
"url": "https://glygen.org/publication/PubMed/8662638"
}
]
},
{
"title": "Identification of a binding site in c-Ab1 tyrosine kinase for the C-terminal repeated domain of RNA polymerase II.",
"journal": "Molecular and cellular biology",
"date": "1996",
"authors": "Baskaran R, Chiang GG, Wang JY",
"evidence": [
{
"database": "iPTMnet",
"id": "P00519-1",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519-1"
}
],
"reference": [
{
"type": "PubMed",
"id": "8668151",
"url": "https://glygen.org/publication/PubMed/8668151"
}
]
},
{
"title": "Physical interaction between human RAD52 and RPA is required for homologous recombination in mammalian cells.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Park MS, Ludwig DL, Stigger E, Lee SH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5685938",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685938"
}
],
"reference": [
{
"type": "PubMed",
"id": "8702565",
"url": "https://glygen.org/publication/PubMed/8702565"
}
]
},
{
"title": "Vav in natural killer cells is tyrosine phosphorylated upon cross-linking of Fc gamma RIIIA and is constitutively associated with a serine/threonine kinase.",
"journal": "The Biochemical journal",
"date": "1996",
"authors": "Xu X, Chong AS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "8809042",
"url": "https://glygen.org/publication/PubMed/8809042"
}
]
},
{
"title": "NF-E2 disrupts chromatin structure at human beta-globin locus control region hypersensitive site 2 in vitro.",
"journal": "Molecular and cellular biology",
"date": "1996",
"authors": "Armstrong JA, Emerson BM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231"
}
],
"reference": [
{
"type": "PubMed",
"id": "8816476",
"url": "https://glygen.org/publication/PubMed/8816476"
}
]
},
{
"title": "Identification of a RING protein that can interact in vivo with the BRCA1 gene product.",
"journal": "Nature genetics",
"date": "1996",
"authors": "Wu LC, Wang ZW, Tsan JT, Spillman MA, Phung A, Xu XL, Yang MC, Hwang LY, Bowcock AM, Baer R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "8944023",
"url": "https://glygen.org/publication/PubMed/8944023"
}
]
},
{
"title": "Functional and physical interactions of Syk family kinases with the Vav proto-oncogene product.",
"journal": "Immunity",
"date": "1996",
"authors": "Deckert M, Tartare-Deckert S, Couture C, Mustelin T, Altman A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "8986718",
"url": "https://glygen.org/publication/PubMed/8986718"
}
]
},
{
"title": "Regulation of DNA damage-induced apoptosis by the c-Abl tyrosine kinase.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1997-02-18",
"authors": "Yuan Z M, Huang Y, Ishiko T, Kharbanda S, Weichselbaum R, Kufe D",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "9037071",
"url": "https://glygen.org/publication/PubMed/9037071"
}
]
},
{
"title": "The subcellular locations of p15(Ink4b) and p27(Kip1) coordinate their inhibitory interactions with cdk4 and cdk2.",
"journal": "Genes & development",
"date": "1997",
"authors": "Reynisdottir I, Massague J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "9042862",
"url": "https://glygen.org/publication/PubMed/9042862"
}
]
},
{
"title": "Identification of a novel protein kinase A anchoring protein that binds both type I and type II regulatory subunits.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Huang LJ, Durick K, Weiner JA, Chun J, Taylor SS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231"
}
],
"reference": [
{
"type": "PubMed",
"id": "9065479",
"url": "https://glygen.org/publication/PubMed/9065479"
}
]
},
{
"title": "Activation of the transcription factor MEF2C by the MAP kinase p38 in inflammation.",
"journal": "Nature",
"date": "1997",
"authors": "Han J, Jiang Y, Li Z, Kravchenko VV, Ulevitch RJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-525793",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-525793"
}
],
"reference": [
{
"type": "PubMed",
"id": "9069290",
"url": "https://glygen.org/publication/PubMed/9069290"
}
]
},
{
"title": "New functional activities for the p21 family of CDK inhibitors.",
"journal": "Genes & development",
"date": "1997",
"authors": "LaBaer J, Garrett MD, Stevenson LF, Slingerland JM, Sandhu C, Chou HS, Fattaey A, Harlow E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "9106657",
"url": "https://glygen.org/publication/PubMed/9106657"
}
]
},
{
"title": "Protein binding and signaling properties of RIN1 suggest a unique effector function.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1997",
"authors": "Han L, Wong D, Dhaka A, Afar D, White M, Xie W, Herschman H, Witte O, Colicelli J",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "9144171",
"url": "https://glygen.org/publication/PubMed/9144171"
}
]
},
{
"title": "The subcellular localization of E2F-4 is cell-cycle dependent.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1997",
"authors": "Lindeman GJ, Gaubatz S, Livingston DM, Ginsberg D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "9144196",
"url": "https://glygen.org/publication/PubMed/9144196"
}
]
},
{
"title": "Ataxia telangiectasia mutant protein activates c-Abl tyrosine kinase in response to ionizing radiation.",
"journal": "Nature",
"date": "1997",
"authors": "Baskaran R, Wood LD, Whitaker LL, Canman CE, Morgan SE, Xu Y, Barlow C, Baltimore D, Wynshaw-Boris A, Kastan MB, Wang JY",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
},
{
"database": "iPTMnet",
"id": "P00519-1",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00519-1"
}
],
"reference": [
{
"type": "PubMed",
"id": "9168116",
"url": "https://glygen.org/publication/PubMed/9168116"
}
]
},
{
"title": "Osf2/Cbfa1: a transcriptional activator of osteoblast differentiation.",
"journal": "Cell",
"date": "1997",
"authors": "Ducy P, Zhang R, Geoffroy V, Ridall AL, Karsenty G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8940973",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8940973"
}
],
"reference": [
{
"type": "PubMed",
"id": "9182762",
"url": "https://glygen.org/publication/PubMed/9182762"
}
]
},
{
"title": "Cyclin D1/Cdk4 regulates retinoblastoma protein-mediated cell cycle arrest by site-specific phosphorylation.",
"journal": "Molecular biology of the cell",
"date": "1997",
"authors": "Connell-Crowley L, Harper JW, Goodrich DW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "9190208",
"url": "https://glygen.org/publication/PubMed/9190208"
}
]
},
{
"title": "FOG, a multitype zinc finger protein, acts as a cofactor for transcription factor GATA-1 in erythroid and megakaryocytic differentiation.",
"journal": "Cell",
"date": "1997",
"authors": "Tsang AP, Visvader JE, Turner CA, Fujiwara Y, Yu C, Weiss MJ, Crossley M, Orkin SH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231"
}
],
"reference": [
{
"type": "PubMed",
"id": "9230307",
"url": "https://glygen.org/publication/PubMed/9230307"
}
]
},
{
"title": "Differential interaction of the cyclin-dependent kinase (Cdk) inhibitor p27Kip1 with cyclin A-Cdk2 and cyclin D2-Cdk4.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Blain SW, Montalvo E, Massague J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "9325318",
"url": "https://glygen.org/publication/PubMed/9325318"
}
]
},
{
"title": "D-AKAP2, a novel protein kinase A anchoring protein with a putative RGS domain.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1997",
"authors": "Huang LJ, Durick K, Weiner JA, Chun J, Taylor SS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231"
}
],
"reference": [
{
"type": "PubMed",
"id": "9326583",
"url": "https://glygen.org/publication/PubMed/9326583"
}
]
},
{
"title": "Vertebrates have conserved capping protein alpha isoforms with specific expression patterns.",
"journal": "Cell motility and the cytoskeleton",
"date": "1997",
"authors": "Hart MC, Korshunova YO, Cooper JA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231"
}
],
"reference": [
{
"type": "PubMed",
"id": "9331217",
"url": "https://glygen.org/publication/PubMed/9331217"
}
]
},
{
"title": "Multiple roles for the MyoD basic region in transmission of transcriptional activation signals and interaction with MEF2.",
"journal": "Molecular and cellular biology",
"date": "1998",
"authors": "Black BL, Molkentin JD, Olson EN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-525793",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-525793"
}
],
"reference": [
{
"type": "PubMed",
"id": "9418854",
"url": "https://glygen.org/publication/PubMed/9418854"
}
]
},
{
"title": "Structure of IRF-1 with bound DNA reveals determinants of interferon regulation.",
"journal": "Nature",
"date": "1998",
"authors": "Escalante CR, Yie J, Thanos D, Aggarwal AK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231"
}
],
"reference": [
{
"type": "PubMed",
"id": "9422515",
"url": "https://glygen.org/publication/PubMed/9422515"
}
]
},
{
"title": "Functional inactivation of the retinoblastoma protein requires sequential modification by at least two distinct cyclin-cdk complexes.",
"journal": "Molecular and cellular biology",
"date": "1998",
"authors": "Lundberg AS, Weinberg RA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "9447971",
"url": "https://glygen.org/publication/PubMed/9447971"
}
]
},
{
"title": "Assembly of cyclin D-dependent kinase and titration of p27Kip1 regulated by mitogen-activated protein kinase kinase (MEK1).",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1998",
"authors": "Cheng M, Sexl V, Sherr CJ, Roussel MF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "9448290",
"url": "https://glygen.org/publication/PubMed/9448290"
}
]
},
{
"title": "Regulation of Rad51 function by c-Abl in response to DNA damage.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Yuan ZM, Huang Y, Ishiko T, Nakada S, Utsugisawa T, Kharbanda S, Wang R, Sung P, Shinohara A, Weichselbaum R, Kufe D",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "9461559",
"url": "https://glygen.org/publication/PubMed/9461559"
}
]
},
{
"title": "DNA double-stranded breaks induce histone H2AX phosphorylation on serine 139.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Rogakou EP, Pilch DR, Orr AH, Ivanova VS, Bonner WM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5693565",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565"
}
],
"reference": [
{
"type": "PubMed",
"id": "9488723",
"url": "https://glygen.org/publication/PubMed/9488723"
}
]
},
{
"title": "A requirement for cyclin D3-cyclin-dependent kinase (cdk)-4 assembly in the cyclic adenosine monophosphate-dependent proliferation of thyrocytes.",
"journal": "The Journal of cell biology",
"date": "1998",
"authors": "Depoortere F, Van Keymeulen A, Lukas J, Costagliola S, Bartkova J, Dumont JE, Bartek J, Roger PP, Dremier S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231"
}
],
"reference": [
{
"type": "PubMed",
"id": "9508775",
"url": "https://glygen.org/publication/PubMed/9508775"
}
]
},
{
"title": "The interaction of Arp2/3 complex with actin: nucleation, high affinity pointed end capping, and formation of branching networks of filaments.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1998",
"authors": "Mullins RD, Heuser JA, Pollard TD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "9600938",
"url": "https://glygen.org/publication/PubMed/9600938"
}
]
},
{
"title": "Crystal structure of the abl-SH3 domain complexed with a designed high-affinity peptide ligand: implications for SH3-ligand interactions.",
"journal": "J. Mol. Biol.",
"date": "1998",
"authors": "Pisabarro M T, Serrano L, Wilmanns M",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"reference": [
{
"type": "PubMed",
"id": "9698566",
"url": "https://glygen.org/publication/PubMed/9698566"
}
]
},
{
"title": "Structural requirements for PAK activation by Rac GTPases.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Knaus UG, Wang Y, Reilly AM, Warnock D, Jackson JH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "9705280",
"url": "https://glygen.org/publication/PubMed/9705280"
}
]
},
{
"title": "CDO, a robo-related cell surface protein that mediates myogenic differentiation.",
"journal": "The Journal of cell biology",
"date": "1998",
"authors": "Kang JS, Mulieri PJ, Miller C, Sassoon DA, Krauss RS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-525793",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-525793"
}
],
"reference": [
{
"type": "PubMed",
"id": "9786951",
"url": "https://glygen.org/publication/PubMed/9786951"
}
]
},
{
"title": "Fc receptor-mediated phagocytosis requires CDC42 and Rac1.",
"journal": "The EMBO journal",
"date": "1998",
"authors": "Massol P, Montcourrier P, Guillemot JC, Chavrier P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "9799231",
"url": "https://glygen.org/publication/PubMed/9799231"
}
]
},
{
"title": "Visualisation of human rad52 protein and its complexes with hRad51 and DNA.",
"journal": "Journal of molecular biology",
"date": "1998",
"authors": "Van Dyck E, Hajibagheri NM, Stasiak A, West SC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5685938",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685938"
}
],
"reference": [
{
"type": "PubMed",
"id": "9837724",
"url": "https://glygen.org/publication/PubMed/9837724"
}
]
},
{
"title": "WAVE, a novel WASP-family protein involved in actin reorganization induced by Rac.",
"journal": "The EMBO journal",
"date": "1998",
"authors": "Miki H, Suetsugu S, Takenawa T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "9843499",
"url": "https://glygen.org/publication/PubMed/9843499"
}
]
},
{
"title": "Regulation of the MEF2 family of transcription factors by p38.",
"journal": "Molecular and cellular biology",
"date": "1999",
"authors": "Zhao M, New L, Kravchenko VV, Kato Y, Gram H, di Padova F, Olson EN, Ulevitch RJ, Han J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-525793",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-525793"
}
],
"reference": [
{
"type": "PubMed",
"id": "9858528",
"url": "https://glygen.org/publication/PubMed/9858528"
}
]
},
{
"title": "EVH1/WH1 domains of VASP and WASP proteins belong to a large family including Ran-binding domains of the RanBP1 family.",
"journal": "FEBS letters",
"date": "1998",
"authors": "Callebaut I, Cossart P, Dehoux P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "9883880",
"url": "https://glygen.org/publication/PubMed/9883880"
}
]
},
{
"title": "A contractile activity that closes phagosomes in macrophages.",
"journal": "Journal of cell science",
"date": "1999",
"authors": "Swanson JA, Johnson MT, Beningo K, Post P, Mooseker M, Araki N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482"
}
],
"reference": [
{
"type": "PubMed",
"id": "9885284",
"url": "https://glygen.org/publication/PubMed/9885284"
}
]
},
{
"title": "FOG-2: A novel GATA-family cofactor related to multitype zinc-finger proteins Friend of GATA-1 and U-shaped.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1999",
"authors": "Tevosian SG, Deconinck AE, Cantor AB, Rieff HI, Fujiwara Y, Corfas G, Orkin SH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983231",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231"
}
],
"reference": [
{
"type": "PubMed",
"id": "9927674",
"url": "https://glygen.org/publication/PubMed/9927674"
}
]
},
{
"title": "p38 mitogen-activated protein kinase pathway promotes skeletal muscle differentiation. Participation of the Mef2c transcription factor.",
"journal": "The Journal of biological chemistry",
"date": "1999",
"authors": "Zetser A, Gredinger E, Bengal E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-525793",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-525793"
}
],
"reference": [
{
"type": "PubMed",
"id": "9988769",
"url": "https://glygen.org/publication/PubMed/9988769"
}
]
}
],
"pathway": [
{
"id": "hsa:25",
"name": "",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:25",
"resource": "KEGG Pathway"
},
{
"id": "R-HSA-2029482",
"name": "Regulation of actin dynamics for phagocytic cup formation",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482",
"resource": "Reactome",
"description": "Regulation of actin dynamics for phagocytic cup formation"
},
{
"id": "R-HSA-428890",
"name": "Role of ABL in ROBO-SLIT signaling",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-428890",
"resource": "Reactome",
"description": "Role of ABL in ROBO-SLIT signaling"
},
{
"id": "R-HSA-525793",
"name": "Myogenesis",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-525793",
"resource": "Reactome",
"description": "Myogenesis"
},
{
"id": "R-HSA-5663213",
"name": "RHO GTPases Activate WASPs and WAVEs",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663213",
"resource": "Reactome",
"description": "RHO GTPases Activate WASPs and WAVEs"
},
{
"id": "R-HSA-5685938",
"name": "HDR through Single Strand Annealing (SSA)",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685938",
"resource": "Reactome",
"description": "HDR through Single Strand Annealing (SSA)"
},
{
"id": "R-HSA-5693565",
"name": "Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565",
"resource": "Reactome",
"description": "Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks"
},
{
"id": "R-HSA-69231",
"name": "Cyclin D associated events in G1",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231",
"resource": "Reactome",
"description": "Cyclin D associated events in G1"
},
{
"id": "R-HSA-8939236",
"name": "RUNX1 regulates transcription of genes involved in differentiation of HSCs",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236",
"resource": "Reactome",
"description": "RUNX1 regulates transcription of genes involved in differentiation of HSCs"
},
{
"id": "R-HSA-8940973",
"name": "RUNX2 regulates osteoblast differentiation",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8940973",
"resource": "Reactome",
"description": "RUNX2 regulates osteoblast differentiation"
},
{
"id": "R-HSA-9664422",
"name": "FCGR3A-mediated phagocytosis",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664422",
"resource": "Reactome",
"description": "FCGR3A-mediated phagocytosis"
},
{
"id": "R-HSA-983231",
"name": "Factors involved in megakaryocyte development and platelet production",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231",
"resource": "Reactome",
"description": "Factors involved in megakaryocyte development and platelet production"
}
],
"orthologs": [
{
"uniprot_canonical_ac": "E9PT20-1",
"protein_name": "Tyrosine-protein kinase",
"gene_name": "Abl1",
"tax_id": 10116,
"organism": "Rattus norvegicus",
"sequence": {
"sequence": "MGQQPGKVLGDQRRPSLPALHFIKGAGKRDSSRHGGPHCNVFVEHEALQRPVASDFEPQGLSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTIYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKRGMRGAAGSTLQAPELPTKTRTCRKTAEQKDAPDALELLHTKGLGESDALDSEPAVSPLLPRKERGPPDGSLNEDERLLPKDKKTNLFSALIKKKKKMAPTPPKRSSSFREMDGQSERRGASEDDGREISNGPPALTSDAVEPTKSPKASNGAGVPNGAFREPGNSGFRSPHVWKKSSTLTSSRLAAAEEESGLSSSKRFLRSCSASCMPHGVRDTEWRSVTLPRDLPSAGKQFDSSTFGGHKSEKPALPRKRTSESRSEQVAKSTATPPPRLVKKTEEAAEDVFKDTESSPGSSPPSLTPKLLRRQVPASPSSGPSHKDEATKGNASGMGTPATAEPAAPSNKAGLSKASSEEPRARRHKHSSESPGRDKGRLSKLKPAPPPPPSSTGKAGKPAQSPSQDVAGEAGGATKTKCTSLSVDAVNSDPTKAGQPGEGLRKSVPPSVPKPQSATKPPGTPTSPVSTPSTAPAPSPLAGDQQPSSAAFIPLISTRVSLRKTRQPPERIASGTITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSYVDSIQQMRNKFAFREAINKLESNLRELQICPATASSGPAATQDFSKLLSSVKEISDIVRR",
"length": 1143
},
"evidence": [
{
"id": "45923082",
"url": "http://www.informatics.jax.org/homology/45923082",
"database": "MGI"
},
{
"id": "P00519",
"url": "https://omabrowser.org/oma/group/P00519/",
"database": "OMA"
}
],
"common_name": "Rat"
},
{
"uniprot_canonical_ac": "P00520-1",
"protein_name": "Tyrosine-protein kinase ABL1",
"gene_name": "Abl1",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MLEICLKLVGCKSKKGLSSSSSCYLEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTIYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKRGTRGGAGSMLQAPELPTKTRTCRRAAEQKDAPDTPELLHTKGLGESDALDSEPAVSPLLPRKERGPPDGSLNEDERLLPRDRKTNLFSALIKKKKKMAPTPPKRSSSFREMDGQPDRRGASEDDSRELCNGPPALTSDAAEPTKSPKASNGAGVPNGAFREPGNSGFRSPHMWKKSSTLTGSRLAAAEEESGMSSSKRFLRSCSASCMPHGARDTEWRSVTLPRDLPSAGKQFDSSTFGGHKSEKPALPRKRTSESRSEQVAKSTAMPPPRLVKKNEEAAEEGFKDTESSPGSSPPSLTPKLLRRQVTASPSSGLSHKEEATKGSASGMGTPATAEPAPPSNKVGLSKASSEEMRVRRHKHSSESPGRDKGRLAKLKPAPPPPPACTGKAGKPAQSPSQEAGEAGGPTKTKCTSLAMDAVNTDPTKAGPPGEGLRKPVPPSVPKPQSTAKPPGTPTSPVSTPSTAPAPSPLAGDQQPSSAAFIPLISTRVSLRKTRQPPERIASGTITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSYVDSIQQMRNKFAFREAINKLESNLRELQICPATASSGPAATQDFSKLLSSVKEISDIVRR",
"length": 1123
},
"evidence": [
{
"id": "45923082",
"url": "http://www.informatics.jax.org/homology/45923082",
"database": "MGI"
},
{
"id": "P00519",
"url": "https://omabrowser.org/oma/group/P00519/",
"database": "OMA"
}
],
"common_name": "Mouse"
}
],
"go_annotation": {
"categories": [
{
"name": "Biological Process",
"total": 116,
"go_terms": [
{
"name": "positive regulation of extracellular matrix organization",
"id": "GO:1903055",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903055",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "DNA conformation change",
"id": "GO:0071103",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071103",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "protein modification process",
"id": "GO:0036211",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036211",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "positive regulation of establishment of T cell polarity",
"id": "GO:1903905",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903905",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "negative regulation of double-strand break repair via homologous recombination",
"id": "GO:2000042",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000042",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "mitotic cell cycle",
"id": "GO:0000278",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000278",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "positive regulation of protein phosphorylation",
"id": "GO:0001934",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001934",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "response to oxidative stress",
"id": "GO:0006979",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006979",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "positive regulation of cytosolic calcium ion concentration",
"id": "GO:0007204",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007204",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "integrin-mediated signaling pathway",
"id": "GO:0007229",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007229",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "associative learning",
"id": "GO:0008306",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008306",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "regulation of autophagy",
"id": "GO:0010506",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010506",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "peptidyl-tyrosine phosphorylation",
"id": "GO:0018108",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0018108",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "regulation of endocytosis",
"id": "GO:0030100",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030100",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "regulation of cell adhesion",
"id": "GO:0030155",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030155",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "regulation of actin cytoskeleton organization",
"id": "GO:0032956",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032956",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "peptidyl-tyrosine autophosphorylation",
"id": "GO:0038083",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038083",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "positive regulation of apoptotic process",
"id": "GO:0043065",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043065",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "positive regulation of mitotic cell cycle",
"id": "GO:0045931",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045931",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "positive regulation of transcription by RNA polymerase II",
"id": "GO:0045944",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "neuromuscular process controlling balance",
"id": "GO:0050885",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050885",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "positive regulation of oxidoreductase activity",
"id": "GO:0051353",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051353",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "neuron apoptotic process",
"id": "GO:0051402",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051402",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "positive regulation of ERK1 and ERK2 cascade",
"id": "GO:0070374",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070374",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "negative regulation of long-term synaptic potentiation",
"id": "GO:1900272",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900272",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "regulation of cell motility",
"id": "GO:2000145",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000145",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "positive regulation of T cell migration",
"id": "GO:2000406",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000406",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "regulation of DNA-templated transcription",
"id": "GO:0006355",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006355",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "positive regulation of endothelial cell migration",
"id": "GO:0010595",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010595",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "T cell receptor signaling pathway",
"id": "GO:0050852",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050852",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "actin cytoskeleton organization",
"id": "GO:0030036",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030036",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "cellular response to lipopolysaccharide",
"id": "GO:0071222",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071222",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "cell-cell adhesion",
"id": "GO:0098609",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098609",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "DNA damage response",
"id": "GO:0006974",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006974",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "positive regulation of canonical NF-kappaB signal transduction",
"id": "GO:0043123",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043123",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "positive regulation of vasoconstriction",
"id": "GO:0045907",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045907",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "protein autophosphorylation",
"id": "GO:0046777",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046777",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "positive regulation of stress fiber assembly",
"id": "GO:0051496",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051496",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "neural tube closure",
"id": "GO:0001843",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001843",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "B-1 B cell homeostasis",
"id": "GO:0001922",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001922",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "B cell proliferation involved in immune response",
"id": "GO:0002322",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002322",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "transitional one stage B cell differentiation",
"id": "GO:0002333",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002333",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "mismatch repair",
"id": "GO:0006298",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006298",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "autophagy",
"id": "GO:0006914",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006914",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "epidermal growth factor receptor signaling pathway",
"id": "GO:0007173",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007173",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "intrinsic apoptotic signaling pathway in response to DNA damage",
"id": "GO:0008630",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008630",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "post-embryonic development",
"id": "GO:0009791",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009791",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "cerebellum morphogenesis",
"id": "GO:0021587",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021587",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "negative regulation of cell-cell adhesion",
"id": "GO:0022408",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022408",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "microspike assembly",
"id": "GO:0030035",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030035",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "neuron differentiation",
"id": "GO:0030182",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030182",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "BMP signaling pathway",
"id": "GO:0030509",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030509",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "negative regulation of BMP signaling pathway",
"id": "GO:0030514",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030514",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "regulation of axon extension",
"id": "GO:0030516",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030516",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "regulation of microtubule polymerization",
"id": "GO:0031113",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031113",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "regulation of Cdc42 protein signal transduction",
"id": "GO:0032489",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032489",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "positive regulation of osteoblast proliferation",
"id": "GO:0033690",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033690",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "substrate adhesion-dependent cell spreading",
"id": "GO:0034446",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034446",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "cellular response to oxidative stress",
"id": "GO:0034599",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034599",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "platelet-derived growth factor receptor-beta signaling pathway",
"id": "GO:0035791",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035791",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "Fc-gamma receptor signaling pathway involved in phagocytosis",
"id": "GO:0038096",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038096",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "neuropilin signaling pathway",
"id": "GO:0038189",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038189",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "signal transduction in response to DNA damage",
"id": "GO:0042770",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042770",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "negative regulation of canonical NF-kappaB signal transduction",
"id": "GO:0043124",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043124",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "endothelial cell migration",
"id": "GO:0043542",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043542",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "regulation of T cell differentiation",
"id": "GO:0045580",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045580",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "negative regulation of mitotic cell cycle",
"id": "GO:0045930",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045930",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "alpha-beta T cell differentiation",
"id": "GO:0046632",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046632",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "spleen development",
"id": "GO:0048536",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048536",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "thymus development",
"id": "GO:0048538",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048538",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "positive regulation of peptidyl-tyrosine phosphorylation",
"id": "GO:0050731",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050731",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "activated T cell proliferation",
"id": "GO:0050798",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050798",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "B cell receptor signaling pathway",
"id": "GO:0050853",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050853",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "positive regulation of release of sequestered calcium ion into cytosol",
"id": "GO:0051281",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051281",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "negative regulation of ubiquitin-protein transferase activity",
"id": "GO:0051444",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051444",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "mitochondrial depolarization",
"id": "GO:0051882",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051882",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "positive regulation of focal adhesion assembly",
"id": "GO:0051894",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051894",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "Bergmann glial cell differentiation",
"id": "GO:0060020",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060020",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "neuroepithelial cell differentiation",
"id": "GO:0060563",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060563",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "cellular response to hydrogen peroxide",
"id": "GO:0070301",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070301",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "ERK1 and ERK2 cascade",
"id": "GO:0070371",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070371",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "negative regulation of ERK1 and ERK2 cascade",
"id": "GO:0070373",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070373",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "negative regulation of protein serine/threonine kinase activity",
"id": "GO:0071901",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071901",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "positive regulation of cell migration involved in sprouting angiogenesis",
"id": "GO:0090050",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090050",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "positive regulation of substrate adhesion-dependent cell spreading",
"id": "GO:1900026",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900026",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "negative regulation of phospholipase C activity",
"id": "GO:1900275",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900275",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "regulation of hematopoietic stem cell differentiation",
"id": "GO:1902036",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902036",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "cellular response to dopamine",
"id": "GO:1903351",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903351",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "positive regulation of microtubule binding",
"id": "GO:1904528",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904528",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "positive regulation of actin filament binding",
"id": "GO:1904531",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904531",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "regulation of modification of synaptic structure",
"id": "GO:1905244",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905244",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "positive regulation of blood vessel branching",
"id": "GO:1905555",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905555",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "activation of protein kinase C activity",
"id": "GO:1990051",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990051",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "positive regulation of Wnt signaling pathway, planar cell polarity pathway",
"id": "GO:2000096",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000096",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "negative regulation of endothelial cell apoptotic process",
"id": "GO:2000352",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000352",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "negative regulation of cellular senescence",
"id": "GO:2000773",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000773",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "positive regulation of type II interferon production",
"id": "GO:0032729",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032729",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "regulation of apoptotic process",
"id": "GO:0042981",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042981",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "cellular response to transforming growth factor beta stimulus",
"id": "GO:0071560",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071560",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "actin filament polymerization",
"id": "GO:0030041",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030041",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "positive regulation of neuron apoptotic process",
"id": "GO:0043525",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043525",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "positive regulation of fibroblast proliferation",
"id": "GO:0048146",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048146",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "canonical NF-kappaB signal transduction",
"id": "GO:0007249",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007249",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "response to xenobiotic stimulus",
"id": "GO:0009410",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009410",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "cellular senescence",
"id": "GO:0090398",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090398",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "positive regulation of interleukin-2 production",
"id": "GO:0032743",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032743",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "response to endoplasmic reticulum stress",
"id": "GO:0034976",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034976",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "cardiac muscle cell proliferation",
"id": "GO:0060038",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060038",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "establishment of localization in cell",
"id": "GO:0051649",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051649",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "response to epinephrine",
"id": "GO:0071871",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071871",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "myoblast proliferation",
"id": "GO:0051450",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051450",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "regulation of cell cycle",
"id": "GO:0051726",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051726",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "positive regulation of dendrite development",
"id": "GO:1900006",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900006",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "podocyte apoptotic process",
"id": "GO:1903210",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903210",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "DN4 thymocyte differentiation",
"id": "GO:1904157",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904157",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "protein localization to cytoplasmic microtubule plus-end",
"id": "GO:1904518",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904518",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
}
]
},
{
"name": "Molecular Function",
"total": 26,
"go_terms": [
{
"name": "magnesium ion binding",
"id": "GO:0000287",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000287",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "phosphotyrosine residue binding",
"id": "GO:0001784",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001784",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "DNA binding",
"id": "GO:0003677",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "transcription coactivator activity",
"id": "GO:0003713",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003713",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "actin monomer binding",
"id": "GO:0003785",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003785",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "protein kinase activity",
"id": "GO:0004672",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004672",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "protein tyrosine kinase activity",
"id": "GO:0004713",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004713",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "non-membrane spanning protein tyrosine kinase activity",
"id": "GO:0004715",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004715",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "ATP binding",
"id": "GO:0005524",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "SH3 domain binding",
"id": "GO:0017124",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017124",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "manganese ion binding",
"id": "GO:0030145",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030145",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "ephrin receptor binding",
"id": "GO:0046875",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046875",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "actin filament binding",
"id": "GO:0051015",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051015",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "mitogen-activated protein kinase binding",
"id": "GO:0051019",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051019",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "protein kinase C binding",
"id": "GO:0005080",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005080",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "protein self-association",
"id": "GO:0043621",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043621",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "proline-rich region binding",
"id": "GO:0070064",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070064",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "nicotinate-nucleotide adenylyltransferase activity",
"id": "GO:0004515",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004515",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "syntaxin binding",
"id": "GO:0019905",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019905",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "neuropilin binding",
"id": "GO:0038191",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038191",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "SH2 domain binding",
"id": "GO:0042169",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042169",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "kinase activity",
"id": "GO:0016301",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016301",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "four-way junction DNA binding",
"id": "GO:0000400",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000400",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "bubble DNA binding",
"id": "GO:0000405",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000405",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "delta-catenin binding",
"id": "GO:0070097",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070097",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "sequence-specific double-stranded DNA binding",
"id": "GO:1990837",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990837",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
}
]
},
{
"name": "Cellular Component",
"total": 16,
"go_terms": [
{
"name": "nucleus",
"id": "GO:0005634",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "nucleoplasm",
"id": "GO:0005654",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "nucleolus",
"id": "GO:0005730",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "cytoplasm",
"id": "GO:0005737",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "mitochondrion",
"id": "GO:0005739",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "cytosol",
"id": "GO:0005829",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "actin cytoskeleton",
"id": "GO:0015629",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015629",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "dendrite",
"id": "GO:0030425",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030425",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "growth cone",
"id": "GO:0030426",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030426",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "nuclear membrane",
"id": "GO:0031965",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031965",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "neuronal cell body",
"id": "GO:0043025",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043025",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "perinuclear region of cytoplasm",
"id": "GO:0048471",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "postsynapse",
"id": "GO:0098794",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098794",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "nuclear body",
"id": "GO:0016604",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016604",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "ruffle",
"id": "GO:0001726",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001726",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
},
{
"name": "protein-containing complex",
"id": "GO:0032991",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032991",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
}
],
"pmid": ""
}
]
}
]
},
"pro_annotation": [],
"site_annotation": [
{
"start_pos": 146,
"end_pos": 148,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 770,
"end_pos": 772,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 812,
"end_pos": 814,
"annotation": "n_glycosylation_sequon"
}
],
"ptm_annotation": [
{
"annotation": "Acetylated at Lys-711 by EP300 which promotes the cytoplasmic translocation.",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "PubMed",
"id": "16648821",
"url": "https://glygen.org/publication/PubMed/16648821"
}
]
},
{
"annotation": "Polyubiquitinated. Polyubiquitination of ABL1 leads to degradation.",
"evidence": [
{
"database": "UniProtKB",
"id": "P00519",
"url": "https://www.uniprot.org/uniprot/P00519"
},
{
"database": "PubMed",
"id": "12475393",
"url": "https://glygen.org/publication/PubMed/12475393"
}
]
}
],
"interactions": [],
"reactions": [
{
"id": "10596",
"name": "",
"equation": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q9WUD9-1",
"P57760-1",
"P35739-1",
"F1LYY7-1",
"A0A8I6GCV6-1",
"Q63132-1",
"Q63117-1",
"Q5U2X5-1",
"Q63474-1",
"Q4V8A3-1",
"O08680-1",
"O35346-1",
"P54757-1",
"P54758-1",
"P54759-1",
"P70600-1",
"Q00495-1",
"Q03351-1",
"Q04589-1",
"P06494-1",
"P09759-1",
"P29321-1",
"P32577-1",
"Q6XUX2-1",
"Q62662-1",
"Q62799-1",
"Q62844-1",
"Q62956-1",
"Q63184-1",
"Q63470-1",
"Q498D6-1",
"Q01621-1",
"Q6P6U0-1",
"Q63604-1",
"P09760-1",
"Q01986-1",
"Q62862-1",
"Q63572-1",
"Q07014-1",
"Q4KSH7-1",
"G3V9H8-1",
"P15127-1",
"O08775-1",
"P53767-1",
"Q05030-1",
"P55146-1",
"Q64725-1",
"Q63802-1",
"Q64716-1",
"P09215-1",
"Q62689-1",
"F1LM93-1",
"P36506-1",
"P20786-1",
"P24062-1",
"Q924U5-1",
"Q63272-1",
"B2RYC7-1",
"P41243-1",
"M0RDA4-1",
"Q62838-1",
"Q63116-1",
"A0A8I6AM23-1",
"P50545-1",
"P57097-1",
"P97523-1",
"Q91ZT1-1",
"D4A7W7-1",
"F1LVI0-1",
"E9PSY0-1",
"A0A0G2K6M9-1",
"F1LSN4-1",
"F1MAJ0-1",
"A0A0R4J8U1-1",
"A0A8I6A5T6-1",
"D3ZDS3-1",
"D4ADZ5-1",
"F1LSG7-1",
"F1LRZ0-1",
"D3ZBN3-1",
"F1M0N1-1",
"G3V6K6-1",
"D3ZD03-1",
"D3ZZK3-1",
"E9PT20-1",
"D4A584-1",
"D3ZDH4-1",
"A0A8I5ZVE3-1",
"A0A8I6AWX7-1",
"Q4KM97-1",
"Q501W1-1",
"B5DFD6-1",
"Q5FVG7-1",
"D3ZCD0-1",
"A0A8I5ZP97-1",
"A0A0G2JW59-1",
"B1WC09-1",
"Q01134-1",
"P11980-1",
"G3V783-1",
"D3ZJI4-1",
"Q4KSH6-1",
"M0R7E7-1",
"Q925D6-1",
"Q9UM73-1",
"O15146-1",
"P42679-1",
"P08922-1",
"P07947-1",
"Q12866-1",
"P00519-1",
"Q07912-1",
"P42684-1",
"Q9UF33-1",
"P10721-1",
"P08069-1",
"P06239-1",
"P04626-1",
"P51451-1",
"Q06187-1",
"P51813-1",
"Q9UIG0-1",
"P49760-1",
"P49761-4",
"Q9HAZ1-1",
"P49759-1",
"P07333-1",
"Q5JZY3-1",
"Q6XUX3-1",
"P00533-1",
"Q9Y463-1",
"P29317-1",
"Q9NR20-1",
"Q13627-1",
"P54760-1",
"P41240-1",
"Q16832-1",
"Q15375-1",
"P29323-1",
"P22455-1",
"P16591-1",
"P29322-1",
"P54756-1",
"P29320-1",
"Q08345-1",
"Q92630-1",
"P54753-1",
"Q15303-1",
"P21860-1",
"Q14289-1",
"O43781-1",
"P54764-1",
"P19525-1",
"P21709-1",
"P54762-1",
"P22607-1",
"P21802-1",
"P52333-1",
"P11362-1",
"P42685-1",
"P06213-1",
"P14616-1",
"Q05655-1",
"Q08881-1",
"P07332-1",
"P08631-1",
"P29376-1",
"Q05397-1",
"O60674-1",
"P23458-1",
"P36888-1",
"P09769-1",
"P06241-1",
"P43405-1",
"P07948-1",
"P46734-1",
"P45985-1",
"Q02750-1",
"P52564-1",
"O14733-1",
"Q13163-1",
"Q16288-1",
"P36507-1",
"Q16620-1",
"P08581-1",
"P04629-1",
"Q14680-1",
"Q01974-1",
"P09619-1",
"P07949-1",
"Q504Y2-1",
"P34925-1",
"P16234-1",
"Q13882-1",
"Q04912-1",
"O43353-1",
"Q06418-1",
"P30530-1",
"Q96KB5-1",
"Q15569-1",
"Q96S53-1",
"Q6J9G0-1",
"P42680-1",
"P35916-2",
"P0C1S8-1",
"P17948-1",
"P29597-1",
"P42681-1",
"P35590-1",
"Q13470-1",
"P33981-1",
"P30291-1",
"P12931-1",
"P35968-1",
"P43403-1",
"O75716-1",
"Q02763-1",
"Q9H3Y6-1",
"P35790-1",
"P14618-1",
"P24604-1",
"Q9Z188-1",
"P35969-1",
"P52332-1",
"P08923-1",
"Q00342-1",
"Q62120-1",
"Q4JIM5-1",
"P97504-1",
"P42682-1",
"Q60629-1",
"O54967-1",
"P00520-1",
"P97793-1",
"P16277-1",
"O35491-1",
"O35492-1",
"O35493-1",
"Q9Z277-1",
"P35991-1",
"P22518-1",
"Q8BYG9-1",
"P54754-1",
"P54761-1",
"Q6XUX1-1",
"Q62371-1",
"Q60750-1",
"Q61527-1",
"Q62413-1",
"Q61214-1",
"Q61772-1",
"Q61851-1",
"Q922Y0-1",
"Q922K9-1",
"O09127-1",
"P16092-1",
"Q03142-1",
"P29319-1",
"Q01279-1",
"P70424-1",
"P21803-1",
"Q8CBF3-1",
"P41241-1",
"Q03963-1",
"Q8BI55-1",
"P54763-3",
"P16879-1",
"P09581-1",
"P34152-3",
"P14234-1",
"P39688-1",
"Q03146-1",
"Q03145-1",
"Q61526-1",
"P70451-1",
"Q5U4C9-1",
"Q9QVP9-1",
"Q03137-1",
"Q60751-1",
"Q62137-1",
"P28867-1",
"P25911-1",
"P48025-1",
"Q9WTL4-1",
"P41242-1",
"P05532-1",
"P06240-1",
"P08103-1",
"P15208-1",
"Q03526-1",
"Q9WVS7-1",
"P70236-1",
"P31938-1",
"P47809-1",
"Q61846-1",
"Q60805-1",
"Q63932-1",
"O09110-1",
"P26618-1",
"Q8CE90-1",
"P16056-1",
"P05622-1",
"P15209-1",
"Q6VNS1-1",
"Q61006-1",
"Q3UFB7-1",
"Q5RJI4-1",
"Q9JJ78-1",
"P58801-1",
"Q8VCT9-1",
"O70146-1",
"Q62190-1",
"Q62270-1",
"P35546-1",
"P35761-1",
"Q9Z138-1",
"Q9R117-1",
"O88697-1",
"P05480-2",
"Q01887-1",
"Q02858-1",
"Q06806-1",
"Q00993-1",
"Q64434-1",
"Q6J9G1-1",
"Q99ML2-1",
"Q78DX7-1",
"P55144-1",
"P43404-1",
"P35917-1",
"P47810-1",
"P35918-1",
"Q04736-1",
"Q66JT0-1",
"O54804-1",
"P52480-1",
"P14680-1",
"P21965-1",
"P22216-1",
"P32490-1",
"P06784-1",
"P08018-1",
"P32350-1",
"P32491-1",
"P54199-1",
"Q54G28-1",
"Q54N73-1",
"Q54R58-1",
"P18160-1",
"P18161-1",
"Q54BC9-1",
"Q54I36-1",
"Q54QV3-1",
"Q552C6-1",
"Q55CL6-1",
"Q75JK0-1",
"Q76NV1-1",
"Q23977-1",
"P18475-1",
"P13368-1",
"Q24145-1",
"Q24488-1",
"Q27324-1",
"P08630-1",
"P00522-1",
"P00528-1",
"P04412-1",
"Q9V422-1",
"Q9V6K3-1",
"Q9V9J3-1",
"Q9VBW3-1",
"P09208-1",
"P49762-1",
"P83102-1",
"Q24324-1",
"Q9VPC0-1",
"P49657-1",
"P54350-1",
"P18106-4",
"Q07407-1",
"Q09147-1",
"Q24592-1",
"Q9I7F7-1",
"Q9V3D5-1",
"Q9VZI2-1",
"Q8INJ8-1",
"Q7KJ08-1",
"Q9VJ04-1",
"E1JHB7-1",
"Q9VE06-1",
"O61444-1",
"O62602-1",
"Q9VZA8-1",
"Q7KT06-1"
],
"evidence": [
{
"id": "10596",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/10596"
}
]
},
{
"id": "R-HSA-1013833",
"name": "Cables link CDK5 and ABL1",
"equation": "",
"summary": "CDK5 and ABL1 enzyme substrate 1 (Cables1) is a negative regulator of cell proliferation. Loss of Cables1 function can lead to uncontrolled growth in vivo, observed in many human cancers, such as colon, lung and gynecological malignancies including ovarian and endometrial cancers (Sakamoto et al. 2008). Cables1 is up-regulated by progesterone and down-regulated by estrogen (Zukerberg et al. 2004). Cables1 is predominantly located in the nucleus of proliferating cells (Zukerberg et al. 2000, Wu et al. 2001) but some fully differentiated cells such as mature neurons have a significant proportion in the cytoplasm. Cables1 interacts with cyclin-dependent kinases (Cdk) 2, 3 and 5 (Wu et al. 2001, Matsuoka et al. 2000, Zukerberg et al. 2000). In neurons, Cables1 links Cdk5 and c-Abl, enhancing Cdk5 tyrosine-15 phosphorylation which results in increased Cdk5 activity, important in neurite outgrowth (Zukerberg et al. 2000). In proliferating cells, Cables1 links Cdk2 and Wee1, a dual specificity kinase. Phosphorylation of Cdk2 on tyrosine-15 by Wee-1 leads to decreased Cdk2 activity, Cables1 enhances this inhibitory phosphorylation (Wu et al. 2001). Cables1 has also been shown to interact with two regulators of apoptosis, p53 and p73. The physiological relevance of this interaction is not fully understood, but Cables1 augments p53-induced apoptosis in human osteosarcoma cells (Tsuji et al. 2002). Cables2 interacts with Cdk3, Cdk5 and c-Abl (Sato et al. 2002).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00519-1",
"Q00535-1"
],
"evidence": [
{
"id": "R-HSA-1013833",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1013833"
}
]
},
{
"id": "R-HSA-2130194",
"name": "ABL phosphorylates WAVEs",
"equation": "",
"summary": "Abelson interactor-1 (ABL) tyrosine kinase phosphorylates the strictly conserved tyrosine 150 in WAVE2 (Y151 in WAVE1 and WAVE3) (Leng et al. 2003, Chen et al. 2010).",
"cellular_location": "cytosol, plasma membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00519-1",
"P63000-1"
],
"evidence": [
{
"id": "R-HSA-2130194",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2130194"
}
]
},
{
"id": "R-HSA-376141",
"name": "Interaction of ABL with ROBO1:SLIT2",
"equation": "",
"summary": "ABL (ABL1 or ABL2) binds directly, via its SH3 domain, to the CC3 motif in the cytoplasmic domain of human ROBO1 (Bashaw et al. 2000).",
"cellular_location": "cytosol, plasma membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00519-1",
"P42684-1"
],
"evidence": [
{
"id": "R-HSA-376141",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-376141"
}
]
},
{
"id": "R-HSA-428883",
"name": "Recruitment of CAP to ABL",
"equation": "",
"summary": "ABL (ABL1 or ABL2) associated with the complex of ROBO1, SLIT2, and glypican-1 (GPC1) at the plasma membrane binds CAP (CAP1 or CAP2) and regulates its activity to inhibit net actin assembly. Studies of CAP homologs from yeast, Dictyostelium, mouse, pig, and human suggest that the C-terminal actin binding domain acts to sequester actin monomers to prevent actin polymerization (Wills et al. 2002).",
"cellular_location": "cytosol, plasma membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00519-1",
"P42684-1"
],
"evidence": [
{
"id": "R-HSA-428883",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-428883"
}
]
},
{
"id": "R-HSA-428885",
"name": "Activation of CLASP",
"equation": "",
"summary": "CLASP (CLASP1 or CLASP2) acts positively downstream of ABL (ABL1 or ABL2) as part of the repellent response initiated by activation of ROBO1. CLASP is spatially positioned to interact with ROBO receptors. SLIT mediated repulsion results in activation of CLASP, presumably through its phosphorylation by the ABL kinase. Activation of CLASP in turn results in inhibition of microtubule polymerization on the side of the growth cone receiving the repulsive signal and consequently the growth cone turns to the opposite side. A direct link between ABL and CLASP, notably the mechanism of CLASP activation, has not been demonstrated, however (Wills et al. 2002, Lee et al. 2004, Kalil and Dent 2004).",
"cellular_location": "cytosol, plasma membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00519-1",
"P42684-1"
],
"evidence": [
{
"id": "R-HSA-428885",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-428885"
}
]
},
{
"id": "R-HSA-428888",
"name": "Phosphorylation of ROBO1 by ABL kinase",
"equation": "",
"summary": "ABL kinase (ABL1 or ABL2) phosphorylates the tyrosine residue Y1073 of the conserved CC1 motif (PTPYATT) in human ROBO1 (Bashaw et al. 2000).",
"cellular_location": "cytosol, plasma membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00519-1",
"P42684-1"
],
"evidence": [
{
"id": "R-HSA-428888",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-428888"
}
]
},
{
"id": "R-HSA-448951",
"name": "Activation of p38 alpha/beta MAPK",
"equation": "",
"summary": "p38 alpha/beta MAPK is well established as a promyogenic kinase, but the mechanism by which it is activated during differentiation is not well understood. CDO, JLP and p38 form a ternary complex and it is anticipated that in its role as a scaffold, JLP brings additional components of the pathway, such as MKKs, to these complexes and cooperate to activate p38 alpha/beta MAPK pathway. p38 is activated by phosphorylation on a canonical TxY motif by dual specificity kinases MKK6 and MKK3. MKK6 is the most abundant in skeletal muscles and displays minimal substrate selectivity among all p38 isoforms.",
"cellular_location": "plasma membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00519-1",
"P60953-2",
"Q16539-1",
"P53778-1",
"P52564-1",
"Q15759-1"
],
"evidence": [
{
"id": "R-HSA-448951",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-448951"
}
]
},
{
"id": "R-HSA-448957",
"name": "Interaction of p38 MAPK with JLP",
"equation": "",
"summary": "JLP is a p38 alpha/beta MAPK scaffold protein. p38 alpha/beta MAPK binds to two sites within JLP (amino acids 1-110 and 160-209), neither of which overlaps the CDO binding region.",
"cellular_location": "cytosol, plasma membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00519-1",
"P60953-2",
"Q16539-1",
"P53778-1",
"Q15759-1"
],
"evidence": [
{
"id": "R-HSA-448957",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-448957"
}
]
},
{
"id": "R-HSA-448958",
"name": "Nuclear translocation of p38 MAPK",
"equation": "",
"summary": "p38 MAPK is activated by phosphorylation in response to CDO-BOC interactions. Activated p38 MAPK may translocate into the nucleus to further activate myogenic related transcription factors.",
"cellular_location": "plasma membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00519-1",
"P60953-2",
"Q16539-1",
"P53778-1",
"Q15759-1"
],
"evidence": [
{
"id": "R-HSA-448958",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-448958"
}
]
},
{
"id": "R-HSA-449200",
"name": "Interaction of ABL1 with CDO complex",
"equation": "",
"summary": "ABL binds to the cytoplasmic tail of CDO and also to the p38 MAPK scaffold protein JLP. ABL binds a proline-rich motif in CDO via its SH3 domain, and ABL is necessary for full activation of p38 MAPK, during myogenic differentiation.",
"cellular_location": "cytosol, plasma membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00519-1",
"P60953-2"
],
"evidence": [
{
"id": "R-HSA-449200",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449200"
}
]
},
{
"id": "R-HSA-5686578",
"name": "Activated ATM phosphorylates ABL1",
"equation": "",
"summary": "ATM, activated in response to DNA damage in the form of double-strand breaks, phosphorylates ABL1 (c-ABL) on serine residue S456, resulting in the activation of kinase activity of ABL1 (Baskaran et al. 1997).",
"cellular_location": "nucleoplasm",
"input_participant_list": [
"R-HSA-5686579"
],
"output_participant_list": [
"R-HSA-5686576"
],
"enzyme_list": [
"P00519-1",
"Q13315-1"
],
"evidence": [
{
"id": "R-HSA-5686578",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686578"
}
]
},
{
"id": "R-HSA-5686587",
"name": "ABL1 phosphorylates RAD52",
"equation": "",
"summary": "ABL1 (c-ABL), activated by ATM-mediated phosphorylation in response to DNA double-strand breaks (DSBs), phosphorylates RAD52 on tyrosine residue Y104, thus increasing the affinity of RAD52 heptamer for ssDNA and enhancing the efficiency of RAD52-mediated single strand annealing (SSA) (Honda et al. 2011).",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00519-1"
],
"evidence": [
{
"id": "R-HSA-5686587",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686587"
}
]
},
{
"id": "R-HSA-8942607",
"name": "Tyrosine kinases phosphorylate Cip/Kip inhibitors bound to CDK4/6:CCND complexes",
"equation": "",
"summary": "Phosphorylation of Cip/Kip cyclin-dependent kinase (CDK) inhibitors CDKN1A (p21Cip), CDKN1B (p27Kip1) and CDKN1C (p57Kip2) on conserved tyrosine residues Y77, Y88 and Y91, respectively, can convert them from bound inhbitors to bound non-inhibitors of CDK4 or CDK6 complexes with D cyclins by dislodging them from the active site of CDK4 or CDK6. This mechanism was studied in most detail on the example of CDKN1B associated with the CDK2:CCNA complex (Grimmler et al. 2007) and the CDK4:CCND1 complex (James et al. 2008, Patel et al. 2015). For a review of this topic, please refer to Blain 2008.
CDKN1A can be phosphorylated at tyrosine residue Y77 by protein tyrosine kinase ABL1 (Hukkelhoven et al. 2012). CDKN1B can be phosphorylated at tyrosine residue Y88, and probably also at the adjacent Y89, by protein tyrosine kinases ABL1 (Grimmler et al. 2007, James et al. 2008, Ray et al. 2009, Ou et al. 2011), LYN (Grimmler et al. 2007), SRC (Larrea et al. 2008), JAK2 (Jakel et al. 2011) and PTK6 (Patel et al. 2015). CDKN1C can be phosphorylated at tyrosine residue Y91 by protein tyrosine kinase ABL1 (Borriello et al. 2011).
Dislodgment of the tyrosine phosphorylated 3-10 helix of Cip/Kip CDK inhibitors from the active site of cyclin D-bound CDK4 or CDK6 results in increased catalytic activity of CDK4 or CDK6 by allowing ATP binding to the active site, but also by enabling activating phosphorylation of the T-loop of CDK4 or CDK6 phosphorylation by CDK7 in complex with cyclin H (Ray et al. 2009).
SRC-mediated phosphorylation of CDKN1B on tyrosine residue Y88 was shown to reduce protein stability of CDKN1B (Chu et al. 2007).
Without overexpression of BCR-ABL or SRC-family tyrosine kinases in several cell systems, tyrosine phosphorylated p27 is either undetectable or a very low abundance species (Ishida et al. 2000, Jaimes et al. 2008, Grimmler et al. 2007) that does not bind preferentially to CDK4 (Jaimes et al. 2008). Therefore, tyrosine phosphorylation of p27 is unlikely to be the sole explanation of the full activity of p27-bound CDK4:CCND complexes reported in previous studies (Blain et al. 1997, Coulonval et al. 2003, Bockstaele et al. 2006). It has been proposed that stoichiometry of the Cip/Kip complex with CDK4 or CDK6 and cyclin D, in addition to or alternative to tyrosine phosphorylation of Cip/Kip CDK inhibitors, determines their inhibitory role where binding of more than one molecule of CDKN1A, CDKN1B or CDKN1C would be needed to achieve inhibition of the CDK4/6:CCND complex (reviewed by Paternot et al. 2010).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q13882-1",
"O60674-1",
"P00519-1",
"P07948-1",
"P11802-1",
"Q00534-1"
],
"evidence": [
{
"id": "R-HSA-8942607",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8942607"
}
]
},
{
"id": "R-HSA-8956639",
"name": "RUNX1 binds YAP1",
"equation": "",
"summary": "RUNX1, presumably in complex with CBFB, binds to YAP1 (Levy, Adamovich et al. 2008; Levy, Reuven and Shaul 2008). Phosphorylation of YAP1 by ABL1 in response to DNA damage prevents binding of YAP1 to RUNX1 (Levy, Adamovich et al. 2008).",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00519-1"
],
"evidence": [
{
"id": "R-HSA-8956639",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8956639"
}
]
},
{
"id": "R-HSA-8956659",
"name": "ABL1 phosphorylates YAP1",
"equation": "",
"summary": "In response to DNA damage, ABL1 phosphorylates YAP1 on tyrosine residue Y407 (corresponds to Y357 in the YAP1 splicing isoform 3, known as YAP1-1beta, which was used in the study by Levy, Adamovich et al. 2008).",
"cellular_location": "nucleoplasm",
"input_participant_list": [
"R-HSA-1253322"
],
"output_participant_list": [
"R-HSA-8956661"
],
"enzyme_list": [
"P00519-1"
],
"evidence": [
{
"id": "R-HSA-8956659",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8956659"
}
]
},
{
"id": "R-HSA-8985227",
"name": "The complex of RUNX2 and WWTR1 (TAZ) binds the BGLAP gene promoter",
"equation": "",
"summary": "Based on studies in mouse cells, the complex of RUNX2 and WWTR1 (TAZ) binds to the promoter of the BGLAP gene, encoding osteocalcin (Hong et al. 2005). Catalytically active protein tyrosine kinase ABL1 promotes association of RUNX2 and WWTR1 and transcription of the BGLAP gene (Matsumoto et al. 2016). RUNX2 binding sites are conserved in the human BGLAP gene promoter.",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00519-1"
],
"evidence": [
{
"id": "R-HSA-8985227",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8985227"
}
]
}
],
"reaction_participants": [
{
"participant_id": "R-HSA-1253322",
"participant_name": "YAP1 [nucleoplasm]",
"crossref": [
{
"id": "P46937",
"database": "UniProt",
"url": ""
},
{
"id": "6GE6",
"database": "PDB",
"url": ""
},
{
"id": "1JMQ",
"database": "PDB",
"url": ""
},
{
"id": "1K5R",
"database": "PDB",
"url": ""
},
{
"id": "6GEC",
"database": "PDB",
"url": ""
},
{
"id": "6GEI",
"database": "PDB",
"url": ""
},
{
"id": "2LAX",
"database": "PDB",
"url": ""
},
{
"id": "6GEK",
"database": "PDB",
"url": ""
},
{
"id": "2LAW",
"database": "PDB",
"url": ""
},
{
"id": "22672",
"database": "Orphanet",
"url": ""
},
{
"id": "1K9Q",
"database": "PDB",
"url": ""
},
{
"id": "6GEE",
"database": "PDB",
"url": ""
},
{
"id": "1K9R",
"database": "PDB",
"url": ""
},
{
"id": "6GEG",
"database": "PDB",
"url": ""
},
{
"id": "3KYS",
"database": "PDB",
"url": ""
},
{
"id": "NP_001181974.1",
"database": "RefSeq",
"url": ""
},
{
"id": "2LTW",
"database": "PDB",
"url": ""
},
{
"id": "3MHR",
"database": "PDB",
"url": ""
},
{
"id": "6HIK",
"database": "PDB",
"url": ""
},
{
"id": "6HIL",
"database": "PDB",
"url": ""
},
{
"id": "NP_001181973.1",
"database": "RefSeq",
"url": ""
},
{
"id": "2LAY",
"database": "PDB",
"url": ""
},
{
"id": "2LTV",
"database": "PDB",
"url": ""
},
{
"id": "NP_001123617.1",
"database": "RefSeq",
"url": ""
},
{
"id": "5OAQ",
"database": "PDB",
"url": ""
},
{
"id": "NP_001269027.1",
"database": "RefSeq",
"url": ""
},
{
"id": "5YDX",
"database": "PDB",
"url": ""
},
{
"id": "4REX",
"database": "PDB",
"url": ""
},
{
"id": "NP_001269026.1",
"database": "RefSeq",
"url": ""
},
{
"id": "6Q2X",
"database": "PDB",
"url": ""
},
{
"id": "7O07",
"database": "PDB",
"url": ""
},
{
"id": "4RE1",
"database": "PDB",
"url": ""
},
{
"id": "NP_001269029.1",
"database": "RefSeq",
"url": ""
},
{
"id": "ENST00000629586",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSG00000137693-YAP1",
"database": "HPA",
"url": ""
},
{
"id": "ENSP00000478927",
"database": "Ensembl",
"url": ""
},
{
"id": "5YDY",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000524575",
"database": "Ensembl",
"url": ""
},
{
"id": "6G8I",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000537274",
"database": "Ensembl",
"url": ""
},
{
"id": "6G6X",
"database": "PDB",
"url": ""
},
{
"id": "6GE5",
"database": "PDB",
"url": ""
},
{
"id": "6GE4",
"database": "PDB",
"url": ""
},
{
"id": "P46937",
"database": "GeneCards",
"url": ""
},
{
"id": "6G8P",
"database": "PDB",
"url": ""
},
{
"id": "6G8L",
"database": "PDB",
"url": ""
},
{
"id": "P46937",
"database": "PRO",
"url": ""
},
{
"id": "ENSG00000137693",
"database": "OpenTargets",
"url": ""
},
{
"id": "6GE3",
"database": "PDB",
"url": ""
},
{
"id": "6G8Q",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000345877",
"database": "Ensembl",
"url": ""
},
{
"id": "P46937",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "ENSG00000137693",
"database": "Ensembl",
"url": ""
},
{
"id": "ENST00000282441",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSP00000434134",
"database": "Ensembl",
"url": ""
},
{
"id": "ENST00000615667",
"database": "Ensembl",
"url": ""
},
{
"id": "6G8K",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000445635",
"database": "Ensembl",
"url": ""
},
{
"id": "NP_001269030.1",
"database": "RefSeq",
"url": ""
},
{
"id": "ENSP00000331023",
"database": "Ensembl",
"url": ""
},
{
"id": "6G8J",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000487519",
"database": "Ensembl",
"url": ""
},
{
"id": "ENST00000531439",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSP00000431574",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSP00000282441",
"database": "Ensembl",
"url": ""
},
{
"id": "ENST00000526343",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSP00000435602",
"database": "Ensembl",
"url": ""
},
{
"id": "8A8R",
"database": "PDB",
"url": ""
},
{
"id": "8A8Q",
"database": "PDB",
"url": ""
},
{
"id": "NP_001269028.1",
"database": "RefSeq",
"url": ""
}
]
},
{
"participant_id": "R-HSA-5686576",
"participant_name": "p-S456-ABL1 [nucleoplasm]",
"crossref": [
{
"id": "3EG2",
"database": "PDB",
"url": ""
},
{
"id": "ABL1_HUMAN",
"database": "ZINC - Biogenic",
"url": ""
},
{
"id": "ABL1_HUMAN",
"database": "ZINC - World Drugs",
"url": ""
},
{
"id": "P00519",
"database": "PRO",
"url": ""
},
{
"id": "4J9C",
"database": "PDB",
"url": ""
},
{
"id": "7PW2",
"database": "PDB",
"url": ""
},
{
"id": "4JJD",
"database": "PDB",
"url": ""
},
{
"id": "2F4J",
"database": "PDB",
"url": ""
},
{
"id": "ABL1_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "1BBZ",
"database": "PDB",
"url": ""
},
{
"id": "15062",
"database": "Orphanet",
"url": ""
},
{
"id": "6AMW",
"database": "PDB",
"url": ""
},
{
"id": "P00519",
"database": "UniProt",
"url": ""
},
{
"id": "4YC8",
"database": "PDB",
"url": ""
},
{
"id": "2HZ0",
"database": "PDB",
"url": ""
},
{
"id": "7N9G",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000097007-ABL1",
"database": "HPA",
"url": ""
},
{
"id": "3T04",
"database": "PDB",
"url": ""
},
{
"id": "6XR6",
"database": "PDB",
"url": ""
},
{
"id": "5DC0",
"database": "PDB",
"url": ""
},
{
"id": "4J9G",
"database": "PDB",
"url": ""
},
{
"id": "P00519",
"database": "GeneCards",
"url": ""
},
{
"id": "2G2I",
"database": "PDB",
"url": ""
},
{
"id": "8H7H",
"database": "PDB",
"url": ""
},
{
"id": "5MO4",
"database": "PDB",
"url": ""
},
{
"id": "3QRJ",
"database": "PDB",
"url": ""
},
{
"id": "5OAZ",
"database": "PDB",
"url": ""
},
{
"id": "6XRG",
"database": "PDB",
"url": ""
},
{
"id": "3UYO",
"database": "PDB",
"url": ""
},
{
"id": "1AWO",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000318560",
"database": "Ensembl",
"url": ""
},
{
"id": "2HZ4",
"database": "PDB",
"url": ""
},
{
"id": "4JJB",
"database": "PDB",
"url": ""
},
{
"id": "7PVS",
"database": "PDB",
"url": ""
},
{
"id": "NP_009297.2",
"database": "RefSeq",
"url": ""
},
{
"id": "3EGU",
"database": "PDB",
"url": ""
},
{
"id": "1JU5",
"database": "PDB",
"url": ""
},
{
"id": "3CS9",
"database": "PDB",
"url": ""
},
{
"id": "4J9I",
"database": "PDB",
"url": ""
},
{
"id": "7W7Y",
"database": "PDB",
"url": ""
},
{
"id": "4WA9",
"database": "PDB",
"url": ""
},
{
"id": "ABL1_HUMAN",
"database": "ZINC - FDA approved",
"url": ""
},
{
"id": "7DT2",
"database": "PDB",
"url": ""
},
{
"id": "2ABL",
"database": "PDB",
"url": ""
},
{
"id": "2HZI",
"database": "PDB",
"url": ""
},
{
"id": "4J9E",
"database": "PDB",
"url": ""
},
{
"id": "5DC9",
"database": "PDB",
"url": ""
},
{
"id": "3PYY",
"database": "PDB",
"url": ""
},
{
"id": "6NPE",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000361423",
"database": "Ensembl",
"url": ""
},
{
"id": "2G2F",
"database": "PDB",
"url": ""
},
{
"id": "4J9F",
"database": "PDB",
"url": ""
},
{
"id": "5NP2",
"database": "PDB",
"url": ""
},
{
"id": "ABL1_HUMAN",
"database": "ZINC - Investigational",
"url": ""
},
{
"id": "P00519",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "1AB2",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000097007",
"database": "Ensembl",
"url": ""
},
{
"id": "2FO0",
"database": "PDB",
"url": ""
},
{
"id": "4JJC",
"database": "PDB",
"url": ""
},
{
"id": "7PVV",
"database": "PDB",
"url": ""
},
{
"id": "ABL1_HUMAN",
"database": "ZINC - Metabolites",
"url": ""
},
{
"id": "3EG1",
"database": "PDB",
"url": ""
},
{
"id": "1ZZP",
"database": "PDB",
"url": ""
},
{
"id": "2O88",
"database": "PDB",
"url": ""
},
{
"id": "4J9B",
"database": "PDB",
"url": ""
},
{
"id": "8H7F",
"database": "PDB",
"url": ""
},
{
"id": "4XEY",
"database": "PDB",
"url": ""
},
{
"id": "2HIW",
"database": "PDB",
"url": ""
},
{
"id": "HMDBP01402",
"database": "HMDB Protein",
"url": ""
},
{
"id": "2E2B",
"database": "PDB",
"url": ""
},
{
"id": "3QRK",
"database": "PDB",
"url": ""
},
{
"id": "6NPV",
"database": "PDB",
"url": ""
},
{
"id": "5DC4",
"database": "PDB",
"url": ""
},
{
"id": "3QRI",
"database": "PDB",
"url": ""
},
{
"id": "6NPU",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000372348",
"database": "Ensembl",
"url": ""
},
{
"id": "1923",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "P00519",
"database": "ZINC target",
"url": ""
},
{
"id": "7W7X",
"database": "PDB",
"url": ""
},
{
"id": "3EG3",
"database": "PDB",
"url": ""
},
{
"id": "NP_005148.2",
"database": "RefSeq",
"url": ""
},
{
"id": "7PVR",
"database": "PDB",
"url": ""
},
{
"id": "2G2H",
"database": "PDB",
"url": ""
},
{
"id": "3EG0",
"database": "PDB",
"url": ""
},
{
"id": "4J9H",
"database": "PDB",
"url": ""
},
{
"id": "ABL1_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "3UE4",
"database": "PDB",
"url": ""
},
{
"id": "6XR7",
"database": "PDB",
"url": ""
},
{
"id": "7PVQ",
"database": "PDB",
"url": ""
},
{
"id": "2HYY",
"database": "PDB",
"url": ""
},
{
"id": "4ZOG",
"database": "PDB",
"url": ""
},
{
"id": "6AMV",
"database": "PDB",
"url": ""
},
{
"id": "6BL8",
"database": "PDB",
"url": ""
},
{
"id": "3K2M",
"database": "PDB",
"url": ""
},
{
"id": "5HU9",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000323315",
"database": "Ensembl",
"url": ""
},
{
"id": "2G1T",
"database": "PDB",
"url": ""
},
{
"id": "4TWP",
"database": "PDB",
"url": ""
},
{
"id": "7CC2",
"database": "PDB",
"url": ""
},
{
"id": "4J9D",
"database": "PDB",
"url": ""
},
{
"id": "2V7A",
"database": "PDB",
"url": ""
},
{
"id": "1OPL",
"database": "PDB",
"url": ""
},
{
"id": "2GQG",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000097007",
"database": "OpenTargets",
"url": ""
}
]
},
{
"participant_id": "R-HSA-5686579",
"participant_name": "ABL1 [nucleoplasm]",
"crossref": [
{
"id": "P00519",
"database": "UniProt",
"url": ""
},
{
"id": "7W7X",
"database": "PDB",
"url": ""
},
{
"id": "7W7Y",
"database": "PDB",
"url": ""
},
{
"id": "8H7F",
"database": "PDB",
"url": ""
},
{
"id": "8H7H",
"database": "PDB",
"url": ""
},
{
"id": "7PVR",
"database": "PDB",
"url": ""
},
{
"id": "7PVS",
"database": "PDB",
"url": ""
},
{
"id": "7PVV",
"database": "PDB",
"url": ""
},
{
"id": "7PW2",
"database": "PDB",
"url": ""
},
{
"id": "7CC2",
"database": "PDB",
"url": ""
},
{
"id": "7DT2",
"database": "PDB",
"url": ""
},
{
"id": "HMDBP01402",
"database": "HMDB Protein",
"url": ""
},
{
"id": "7N9G",
"database": "PDB",
"url": ""
},
{
"id": "7PVQ",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000318560",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSG00000097007",
"database": "Ensembl",
"url": ""
},
{
"id": "ABL1_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "ENSP00000323315",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSP00000361423",
"database": "Ensembl",
"url": ""
},
{
"id": "ENST00000372348",
"database": "Ensembl",
"url": ""
},
{
"id": "P00519",
"database": "GeneCards",
"url": ""
},
{
"id": "3EG0",
"database": "PDB",
"url": ""
},
{
"id": "3CS9",
"database": "PDB",
"url": ""
},
{
"id": "2O88",
"database": "PDB",
"url": ""
},
{
"id": "P00519",
"database": "PRO",
"url": ""
},
{
"id": "2V7A",
"database": "PDB",
"url": ""
},
{
"id": "2HZI",
"database": "PDB",
"url": ""
},
{
"id": "3QRK",
"database": "PDB",
"url": ""
},
{
"id": "3T04",
"database": "PDB",
"url": ""
},
{
"id": "3UE4",
"database": "PDB",
"url": ""
},
{
"id": "3UYO",
"database": "PDB",
"url": ""
},
{
"id": "P00519",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "15062",
"database": "Orphanet",
"url": ""
},
{
"id": "3K2M",
"database": "PDB",
"url": ""
},
{
"id": "3PYY",
"database": "PDB",
"url": ""
},
{
"id": "3QRI",
"database": "PDB",
"url": ""
},
{
"id": "3QRJ",
"database": "PDB",
"url": ""
},
{
"id": "3EG3",
"database": "PDB",
"url": ""
},
{
"id": "3EGU",
"database": "PDB",
"url": ""
},
{
"id": "3EG1",
"database": "PDB",
"url": ""
},
{
"id": "3EG2",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000097007",
"database": "OpenTargets",
"url": ""
},
{
"id": "4WA9",
"database": "PDB",
"url": ""
},
{
"id": "4XEY",
"database": "PDB",
"url": ""
},
{
"id": "4YC8",
"database": "PDB",
"url": ""
},
{
"id": "4ZOG",
"database": "PDB",
"url": ""
},
{
"id": "4JJB",
"database": "PDB",
"url": ""
},
{
"id": "4JJC",
"database": "PDB",
"url": ""
},
{
"id": "4JJD",
"database": "PDB",
"url": ""
},
{
"id": "4TWP",
"database": "PDB",
"url": ""
},
{
"id": "4J9F",
"database": "PDB",
"url": ""
},
{
"id": "P00519",
"database": "ZINC target",
"url": ""
},
{
"id": "4J9G",
"database": "PDB",
"url": ""
},
{
"id": "4J9H",
"database": "PDB",
"url": ""
},
{
"id": "4J9I",
"database": "PDB",
"url": ""
},
{
"id": "4J9B",
"database": "PDB",
"url": ""
},
{
"id": "4J9C",
"database": "PDB",
"url": ""
},
{
"id": "4J9D",
"database": "PDB",
"url": ""
},
{
"id": "4J9E",
"database": "PDB",
"url": ""
},
{
"id": "6NPV",
"database": "PDB",
"url": ""
},
{
"id": "6XR6",
"database": "PDB",
"url": ""
},
{
"id": "6XR7",
"database": "PDB",
"url": ""
},
{
"id": "6XRG",
"database": "PDB",
"url": ""
},
{
"id": "ABL1_HUMAN",
"database": "ZINC - Investigational",
"url": ""
},
{
"id": "6AMW",
"database": "PDB",
"url": ""
},
{
"id": "6BL8",
"database": "PDB",
"url": ""
},
{
"id": "6NPE",
"database": "PDB",
"url": ""
},
{
"id": "6NPU",
"database": "PDB",
"url": ""
},
{
"id": "5MO4",
"database": "PDB",
"url": ""
},
{
"id": "NP_005148.2",
"database": "RefSeq",
"url": ""
},
{
"id": "NP_009297.2",
"database": "RefSeq",
"url": ""
},
{
"id": "ABL1_HUMAN",
"database": "ZINC - Metabolites",
"url": ""
},
{
"id": "ABL1_HUMAN",
"database": "ZINC - Biogenic",
"url": ""
},
{
"id": "2GQG",
"database": "PDB",
"url": ""
},
{
"id": "ABL1_HUMAN",
"database": "ZINC - FDA approved",
"url": ""
},
{
"id": "2HIW",
"database": "PDB",
"url": ""
},
{
"id": "2HZ0",
"database": "PDB",
"url": ""
},
{
"id": "2HYY",
"database": "PDB",
"url": ""
},
{
"id": "2HZ4",
"database": "PDB",
"url": ""
},
{
"id": "2FO0",
"database": "PDB",
"url": ""
},
{
"id": "2F4J",
"database": "PDB",
"url": ""
},
{
"id": "2G1T",
"database": "PDB",
"url": ""
},
{
"id": "2G2F",
"database": "PDB",
"url": ""
},
{
"id": "1923",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "2G2I",
"database": "PDB",
"url": ""
},
{
"id": "2G2H",
"database": "PDB",
"url": ""
},
{
"id": "1JU5",
"database": "PDB",
"url": ""
},
{
"id": "1ZZP",
"database": "PDB",
"url": ""
},
{
"id": "ABL1_HUMAN",
"database": "ZINC - World Drugs",
"url": ""
},
{
"id": "1OPL",
"database": "PDB",
"url": ""
},
{
"id": "2ABL",
"database": "PDB",
"url": ""
},
{
"id": "2E2B",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000097007-ABL1",
"database": "HPA",
"url": ""
},
{
"id": "ABL1_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "1AWO",
"database": "PDB",
"url": ""
},
{
"id": "1AB2",
"database": "PDB",
"url": ""
},
{
"id": "1BBZ",
"database": "PDB",
"url": ""
},
{
"id": "5HU9",
"database": "PDB",
"url": ""
},
{
"id": "5DC9",
"database": "PDB",
"url": ""
},
{
"id": "5DC4",
"database": "PDB",
"url": ""
},
{
"id": "5DC0",
"database": "PDB",
"url": ""
},
{
"id": "6AMV",
"database": "PDB",
"url": ""
},
{
"id": "5OAZ",
"database": "PDB",
"url": ""
},
{
"id": "5NP2",
"database": "PDB",
"url": ""
}
]
},
{
"participant_id": "R-HSA-8956661",
"participant_name": "p-Y407-YAP1 [nucleoplasm]",
"crossref": [
{
"id": "6GE5",
"database": "PDB",
"url": ""
},
{
"id": "22672",
"database": "Orphanet",
"url": ""
},
{
"id": "ENSP00000445635",
"database": "Ensembl",
"url": ""
},
{
"id": "NP_001269027.1",
"database": "RefSeq",
"url": ""
},
{
"id": "ENST00000526343",
"database": "Ensembl",
"url": ""
},
{
"id": "ENST00000629586",
"database": "Ensembl",
"url": ""
},
{
"id": "3MHR",
"database": "PDB",
"url": ""
},
{
"id": "6G8Q",
"database": "PDB",
"url": ""
},
{
"id": "6GE6",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000524575",
"database": "Ensembl",
"url": ""
},
{
"id": "6GEI",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000282441",
"database": "Ensembl",
"url": ""
},
{
"id": "2LAY",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000487519",
"database": "Ensembl",
"url": ""
},
{
"id": "6Q2X",
"database": "PDB",
"url": ""
},
{
"id": "6GEG",
"database": "PDB",
"url": ""
},
{
"id": "6G8L",
"database": "PDB",
"url": ""
},
{
"id": "8A8R",
"database": "PDB",
"url": ""
},
{
"id": "4RE1",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000431574",
"database": "Ensembl",
"url": ""
},
{
"id": "NP_001181974.1",
"database": "RefSeq",
"url": ""
},
{
"id": "ENSG00000137693",
"database": "OpenTargets",
"url": ""
},
{
"id": "6GEK",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000537274",
"database": "Ensembl",
"url": ""
},
{
"id": "ENST00000615667",
"database": "Ensembl",
"url": ""
},
{
"id": "NP_001123617.1",
"database": "RefSeq",
"url": ""
},
{
"id": "1K5R",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000478927",
"database": "Ensembl",
"url": ""
},
{
"id": "P46937",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "6HIL",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000331023",
"database": "Ensembl",
"url": ""
},
{
"id": "4REX",
"database": "PDB",
"url": ""
},
{
"id": "6GEE",
"database": "PDB",
"url": ""
},
{
"id": "P46937",
"database": "GeneCards",
"url": ""
},
{
"id": "NP_001269028.1",
"database": "RefSeq",
"url": ""
},
{
"id": "NP_001269029.1",
"database": "RefSeq",
"url": ""
},
{
"id": "ENSP00000282441",
"database": "Ensembl",
"url": ""
},
{
"id": "2LTW",
"database": "PDB",
"url": ""
},
{
"id": "6GE3",
"database": "PDB",
"url": ""
},
{
"id": "2LAW",
"database": "PDB",
"url": ""
},
{
"id": "6G6X",
"database": "PDB",
"url": ""
},
{
"id": "6G8K",
"database": "PDB",
"url": ""
},
{
"id": "5OAQ",
"database": "PDB",
"url": ""
},
{
"id": "6GEC",
"database": "PDB",
"url": ""
},
{
"id": "6G8P",
"database": "PDB",
"url": ""
},
{
"id": "1K9R",
"database": "PDB",
"url": ""
},
{
"id": "6G8J",
"database": "PDB",
"url": ""
},
{
"id": "NP_001269026.1",
"database": "RefSeq",
"url": ""
},
{
"id": "8A8Q",
"database": "PDB",
"url": ""
},
{
"id": "5YDY",
"database": "PDB",
"url": ""
},
{
"id": "NP_001181973.1",
"database": "RefSeq",
"url": ""
},
{
"id": "ENSG00000137693",
"database": "Ensembl",
"url": ""
},
{
"id": "P46937",
"database": "UniProt",
"url": ""
},
{
"id": "ENSG00000137693-YAP1",
"database": "HPA",
"url": ""
},
{
"id": "1JMQ",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000345877",
"database": "Ensembl",
"url": ""
},
{
"id": "6HIK",
"database": "PDB",
"url": ""
},
{
"id": "NP_001269030.1",
"database": "RefSeq",
"url": ""
},
{
"id": "5YDX",
"database": "PDB",
"url": ""
},
{
"id": "1K9Q",
"database": "PDB",
"url": ""
},
{
"id": "6GE4",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000435602",
"database": "Ensembl",
"url": ""
},
{
"id": "7O07",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000531439",
"database": "Ensembl",
"url": ""
},
{
"id": "3KYS",
"database": "PDB",
"url": ""
},
{
"id": "P46937",
"database": "PRO",
"url": ""
},
{
"id": "2LAX",
"database": "PDB",
"url": ""
},
{
"id": "2LTV",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000434134",
"database": "Ensembl",
"url": ""
},
{
"id": "6G8I",
"database": "PDB",
"url": ""
}
]
}
],
"reaction_enzymes": [
{
"uniprot_ac": "A0A0G2JW59",
"gene_name": "Flt3",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "A0A0G2JW59",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A0G2JW59"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "A0A0G2JW59",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A0G2JW59"
}
]
}
]
},
{
"uniprot_ac": "A0A0G2K6M9",
"gene_name": "Btk",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "A0A0G2K6M9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A0G2K6M9"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "A0A0G2K6M9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A0G2K6M9"
}
]
}
]
},
{
"uniprot_ac": "A0A0R4J8U1",
"gene_name": "Zap70",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "A0A0R4J8U1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A0R4J8U1"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "A0A0R4J8U1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A0R4J8U1"
}
]
}
]
},
{
"uniprot_ac": "A0A8I5ZP97",
"gene_name": "Dyrk1b",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "A0A8I5ZP97",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A8I5ZP97"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "A0A8I5ZP97",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A8I5ZP97"
}
]
}
]
},
{
"uniprot_ac": "A0A8I5ZVE3",
"gene_name": "Ephb3",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "A0A8I5ZVE3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A8I5ZVE3"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "A0A8I5ZVE3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A8I5ZVE3"
}
]
}
]
},
{
"uniprot_ac": "A0A8I6A5T6",
"gene_name": "Mst1r",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "A0A8I6A5T6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A8I6A5T6"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "A0A8I6A5T6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A8I6A5T6"
}
]
}
]
},
{
"uniprot_ac": "A0A8I6AM23",
"gene_name": "Jak1",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "A0A8I6AM23",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A8I6AM23"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "A0A8I6AM23",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A8I6AM23"
}
]
}
]
},
{
"uniprot_ac": "A0A8I6AWX7",
"gene_name": "Dyrk4",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "A0A8I6AWX7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A8I6AWX7"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "A0A8I6AWX7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A8I6AWX7"
}
]
}
]
},
{
"uniprot_ac": "A0A8I6GCV6",
"gene_name": "Ltk",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "A0A8I6GCV6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A8I6GCV6"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "A0A8I6GCV6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A8I6GCV6"
}
]
}
]
},
{
"uniprot_ac": "B1WC09",
"gene_name": "Ddr2",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "B1WC09",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/B1WC09"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "B1WC09",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/B1WC09"
}
]
}
]
},
{
"uniprot_ac": "B2RYC7",
"gene_name": "Tec",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "B2RYC7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/B2RYC7"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "B2RYC7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/B2RYC7"
}
]
}
]
},
{
"uniprot_ac": "B5DFD6",
"gene_name": "Tie1",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "B5DFD6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/B5DFD6"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "B5DFD6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/B5DFD6"
}
]
}
]
},
{
"uniprot_ac": "D3ZBN3",
"gene_name": "Epha2",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "D3ZBN3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/D3ZBN3"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "D3ZBN3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/D3ZBN3"
}
]
}
]
},
{
"uniprot_ac": "D3ZCD0",
"gene_name": "Tek",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "D3ZCD0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/D3ZCD0"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "D3ZCD0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/D3ZCD0"
}
]
}
]
},
{
"uniprot_ac": "D3ZD03",
"gene_name": "Tyk2",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "D3ZD03",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/D3ZD03"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "D3ZD03",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/D3ZD03"
}
]
}
]
},
{
"uniprot_ac": "D3ZDH4",
"gene_name": "Epha1",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "D3ZDH4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/D3ZDH4"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "D3ZDH4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/D3ZDH4"
}
]
}
]
},
{
"uniprot_ac": "D3ZDS3",
"gene_name": "Ptk6",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "D3ZDS3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/D3ZDS3"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "D3ZDS3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/D3ZDS3"
}
]
}
]
},
{
"uniprot_ac": "D3ZJI4",
"gene_name": "Tnk1",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "D3ZJI4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/D3ZJI4"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "D3ZJI4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/D3ZJI4"
}
]
}
]
},
{
"uniprot_ac": "D3ZZK3",
"gene_name": "Epha4",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "D3ZZK3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/D3ZZK3"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "D3ZZK3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/D3ZZK3"
}
]
}
]
},
{
"uniprot_ac": "D4A584",
"gene_name": "Fes",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "D4A584",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/D4A584"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "D4A584",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/D4A584"
}
]
}
]
},
{
"uniprot_ac": "D4A7W7",
"gene_name": "Itk",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "D4A7W7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/D4A7W7"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "D4A7W7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/D4A7W7"
}
]
}
]
},
{
"uniprot_ac": "D4ADZ5",
"gene_name": "Wee2",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "D4ADZ5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/D4ADZ5"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "D4ADZ5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/D4ADZ5"
}
]
}
]
},
{
"uniprot_ac": "E1JHB7",
"gene_name": "Pvr",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "E1JHB7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/E1JHB7"
}
]
}
]
},
{
"uniprot_ac": "E9PSY0",
"gene_name": "Axl",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "E9PSY0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/E9PSY0"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "E9PSY0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/E9PSY0"
}
]
}
]
},
{
"uniprot_ac": "E9PT20",
"gene_name": "Abl1",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "E9PT20",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/E9PT20"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "E9PT20",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/E9PT20"
}
]
}
]
},
{
"uniprot_ac": "F1LM93",
"gene_name": "Yes1",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "F1LM93",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F1LM93"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "F1LM93",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F1LM93"
}
]
}
]
},
{
"uniprot_ac": "F1LRZ0",
"gene_name": "Alk",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "F1LRZ0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F1LRZ0"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "F1LRZ0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F1LRZ0"
}
]
}
]
},
{
"uniprot_ac": "F1LSG7",
"gene_name": "Fgfr2",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "F1LSG7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F1LSG7"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "F1LSG7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F1LSG7"
}
]
}
]
},
{
"uniprot_ac": "F1LSN4",
"gene_name": "Fgfr3",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "F1LSN4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F1LSN4"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "F1LSN4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F1LSN4"
}
]
}
]
},
{
"uniprot_ac": "F1LVI0",
"gene_name": "Bmx",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "F1LVI0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F1LVI0"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "F1LVI0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F1LVI0"
}
]
}
]
},
{
"uniprot_ac": "F1LYY7",
"gene_name": "Dyrk2",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "F1LYY7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F1LYY7"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "F1LYY7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F1LYY7"
}
]
}
]
},
{
"uniprot_ac": "F1M0N1",
"gene_name": "Abl2",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "F1M0N1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F1M0N1"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "F1M0N1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F1M0N1"
}
]
}
]
},
{
"uniprot_ac": "F1MAJ0",
"gene_name": "Ephb2",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "F1MAJ0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F1MAJ0"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "F1MAJ0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F1MAJ0"
}
]
}
]
},
{
"uniprot_ac": "G3V6K6",
"gene_name": "Egfr",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "G3V6K6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/G3V6K6"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "G3V6K6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/G3V6K6"
}
]
}
]
},
{
"uniprot_ac": "G3V783",
"gene_name": "Ripk2",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "G3V783",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/G3V783"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "G3V783",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/G3V783"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "G3V783",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/G3V783"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "G3V783",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/G3V783"
}
]
}
]
},
{
"uniprot_ac": "G3V9H8",
"gene_name": "Ret",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "G3V9H8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/G3V9H8"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "G3V9H8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/G3V9H8"
}
]
}
]
},
{
"uniprot_ac": "M0R7E7",
"gene_name": "Map2k3",
"activity": [
{
"ec_number": "2.7.12.2",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "M0R7E7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/M0R7E7"
}
]
},
{
"ec_number": "2.7.12.2",
"activity": "",
"evidence": [
{
"id": "M0R7E7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/M0R7E7"
}
]
}
]
},
{
"uniprot_ac": "M0RDA4",
"gene_name": "Ephb4",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "M0RDA4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/M0RDA4"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "M0RDA4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/M0RDA4"
}
]
}
]
},
{
"uniprot_ac": "O08680",
"gene_name": "Epha3",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "O08680",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O08680"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "O08680",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O08680"
}
]
}
]
},
{
"uniprot_ac": "O08775",
"gene_name": "Kdr",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "O08775",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O08775"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "O08775",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O08775"
}
]
}
]
},
{
"uniprot_ac": "O09110",
"gene_name": "Map2k3",
"activity": [
{
"ec_number": "2.7.12.2",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "O09110",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O09110"
}
]
},
{
"ec_number": "2.7.12.2",
"activity": "",
"evidence": [
{
"id": "O09110",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O09110"
}
]
}
]
},
{
"uniprot_ac": "O09127",
"gene_name": "Epha8",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "O09127",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O09127"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "O09127",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O09127"
}
]
}
]
},
{
"uniprot_ac": "O14733",
"gene_name": "MAP2K7",
"activity": [
{
"ec_number": "2.7.12.2",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "O14733",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14733"
}
]
},
{
"ec_number": "2.7.12.2",
"activity": "",
"evidence": [
{
"id": "O14733",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14733"
}
]
}
]
},
{
"uniprot_ac": "O15146",
"gene_name": "MUSK",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "O15146",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O15146"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "O15146",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O15146"
}
]
}
]
},
{
"uniprot_ac": "O35346",
"gene_name": "Ptk2",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "O35346",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O35346"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "O35346",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O35346"
}
]
}
]
},
{
"uniprot_ac": "O35491",
"gene_name": "Clk2",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "O35491",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O35491"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "O35491",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O35491"
}
]
}
]
},
{
"uniprot_ac": "O35492",
"gene_name": "Clk3",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "O35492",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O35492"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "O35492",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O35492"
}
]
}
]
},
{
"uniprot_ac": "O35493",
"gene_name": "Clk4",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "O35493",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O35493"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "O35493",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O35493"
}
]
}
]
},
{
"uniprot_ac": "O43353",
"gene_name": "RIPK2",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "O43353",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O43353"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "O43353",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O43353"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "O43353",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O43353"
}
]
}
]
},
{
"uniprot_ac": "O43781",
"gene_name": "DYRK3",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "O43781",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O43781"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "O43781",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O43781"
}
]
}
]
},
{
"uniprot_ac": "O54804",
"gene_name": "Chka",
"activity": [
{
"ec_number": "2.7.1.32",
"activity": "ATP + choline = ADP + H(+) + phosphocholine.",
"evidence": [
{
"id": "O54804",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O54804"
}
]
},
{
"ec_number": "2.7.1.82",
"activity": "ATP + ethanolamine = ADP + H(+) + phosphoethanolamine.",
"evidence": [
{
"id": "O54804",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O54804"
}
]
},
{
"ec_number": "2.7.1.32",
"activity": "",
"evidence": [
{
"id": "O54804",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O54804"
}
]
},
{
"ec_number": "2.7.1.82",
"activity": "",
"evidence": [
{
"id": "O54804",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O54804"
}
]
}
]
},
{
"uniprot_ac": "O54967",
"gene_name": "Tnk2",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "O54967",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O54967"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "O54967",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O54967"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "O54967",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O54967"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "O54967",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O54967"
}
]
}
]
},
{
"uniprot_ac": "O60674",
"gene_name": "JAK2",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "O60674",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O60674"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "O60674",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O60674"
}
]
}
]
},
{
"uniprot_ac": "O61444",
"gene_name": "Mkk4",
"activity": [
{
"ec_number": "2.7.12.2",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "O61444",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O61444"
}
]
},
{
"ec_number": "2.7.12.2",
"activity": "",
"evidence": [
{
"id": "O61444",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O61444"
}
]
}
]
},
{
"uniprot_ac": "O62602",
"gene_name": "lic",
"activity": [
{
"ec_number": "2.7.12.2",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "O62602",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O62602"
}
]
},
{
"ec_number": "2.7.12.2",
"activity": "",
"evidence": [
{
"id": "O62602",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O62602"
}
]
}
]
},
{
"uniprot_ac": "O70146",
"gene_name": "Tesk1",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "O70146",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O70146"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "O70146",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O70146"
}
]
}
]
},
{
"uniprot_ac": "O75716",
"gene_name": "STK16",
"activity": [
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "O75716",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O75716"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "O75716",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O75716"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "O75716",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O75716"
}
]
}
]
},
{
"uniprot_ac": "O88697",
"gene_name": "Stk16",
"activity": [
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "O88697",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O88697"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "O88697",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O88697"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "O88697",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O88697"
}
]
}
]
},
{
"uniprot_ac": "P00519",
"gene_name": "ABL1",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P00519",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00519"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P00519",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00519"
}
]
}
]
},
{
"uniprot_ac": "P00520",
"gene_name": "Abl1",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P00520",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00520"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P00520",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00520"
}
]
}
]
},
{
"uniprot_ac": "P00522",
"gene_name": "Abl",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P00522",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00522"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P00522",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00522"
}
]
}
]
},
{
"uniprot_ac": "P00528",
"gene_name": "Src64B",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P00528",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00528"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P00528",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00528"
}
]
}
]
},
{
"uniprot_ac": "P00533",
"gene_name": "EGFR",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P00533",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00533"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P00533",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00533"
}
]
}
]
},
{
"uniprot_ac": "P04412",
"gene_name": "Egfr",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P04412",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04412"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P04412",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04412"
}
]
}
]
},
{
"uniprot_ac": "P04626",
"gene_name": "ERBB2",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P04626",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04626"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P04626",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04626"
}
]
}
]
},
{
"uniprot_ac": "P04629",
"gene_name": "NTRK1",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P04629",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04629"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P04629",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04629"
}
]
}
]
},
{
"uniprot_ac": "P05480",
"gene_name": "Src",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P05480",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P05480"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P05480",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P05480"
}
]
}
]
},
{
"uniprot_ac": "P05532",
"gene_name": "Kit",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P05532",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P05532"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P05532",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P05532"
}
]
}
]
},
{
"uniprot_ac": "P05622",
"gene_name": "Pdgfrb",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P05622",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P05622"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P05622",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P05622"
}
]
}
]
},
{
"uniprot_ac": "P06213",
"gene_name": "INSR",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P06213",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P06213"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P06213",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P06213"
}
]
}
]
},
{
"uniprot_ac": "P06239",
"gene_name": "LCK",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P06239",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P06239"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P06239",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P06239"
}
]
}
]
},
{
"uniprot_ac": "P06240",
"gene_name": "Lck",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P06240",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P06240"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P06240",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P06240"
}
]
}
]
},
{
"uniprot_ac": "P06241",
"gene_name": "FYN",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P06241",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P06241"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P06241",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P06241"
}
]
}
]
},
{
"uniprot_ac": "P06494",
"gene_name": "Erbb2",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P06494",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P06494"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P06494",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P06494"
}
]
}
]
},
{
"uniprot_ac": "P06784",
"gene_name": "STE7",
"activity": [
{
"ec_number": "2.7.12.2",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P06784",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P06784"
}
]
},
{
"ec_number": "2.7.12.2",
"activity": "",
"evidence": [
{
"id": "P06784",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P06784"
}
]
}
]
},
{
"uniprot_ac": "P07332",
"gene_name": "FES",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P07332",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07332"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P07332",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07332"
}
]
}
]
},
{
"uniprot_ac": "P07333",
"gene_name": "CSF1R",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P07333",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07333"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P07333",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07333"
}
]
}
]
},
{
"uniprot_ac": "P07947",
"gene_name": "YES1",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P07947",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07947"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P07947",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07947"
}
]
}
]
},
{
"uniprot_ac": "P07948",
"gene_name": "LYN",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P07948",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07948"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P07948",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07948"
}
]
}
]
},
{
"uniprot_ac": "P07949",
"gene_name": "RET",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P07949",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07949"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P07949",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07949"
}
]
}
]
},
{
"uniprot_ac": "P08018",
"gene_name": "PBS2",
"activity": [
{
"ec_number": "2.7.12.2",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P08018",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08018"
}
]
},
{
"ec_number": "2.7.12.2",
"activity": "",
"evidence": [
{
"id": "P08018",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08018"
}
]
}
]
},
{
"uniprot_ac": "P08069",
"gene_name": "IGF1R",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P08069",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08069"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P08069",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08069"
}
]
}
]
},
{
"uniprot_ac": "P08103",
"gene_name": "Hck",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P08103",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08103"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P08103",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08103"
}
]
}
]
},
{
"uniprot_ac": "P08581",
"gene_name": "MET",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P08581",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08581"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P08581",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08581"
}
]
}
]
},
{
"uniprot_ac": "P08630",
"gene_name": "Btk",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P08630",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08630"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P08630",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08630"
}
]
}
]
},
{
"uniprot_ac": "P08631",
"gene_name": "HCK",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P08631",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08631"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P08631",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08631"
}
]
}
]
},
{
"uniprot_ac": "P08922",
"gene_name": "ROS1",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P08922",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08922"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P08922",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08922"
}
]
}
]
},
{
"uniprot_ac": "P08923",
"gene_name": "Ltk",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P08923",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08923"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P08923",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08923"
}
]
}
]
},
{
"uniprot_ac": "P09208",
"gene_name": "InR",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P09208",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09208"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P09208",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09208"
}
]
}
]
},
{
"uniprot_ac": "P09215",
"gene_name": "Prkcd",
"activity": [
{
"ec_number": "2.7.11.13",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P09215",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09215"
}
]
},
{
"ec_number": "2.7.11.13",
"activity": "",
"evidence": [
{
"id": "P09215",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09215"
}
]
}
]
},
{
"uniprot_ac": "P09581",
"gene_name": "Csf1r",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P09581",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09581"
}
]
}
]
},
{
"uniprot_ac": "P09619",
"gene_name": "PDGFRB",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P09619",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09619"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P09619",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09619"
}
]
}
]
},
{
"uniprot_ac": "P09759",
"gene_name": "Ephb1",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P09759",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09759"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P09759",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09759"
}
]
}
]
},
{
"uniprot_ac": "P09760",
"gene_name": "Fer",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P09760",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09760"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P09760",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09760"
}
]
}
]
},
{
"uniprot_ac": "P09769",
"gene_name": "FGR",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P09769",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09769"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P09769",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09769"
}
]
}
]
},
{
"uniprot_ac": "P0C1S8",
"gene_name": "WEE2",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P0C1S8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C1S8"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P0C1S8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C1S8"
}
]
}
]
},
{
"uniprot_ac": "P10721",
"gene_name": "KIT",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P10721",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10721"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P10721",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10721"
}
]
}
]
},
{
"uniprot_ac": "P11362",
"gene_name": "FGFR1",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P11362",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11362"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P11362",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11362"
}
]
}
]
},
{
"uniprot_ac": "P11802",
"gene_name": "CDK4",
"activity": [
{
"ec_number": "2.7.11.22",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P11802",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11802"
}
]
},
{
"ec_number": "2.7.11.22",
"activity": "",
"evidence": [
{
"id": "P11802",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11802"
}
]
}
]
},
{
"uniprot_ac": "P11980",
"gene_name": "Pkm",
"activity": [
{
"ec_number": "2.7.1.40",
"activity": "CTP + pyruvate = CDP + H(+) + phosphoenolpyruvate.",
"evidence": [
{
"id": "P11980",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11980"
}
]
},
{
"ec_number": "2.7.1.40",
"activity": "",
"evidence": [
{
"id": "P11980",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11980"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P11980",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11980"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P11980",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11980"
}
]
}
]
},
{
"uniprot_ac": "P12931",
"gene_name": "SRC",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P12931",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P12931"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P12931",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P12931"
}
]
}
]
},
{
"uniprot_ac": "P13368",
"gene_name": "sev",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P13368",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P13368"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P13368",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P13368"
}
]
}
]
},
{
"uniprot_ac": "P14234",
"gene_name": "Fgr",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P14234",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14234"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P14234",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14234"
}
]
}
]
},
{
"uniprot_ac": "P14616",
"gene_name": "INSRR",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P14616",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14616"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P14616",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14616"
}
]
}
]
},
{
"uniprot_ac": "P14618",
"gene_name": "PKM",
"activity": [
{
"ec_number": "2.7.1.40",
"activity": "CTP + pyruvate = CDP + H(+) + phosphoenolpyruvate.",
"evidence": [
{
"id": "P14618",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14618"
}
]
},
{
"ec_number": "2.7.1.40",
"activity": "",
"evidence": [
{
"id": "P14618",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14618"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P14618",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14618"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P14618",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14618"
}
]
}
]
},
{
"uniprot_ac": "P14680",
"gene_name": "YAK1",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P14680",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14680"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "P14680",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14680"
}
]
}
]
},
{
"uniprot_ac": "P15127",
"gene_name": "Insr",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P15127",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P15127"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P15127",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P15127"
}
]
}
]
},
{
"uniprot_ac": "P15208",
"gene_name": "Insr",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P15208",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P15208"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P15208",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P15208"
}
]
}
]
},
{
"uniprot_ac": "P15209",
"gene_name": "Ntrk2",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P15209",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P15209"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P15209",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P15209"
}
]
}
]
},
{
"uniprot_ac": "P16056",
"gene_name": "Met",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P16056",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P16056"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P16056",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P16056"
}
]
}
]
},
{
"uniprot_ac": "P16092",
"gene_name": "Fgfr1",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P16092",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P16092"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P16092",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P16092"
}
]
}
]
},
{
"uniprot_ac": "P16234",
"gene_name": "PDGFRA",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P16234",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P16234"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P16234",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P16234"
}
]
}
]
},
{
"uniprot_ac": "P16277",
"gene_name": "Blk",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P16277",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P16277"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P16277",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P16277"
}
]
}
]
},
{
"uniprot_ac": "P16591",
"gene_name": "FER",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P16591",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P16591"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P16591",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P16591"
}
]
}
]
},
{
"uniprot_ac": "P16879",
"gene_name": "Fes",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P16879",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P16879"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P16879",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P16879"
}
]
}
]
},
{
"uniprot_ac": "P17948",
"gene_name": "FLT1",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P17948",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P17948"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P17948",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P17948"
}
]
}
]
},
{
"uniprot_ac": "P18106",
"gene_name": "FER",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P18106",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P18106"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P18106",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P18106"
}
]
}
]
},
{
"uniprot_ac": "P18160",
"gene_name": "splA",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P18160",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P18160"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P18160",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P18160"
}
]
}
]
},
{
"uniprot_ac": "P18161",
"gene_name": "splB",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P18161",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P18161"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P18161",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P18161"
}
]
}
]
},
{
"uniprot_ac": "P18475",
"gene_name": "tor",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P18475",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P18475"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P18475",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P18475"
}
]
}
]
},
{
"uniprot_ac": "P19525",
"gene_name": "EIF2AK2",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P19525",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P19525"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P19525",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P19525"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "P19525",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P19525"
}
]
}
]
},
{
"uniprot_ac": "P20786",
"gene_name": "Pdgfra",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P20786",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20786"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P20786",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20786"
}
]
}
]
},
{
"uniprot_ac": "P21709",
"gene_name": "EPHA1",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P21709",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P21709"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P21709",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P21709"
}
]
}
]
},
{
"uniprot_ac": "P21802",
"gene_name": "FGFR2",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P21802",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P21802"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P21802",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P21802"
}
]
}
]
},
{
"uniprot_ac": "P21803",
"gene_name": "Fgfr2",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P21803",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P21803"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P21803",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P21803"
}
]
}
]
},
{
"uniprot_ac": "P21860",
"gene_name": "ERBB3",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P21860",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P21860"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P21860",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P21860"
}
]
}
]
},
{
"uniprot_ac": "P21965",
"gene_name": "MCK1",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P21965",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P21965"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "P21965",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P21965"
}
]
}
]
},
{
"uniprot_ac": "P22216",
"gene_name": "RAD53",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P22216",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P22216"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "P22216",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P22216"
}
]
}
]
},
{
"uniprot_ac": "P22455",
"gene_name": "FGFR4",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P22455",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P22455"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P22455",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P22455"
}
]
}
]
},
{
"uniprot_ac": "P22518",
"gene_name": "Clk1",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P22518",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P22518"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "P22518",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P22518"
}
]
}
]
},
{
"uniprot_ac": "P22607",
"gene_name": "FGFR3",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P22607",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P22607"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P22607",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P22607"
}
]
}
]
},
{
"uniprot_ac": "P23458",
"gene_name": "JAK1",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P23458",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P23458"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P23458",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P23458"
}
]
}
]
},
{
"uniprot_ac": "P24062",
"gene_name": "Igf1r",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P24062",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24062"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P24062",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24062"
}
]
}
]
},
{
"uniprot_ac": "P24604",
"gene_name": "Tec",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P24604",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24604"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P24604",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24604"
}
]
}
]
},
{
"uniprot_ac": "P25911",
"gene_name": "Lyn",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P25911",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P25911"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P25911",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P25911"
}
]
}
]
},
{
"uniprot_ac": "P26618",
"gene_name": "Pdgfra",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P26618",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P26618"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P26618",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P26618"
}
]
}
]
},
{
"uniprot_ac": "P28867",
"gene_name": "Prkcd",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P28867",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P28867"
}
]
},
{
"ec_number": "2.7.11.13",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P28867",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P28867"
}
]
},
{
"ec_number": "2.7.11.13",
"activity": "",
"evidence": [
{
"id": "P28867",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P28867"
}
]
}
]
},
{
"uniprot_ac": "P29317",
"gene_name": "EPHA2",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P29317",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P29317"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P29317",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P29317"
}
]
}
]
},
{
"uniprot_ac": "P29319",
"gene_name": "Epha3",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P29319",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P29319"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P29319",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P29319"
}
]
}
]
},
{
"uniprot_ac": "P29320",
"gene_name": "EPHA3",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P29320",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P29320"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P29320",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P29320"
}
]
}
]
},
{
"uniprot_ac": "P29321",
"gene_name": "Epha8",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P29321",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P29321"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P29321",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P29321"
}
]
}
]
},
{
"uniprot_ac": "P29322",
"gene_name": "EPHA8",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P29322",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P29322"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P29322",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P29322"
}
]
}
]
},
{
"uniprot_ac": "P29323",
"gene_name": "EPHB2",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P29323",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P29323"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P29323",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P29323"
}
]
}
]
},
{
"uniprot_ac": "P29376",
"gene_name": "LTK",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P29376",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P29376"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P29376",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P29376"
}
]
}
]
},
{
"uniprot_ac": "P29597",
"gene_name": "TYK2",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P29597",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P29597"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P29597",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P29597"
}
]
}
]
},
{
"uniprot_ac": "P30291",
"gene_name": "WEE1",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P30291",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P30291"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P30291",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P30291"
}
]
}
]
},
{
"uniprot_ac": "P30530",
"gene_name": "AXL",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P30530",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P30530"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P30530",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P30530"
}
]
}
]
},
{
"uniprot_ac": "P31938",
"gene_name": "Map2k1",
"activity": [
{
"ec_number": "2.7.12.2",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P31938",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P31938"
}
]
},
{
"ec_number": "2.7.12.2",
"activity": "",
"evidence": [
{
"id": "P31938",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P31938"
}
]
}
]
},
{
"uniprot_ac": "P32350",
"gene_name": "KNS1",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P32350",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P32350"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "P32350",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P32350"
}
]
}
]
},
{
"uniprot_ac": "P32490",
"gene_name": "MKK1",
"activity": [
{
"ec_number": "2.7.12.2",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P32490",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P32490"
}
]
},
{
"ec_number": "2.7.12.2",
"activity": "",
"evidence": [
{
"id": "P32490",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P32490"
}
]
}
]
},
{
"uniprot_ac": "P32491",
"gene_name": "MKK2",
"activity": [
{
"ec_number": "2.7.12.2",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P32491",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P32491"
}
]
},
{
"ec_number": "2.7.12.2",
"activity": "",
"evidence": [
{
"id": "P32491",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P32491"
}
]
}
]
},
{
"uniprot_ac": "P32577",
"gene_name": "Csk",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P32577",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P32577"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P32577",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P32577"
}
]
}
]
},
{
"uniprot_ac": "P33981",
"gene_name": "TTK",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P33981",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P33981"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "P33981",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P33981"
}
]
}
]
},
{
"uniprot_ac": "P34152",
"gene_name": "Ptk2",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P34152",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P34152"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P34152",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P34152"
}
]
}
]
},
{
"uniprot_ac": "P34925",
"gene_name": "RYK",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P34925",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P34925"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P34925",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P34925"
}
]
}
]
},
{
"uniprot_ac": "P35546",
"gene_name": "Ret",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P35546",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P35546"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P35546",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P35546"
}
]
}
]
},
{
"uniprot_ac": "P35590",
"gene_name": "TIE1",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P35590",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P35590"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P35590",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P35590"
}
]
}
]
},
{
"uniprot_ac": "P35739",
"gene_name": "Ntrk1",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P35739",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P35739"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P35739",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P35739"
}
]
}
]
},
{
"uniprot_ac": "P35761",
"gene_name": "Ttk",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P35761",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P35761"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "P35761",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P35761"
}
]
}
]
},
{
"uniprot_ac": "P35790",
"gene_name": "CHKA",
"activity": [
{
"ec_number": "2.7.1.82",
"activity": "ATP + ethanolamine = ADP + H(+) + phosphoethanolamine.",
"evidence": [
{
"id": "P35790",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P35790"
}
]
},
{
"ec_number": "2.7.1.82",
"activity": "",
"evidence": [
{
"id": "P35790",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P35790"
}
]
},
{
"ec_number": "2.7.1.32",
"activity": "ATP + choline = ADP + H(+) + phosphocholine.",
"evidence": [
{
"id": "P35790",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P35790"
}
]
},
{
"ec_number": "2.7.1.32",
"activity": "",
"evidence": [
{
"id": "P35790",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P35790"
}
]
}
]
},
{
"uniprot_ac": "P35916",
"gene_name": "FLT4",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P35916",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P35916"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P35916",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P35916"
}
]
}
]
},
{
"uniprot_ac": "P35917",
"gene_name": "Flt4",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P35917",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P35917"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P35917",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P35917"
}
]
}
]
},
{
"uniprot_ac": "P35918",
"gene_name": "Kdr",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P35918",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P35918"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P35918",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P35918"
}
]
}
]
},
{
"uniprot_ac": "P35968",
"gene_name": "KDR",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P35968",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P35968"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P35968",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P35968"
}
]
}
]
},
{
"uniprot_ac": "P35969",
"gene_name": "Flt1",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P35969",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P35969"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P35969",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P35969"
}
]
}
]
},
{
"uniprot_ac": "P35991",
"gene_name": "Btk",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P35991",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P35991"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P35991",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P35991"
}
]
}
]
},
{
"uniprot_ac": "P36506",
"gene_name": "Map2k2",
"activity": [
{
"ec_number": "2.7.12.2",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P36506",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P36506"
}
]
},
{
"ec_number": "2.7.12.2",
"activity": "",
"evidence": [
{
"id": "P36506",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P36506"
}
]
}
]
},
{
"uniprot_ac": "P36507",
"gene_name": "MAP2K2",
"activity": [
{
"ec_number": "2.7.12.2",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P36507",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P36507"
}
]
},
{
"ec_number": "2.7.12.2",
"activity": "",
"evidence": [
{
"id": "P36507",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P36507"
}
]
}
]
},
{
"uniprot_ac": "P36888",
"gene_name": "FLT3",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P36888",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P36888"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P36888",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P36888"
}
]
}
]
},
{
"uniprot_ac": "P39688",
"gene_name": "Fyn",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P39688",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P39688"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P39688",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P39688"
}
]
}
]
},
{
"uniprot_ac": "P41240",
"gene_name": "CSK",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P41240",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P41240"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P41240",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P41240"
}
]
}
]
},
{
"uniprot_ac": "P41241",
"gene_name": "Csk",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P41241",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P41241"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P41241",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P41241"
}
]
}
]
},
{
"uniprot_ac": "P41242",
"gene_name": "Matk",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P41242",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P41242"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P41242",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P41242"
}
]
}
]
},
{
"uniprot_ac": "P41243",
"gene_name": "Matk",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P41243",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P41243"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P41243",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P41243"
}
]
}
]
},
{
"uniprot_ac": "P42679",
"gene_name": "MATK",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P42679",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P42679"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P42679",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P42679"
}
]
}
]
},
{
"uniprot_ac": "P42680",
"gene_name": "TEC",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P42680",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P42680"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P42680",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P42680"
}
]
}
]
},
{
"uniprot_ac": "P42681",
"gene_name": "TXK",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P42681",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P42681"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P42681",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P42681"
}
]
}
]
},
{
"uniprot_ac": "P42682",
"gene_name": "Txk",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P42682",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P42682"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P42682",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P42682"
}
]
}
]
},
{
"uniprot_ac": "P42684",
"gene_name": "ABL2",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P42684",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P42684"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P42684",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P42684"
}
]
}
]
},
{
"uniprot_ac": "P42685",
"gene_name": "FRK",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P42685",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P42685"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P42685",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P42685"
}
]
}
]
},
{
"uniprot_ac": "P43403",
"gene_name": "ZAP70",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P43403",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P43403"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P43403",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P43403"
}
]
}
]
},
{
"uniprot_ac": "P43404",
"gene_name": "Zap70",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P43404",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P43404"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P43404",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P43404"
}
]
}
]
},
{
"uniprot_ac": "P43405",
"gene_name": "SYK",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P43405",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P43405"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P43405",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P43405"
}
]
}
]
},
{
"uniprot_ac": "P45985",
"gene_name": "MAP2K4",
"activity": [
{
"ec_number": "2.7.12.2",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P45985",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P45985"
}
]
},
{
"ec_number": "2.7.12.2",
"activity": "",
"evidence": [
{
"id": "P45985",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P45985"
}
]
}
]
},
{
"uniprot_ac": "P46734",
"gene_name": "MAP2K3",
"activity": [
{
"ec_number": "2.7.12.2",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P46734",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P46734"
}
]
},
{
"ec_number": "2.7.12.2",
"activity": "",
"evidence": [
{
"id": "P46734",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P46734"
}
]
}
]
},
{
"uniprot_ac": "P47809",
"gene_name": "Map2k4",
"activity": [
{
"ec_number": "2.7.12.2",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P47809",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P47809"
}
]
},
{
"ec_number": "2.7.12.2",
"activity": "",
"evidence": [
{
"id": "P47809",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P47809"
}
]
}
]
},
{
"uniprot_ac": "P47810",
"gene_name": "Wee1",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P47810",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P47810"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P47810",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P47810"
}
]
}
]
},
{
"uniprot_ac": "P48025",
"gene_name": "Syk",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P48025",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P48025"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P48025",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P48025"
}
]
}
]
},
{
"uniprot_ac": "P49657",
"gene_name": "mnb",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P49657",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P49657"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "P49657",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P49657"
}
]
}
]
},
{
"uniprot_ac": "P49759",
"gene_name": "CLK1",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P49759",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P49759"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "P49759",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P49759"
}
]
}
]
},
{
"uniprot_ac": "P49760",
"gene_name": "CLK2",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P49760",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P49760"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "P49760",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P49760"
}
]
}
]
},
{
"uniprot_ac": "P49761",
"gene_name": "CLK3",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P49761",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P49761"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "P49761",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P49761"
}
]
}
]
},
{
"uniprot_ac": "P49762",
"gene_name": "Doa",
"activity": [
{
"ec_number": "2.7.11.-",
"activity": "",
"evidence": [
{
"id": "P49762",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P49762"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P49762",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P49762"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "P49762",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P49762"
}
]
}
]
},
{
"uniprot_ac": "P50545",
"gene_name": "Hck",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P50545",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P50545"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P50545",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P50545"
}
]
}
]
},
{
"uniprot_ac": "P51451",
"gene_name": "BLK",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P51451",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P51451"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P51451",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P51451"
}
]
}
]
},
{
"uniprot_ac": "P51813",
"gene_name": "BMX",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P51813",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P51813"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P51813",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P51813"
}
]
}
]
},
{
"uniprot_ac": "P52332",
"gene_name": "Jak1",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P52332",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P52332"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P52332",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P52332"
}
]
}
]
},
{
"uniprot_ac": "P52333",
"gene_name": "JAK3",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P52333",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P52333"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P52333",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P52333"
}
]
}
]
},
{
"uniprot_ac": "P52480",
"gene_name": "Pkm",
"activity": [
{
"ec_number": "2.7.1.40",
"activity": "CTP + pyruvate = CDP + H(+) + phosphoenolpyruvate.",
"evidence": [
{
"id": "P52480",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P52480"
}
]
},
{
"ec_number": "2.7.1.40",
"activity": "",
"evidence": [
{
"id": "P52480",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P52480"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P52480",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P52480"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P52480",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P52480"
}
]
}
]
},
{
"uniprot_ac": "P52564",
"gene_name": "MAP2K6",
"activity": [
{
"ec_number": "2.7.12.2",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P52564",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P52564"
}
]
},
{
"ec_number": "2.7.12.2",
"activity": "",
"evidence": [
{
"id": "P52564",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P52564"
}
]
}
]
},
{
"uniprot_ac": "P53767",
"gene_name": "Flt1",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P53767",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P53767"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P53767",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P53767"
}
]
}
]
},
{
"uniprot_ac": "P53778",
"gene_name": "MAPK12",
"activity": [
{
"ec_number": "2.7.11.24",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P53778",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P53778"
}
]
},
{
"ec_number": "2.7.11.24",
"activity": "",
"evidence": [
{
"id": "P53778",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P53778"
}
]
}
]
},
{
"uniprot_ac": "P54199",
"gene_name": "MPS1",
"activity": [
{
"ec_number": "2.7.12.2",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P54199",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54199"
}
]
},
{
"ec_number": "2.7.12.2",
"activity": "",
"evidence": [
{
"id": "P54199",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54199"
}
]
}
]
},
{
"uniprot_ac": "P54350",
"gene_name": "Wee1",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P54350",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54350"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P54350",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54350"
}
]
}
]
},
{
"uniprot_ac": "P54753",
"gene_name": "EPHB3",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P54753",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54753"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P54753",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54753"
}
]
}
]
},
{
"uniprot_ac": "P54754",
"gene_name": "Ephb3",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P54754",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54754"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P54754",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54754"
}
]
}
]
},
{
"uniprot_ac": "P54756",
"gene_name": "EPHA5",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P54756",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54756"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P54756",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54756"
}
]
}
]
},
{
"uniprot_ac": "P54757",
"gene_name": "Epha5",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P54757",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54757"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P54757",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54757"
}
]
}
]
},
{
"uniprot_ac": "P54758",
"gene_name": "Epha6",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P54758",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54758"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P54758",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54758"
}
]
}
]
},
{
"uniprot_ac": "P54759",
"gene_name": "Epha7",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P54759",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54759"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P54759",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54759"
}
]
}
]
},
{
"uniprot_ac": "P54760",
"gene_name": "EPHB4",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P54760",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54760"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P54760",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54760"
}
]
}
]
},
{
"uniprot_ac": "P54761",
"gene_name": "Ephb4",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P54761",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54761"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P54761",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54761"
}
]
}
]
},
{
"uniprot_ac": "P54762",
"gene_name": "EPHB1",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P54762",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54762"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P54762",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54762"
}
]
}
]
},
{
"uniprot_ac": "P54763",
"gene_name": "Ephb2",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P54763",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54763"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P54763",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54763"
}
]
}
]
},
{
"uniprot_ac": "P54764",
"gene_name": "EPHA4",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P54764",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54764"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P54764",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54764"
}
]
}
]
},
{
"uniprot_ac": "P55144",
"gene_name": "Tyro3",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P55144",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P55144"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P55144",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P55144"
}
]
}
]
},
{
"uniprot_ac": "P55146",
"gene_name": "Tyro3",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P55146",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P55146"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P55146",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P55146"
}
]
}
]
},
{
"uniprot_ac": "P57097",
"gene_name": "Mertk",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P57097",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P57097"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P57097",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P57097"
}
]
}
]
},
{
"uniprot_ac": "P57760",
"gene_name": "Stk16",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P57760",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P57760"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P57760",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P57760"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "P57760",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P57760"
}
]
}
]
},
{
"uniprot_ac": "P58801",
"gene_name": "Ripk2",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P58801",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P58801"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P58801",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P58801"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "P58801",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P58801"
}
]
}
]
},
{
"uniprot_ac": "P60953",
"gene_name": "CDC42",
"activity": [
{
"ec_number": "3.6.5.2",
"activity": "GTP + H2O = GDP + H(+) + phosphate.",
"evidence": [
{
"id": "P60953",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P60953"
}
]
},
{
"ec_number": "3.6.5.2",
"activity": "",
"evidence": [
{
"id": "P60953",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P60953"
}
]
}
]
},
{
"uniprot_ac": "P63000",
"gene_name": "RAC1",
"activity": [
{
"ec_number": "3.6.5.2",
"activity": "GTP + H2O = GDP + H(+) + phosphate.",
"evidence": [
{
"id": "P63000",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P63000"
}
]
},
{
"ec_number": "3.6.5.2",
"activity": "",
"evidence": [
{
"id": "P63000",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P63000"
}
]
}
]
},
{
"uniprot_ac": "P70236",
"gene_name": "Map2k6",
"activity": [
{
"ec_number": "2.7.12.2",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P70236",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P70236"
}
]
},
{
"ec_number": "2.7.12.2",
"activity": "",
"evidence": [
{
"id": "P70236",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P70236"
}
]
}
]
},
{
"uniprot_ac": "P70424",
"gene_name": "Erbb2",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P70424",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P70424"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P70424",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P70424"
}
]
}
]
},
{
"uniprot_ac": "P70451",
"gene_name": "Fer",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P70451",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P70451"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P70451",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P70451"
}
]
}
]
},
{
"uniprot_ac": "P70600",
"gene_name": "Ptk2b",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P70600",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P70600"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P70600",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P70600"
}
]
}
]
},
{
"uniprot_ac": "P83102",
"gene_name": "Dyrk3",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P83102",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P83102"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "P83102",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P83102"
}
]
}
]
},
{
"uniprot_ac": "P97504",
"gene_name": "Bmx",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P97504",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P97504"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P97504",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P97504"
}
]
}
]
},
{
"uniprot_ac": "P97523",
"gene_name": "Met",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P97523",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P97523"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P97523",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P97523"
}
]
}
]
},
{
"uniprot_ac": "P97793",
"gene_name": "Alk",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P97793",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P97793"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P97793",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P97793"
}
]
}
]
},
{
"uniprot_ac": "Q00342",
"gene_name": "Flt3",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q00342",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q00342"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q00342",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q00342"
}
]
}
]
},
{
"uniprot_ac": "Q00495",
"gene_name": "Csf1r",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q00495",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q00495"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q00495",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q00495"
}
]
}
]
},
{
"uniprot_ac": "Q00534",
"gene_name": "CDK6",
"activity": [
{
"ec_number": "2.7.11.22",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q00534",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q00534"
}
]
},
{
"ec_number": "2.7.11.22",
"activity": "",
"evidence": [
{
"id": "Q00534",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q00534"
}
]
}
]
},
{
"uniprot_ac": "Q00535",
"gene_name": "CDK5",
"activity": [
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q00535",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q00535"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "Q00535",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q00535"
}
]
}
]
},
{
"uniprot_ac": "Q00993",
"gene_name": "Axl",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q00993",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q00993"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q00993",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q00993"
}
]
}
]
},
{
"uniprot_ac": "Q01134",
"gene_name": "Chka",
"activity": [
{
"ec_number": "2.7.1.82",
"activity": "ATP + ethanolamine = ADP + H(+) + phosphoethanolamine.",
"evidence": [
{
"id": "Q01134",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q01134"
}
]
},
{
"ec_number": "2.7.1.82",
"activity": "",
"evidence": [
{
"id": "Q01134",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q01134"
}
]
},
{
"ec_number": "2.7.1.32",
"activity": "ATP + choline = ADP + H(+) + phosphocholine.",
"evidence": [
{
"id": "Q01134",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q01134"
}
]
},
{
"ec_number": "2.7.1.32",
"activity": "",
"evidence": [
{
"id": "Q01134",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q01134"
}
]
}
]
},
{
"uniprot_ac": "Q01279",
"gene_name": "Egfr",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q01279",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q01279"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q01279",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q01279"
}
]
}
]
},
{
"uniprot_ac": "Q01621",
"gene_name": "Lck",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q01621",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q01621"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q01621",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q01621"
}
]
}
]
},
{
"uniprot_ac": "Q01887",
"gene_name": "Ryk",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q01887",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q01887"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q01887",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q01887"
}
]
}
]
},
{
"uniprot_ac": "Q01974",
"gene_name": "ROR2",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q01974",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q01974"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q01974",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q01974"
}
]
}
]
},
{
"uniprot_ac": "Q01986",
"gene_name": "Map2k1",
"activity": [
{
"ec_number": "2.7.12.2",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q01986",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q01986"
}
]
},
{
"ec_number": "2.7.12.2",
"activity": "",
"evidence": [
{
"id": "Q01986",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q01986"
}
]
}
]
},
{
"uniprot_ac": "Q02750",
"gene_name": "MAP2K1",
"activity": [
{
"ec_number": "2.7.12.2",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q02750",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q02750"
}
]
},
{
"ec_number": "2.7.12.2",
"activity": "",
"evidence": [
{
"id": "Q02750",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q02750"
}
]
}
]
},
{
"uniprot_ac": "Q02763",
"gene_name": "TEK",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q02763",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q02763"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q02763",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q02763"
}
]
}
]
},
{
"uniprot_ac": "Q02858",
"gene_name": "Tek",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q02858",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q02858"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q02858",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q02858"
}
]
}
]
},
{
"uniprot_ac": "Q03137",
"gene_name": "Epha4",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q03137",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03137"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q03137",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03137"
}
]
}
]
},
{
"uniprot_ac": "Q03142",
"gene_name": "Fgfr4",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q03142",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03142"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q03142",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03142"
}
]
}
]
},
{
"uniprot_ac": "Q03145",
"gene_name": "Epha2",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q03145",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03145"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q03145",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03145"
}
]
}
]
},
{
"uniprot_ac": "Q03146",
"gene_name": "Ddr1",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q03146",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03146"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q03146",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03146"
}
]
}
]
},
{
"uniprot_ac": "Q03351",
"gene_name": "Ntrk3",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q03351",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03351"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q03351",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03351"
}
]
}
]
},
{
"uniprot_ac": "Q03526",
"gene_name": "Itk",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q03526",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03526"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q03526",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03526"
}
]
}
]
},
{
"uniprot_ac": "Q03963",
"gene_name": "Eif2ak2",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q03963",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03963"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q03963",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03963"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "Q03963",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03963"
}
]
}
]
},
{
"uniprot_ac": "Q04589",
"gene_name": "Fgfr1",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q04589",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04589"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q04589",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04589"
}
]
}
]
},
{
"uniprot_ac": "Q04736",
"gene_name": "Yes1",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q04736",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04736"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q04736",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04736"
}
]
}
]
},
{
"uniprot_ac": "Q04912",
"gene_name": "MST1R",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q04912",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04912"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q04912",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04912"
}
]
}
]
},
{
"uniprot_ac": "Q05030",
"gene_name": "Pdgfrb",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q05030",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q05030"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q05030",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q05030"
}
]
}
]
},
{
"uniprot_ac": "Q05397",
"gene_name": "PTK2",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q05397",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q05397"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q05397",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q05397"
}
]
}
]
},
{
"uniprot_ac": "Q05655",
"gene_name": "PRKCD",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q05655",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q05655"
}
]
},
{
"ec_number": "2.7.11.13",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q05655",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q05655"
}
]
},
{
"ec_number": "2.7.11.13",
"activity": "",
"evidence": [
{
"id": "Q05655",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q05655"
}
]
}
]
},
{
"uniprot_ac": "Q06187",
"gene_name": "BTK",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q06187",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q06187"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q06187",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q06187"
}
]
}
]
},
{
"uniprot_ac": "Q06418",
"gene_name": "TYRO3",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q06418",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q06418"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q06418",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q06418"
}
]
}
]
},
{
"uniprot_ac": "Q06806",
"gene_name": "Tie1",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q06806",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q06806"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q06806",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q06806"
}
]
}
]
},
{
"uniprot_ac": "Q07014",
"gene_name": "Lyn",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q07014",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q07014"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q07014",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q07014"
}
]
}
]
},
{
"uniprot_ac": "Q07407",
"gene_name": "htl",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q07407",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q07407"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q07407",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q07407"
}
]
}
]
},
{
"uniprot_ac": "Q07912",
"gene_name": "TNK2",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q07912",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q07912"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q07912",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q07912"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q07912",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q07912"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "Q07912",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q07912"
}
]
}
]
},
{
"uniprot_ac": "Q08345",
"gene_name": "DDR1",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q08345",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q08345"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q08345",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q08345"
}
]
}
]
},
{
"uniprot_ac": "Q08881",
"gene_name": "ITK",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q08881",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q08881"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q08881",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q08881"
}
]
}
]
},
{
"uniprot_ac": "Q09147",
"gene_name": "btl",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q09147",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q09147"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q09147",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q09147"
}
]
}
]
},
{
"uniprot_ac": "Q12866",
"gene_name": "MERTK",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q12866",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12866"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q12866",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12866"
}
]
}
]
},
{
"uniprot_ac": "Q13163",
"gene_name": "MAP2K5",
"activity": [
{
"ec_number": "2.7.12.2",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q13163",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13163"
}
]
},
{
"ec_number": "2.7.12.2",
"activity": "",
"evidence": [
{
"id": "Q13163",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13163"
}
]
}
]
},
{
"uniprot_ac": "Q13315",
"gene_name": "ATM",
"activity": [
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q13315",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13315"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "Q13315",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13315"
}
]
}
]
},
{
"uniprot_ac": "Q13470",
"gene_name": "TNK1",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q13470",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13470"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q13470",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13470"
}
]
}
]
},
{
"uniprot_ac": "Q13627",
"gene_name": "DYRK1A",
"activity": [
{
"ec_number": "2.7.11.23",
"activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].",
"evidence": [
{
"id": "Q13627",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13627"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q13627",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13627"
}
]
},
{
"ec_number": "2.7.11.23",
"activity": "",
"evidence": [
{
"id": "Q13627",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13627"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "Q13627",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13627"
}
]
}
]
},
{
"uniprot_ac": "Q13882",
"gene_name": "PTK6",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q13882",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13882"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q13882",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13882"
}
]
}
]
},
{
"uniprot_ac": "Q14289",
"gene_name": "PTK2B",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q14289",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q14289"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q14289",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q14289"
}
]
}
]
},
{
"uniprot_ac": "Q14680",
"gene_name": "MELK",
"activity": [
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q14680",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q14680"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "Q14680",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q14680"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q14680",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q14680"
}
]
}
]
},
{
"uniprot_ac": "Q15303",
"gene_name": "ERBB4",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q15303",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q15303"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q15303",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q15303"
}
]
}
]
},
{
"uniprot_ac": "Q15375",
"gene_name": "EPHA7",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q15375",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q15375"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q15375",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q15375"
}
]
}
]
},
{
"uniprot_ac": "Q15569",
"gene_name": "TESK1",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q15569",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q15569"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "Q15569",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q15569"
}
]
}
]
},
{
"uniprot_ac": "Q15759",
"gene_name": "MAPK11",
"activity": [
{
"ec_number": "2.7.11.24",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q15759",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q15759"
}
]
},
{
"ec_number": "2.7.11.24",
"activity": "",
"evidence": [
{
"id": "Q15759",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q15759"
}
]
}
]
},
{
"uniprot_ac": "Q16288",
"gene_name": "NTRK3",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q16288",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16288"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q16288",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16288"
}
]
}
]
},
{
"uniprot_ac": "Q16539",
"gene_name": "MAPK14",
"activity": [
{
"ec_number": "2.7.11.24",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q16539",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16539"
}
]
},
{
"ec_number": "2.7.11.24",
"activity": "",
"evidence": [
{
"id": "Q16539",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16539"
}
]
}
]
},
{
"uniprot_ac": "Q16620",
"gene_name": "NTRK2",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q16620",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16620"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q16620",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16620"
}
]
}
]
},
{
"uniprot_ac": "Q16832",
"gene_name": "DDR2",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q16832",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16832"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q16832",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16832"
}
]
}
]
},
{
"uniprot_ac": "Q23977",
"gene_name": "hep",
"activity": [
{
"ec_number": "2.7.12.2",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q23977",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q23977"
}
]
},
{
"ec_number": "2.7.12.2",
"activity": "",
"evidence": [
{
"id": "Q23977",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q23977"
}
]
}
]
},
{
"uniprot_ac": "Q24145",
"gene_name": "Shark",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q24145",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q24145"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q24145",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q24145"
}
]
}
]
},
{
"uniprot_ac": "Q24324",
"gene_name": "Dsor1",
"activity": [
{
"ec_number": "2.7.12.2",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q24324",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q24324"
}
]
},
{
"ec_number": "2.7.12.2",
"activity": "",
"evidence": [
{
"id": "Q24324",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q24324"
}
]
}
]
},
{
"uniprot_ac": "Q24488",
"gene_name": "Ror",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q24488",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q24488"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q24488",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q24488"
}
]
}
]
},
{
"uniprot_ac": "Q24592",
"gene_name": "hop",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q24592",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q24592"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q24592",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q24592"
}
]
}
]
},
{
"uniprot_ac": "Q27324",
"gene_name": "drl",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q27324",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q27324"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q27324",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q27324"
}
]
}
]
},
{
"uniprot_ac": "Q3UFB7",
"gene_name": "Ntrk1",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q3UFB7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q3UFB7"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q3UFB7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q3UFB7"
}
]
}
]
},
{
"uniprot_ac": "Q498D6",
"gene_name": "Fgfr4",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q498D6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q498D6"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q498D6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q498D6"
}
]
}
]
},
{
"uniprot_ac": "Q4JIM5",
"gene_name": "Abl2",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q4JIM5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q4JIM5"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q4JIM5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q4JIM5"
}
]
}
]
},
{
"uniprot_ac": "Q4KM97",
"gene_name": "Blk",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q4KM97",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q4KM97"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q4KM97",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q4KM97"
}
]
}
]
},
{
"uniprot_ac": "Q4KSH6",
"gene_name": "Map2k4",
"activity": [
{
"ec_number": "2.7.12.2",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q4KSH6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q4KSH6"
}
]
},
{
"ec_number": "2.7.12.2",
"activity": "",
"evidence": [
{
"id": "Q4KSH6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q4KSH6"
}
]
}
]
},
{
"uniprot_ac": "Q4KSH7",
"gene_name": "Map2k7",
"activity": [
{
"ec_number": "2.7.12.2",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q4KSH7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q4KSH7"
}
]
},
{
"ec_number": "2.7.12.2",
"activity": "",
"evidence": [
{
"id": "Q4KSH7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q4KSH7"
}
]
}
]
},
{
"uniprot_ac": "Q4V8A3",
"gene_name": "Dyrk3",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q4V8A3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q4V8A3"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "Q4V8A3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q4V8A3"
}
]
}
]
},
{
"uniprot_ac": "Q501W1",
"gene_name": "Txk",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q501W1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q501W1"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q501W1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q501W1"
}
]
}
]
},
{
"uniprot_ac": "Q504Y2",
"gene_name": "PKDCC",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q504Y2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q504Y2"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q504Y2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q504Y2"
}
]
}
]
},
{
"uniprot_ac": "Q54BC9",
"gene_name": "dyrk2",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q54BC9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54BC9"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "Q54BC9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54BC9"
}
]
}
]
},
{
"uniprot_ac": "Q54G28",
"gene_name": "",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q54G28",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54G28"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q54G28",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54G28"
}
]
}
]
},
{
"uniprot_ac": "Q54I36",
"gene_name": "pyk3",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q54I36",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54I36"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "Q54I36",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54I36"
}
]
}
]
},
{
"uniprot_ac": "Q54N73",
"gene_name": "7tmk1",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q54N73",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54N73"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q54N73",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54N73"
}
]
}
]
},
{
"uniprot_ac": "Q54QV3",
"gene_name": "yakA",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q54QV3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54QV3"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "Q54QV3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54QV3"
}
]
}
]
},
{
"uniprot_ac": "Q54R58",
"gene_name": "",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q54R58",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54R58"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q54R58",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54R58"
}
]
}
]
},
{
"uniprot_ac": "Q552C6",
"gene_name": "zak2",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q552C6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q552C6"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "Q552C6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q552C6"
}
]
}
]
},
{
"uniprot_ac": "Q55CL6",
"gene_name": "mekA",
"activity": [
{
"ec_number": "2.7.12.2",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q55CL6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q55CL6"
}
]
},
{
"ec_number": "2.7.12.2",
"activity": "",
"evidence": [
{
"id": "Q55CL6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q55CL6"
}
]
}
]
},
{
"uniprot_ac": "Q5FVG7",
"gene_name": "Srms",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q5FVG7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5FVG7"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q5FVG7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5FVG7"
}
]
}
]
},
{
"uniprot_ac": "Q5JZY3",
"gene_name": "EPHA10",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q5JZY3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5JZY3"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q5JZY3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5JZY3"
}
]
}
]
},
{
"uniprot_ac": "Q5RJI4",
"gene_name": "Pkdcc",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q5RJI4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5RJI4"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q5RJI4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5RJI4"
}
]
}
]
},
{
"uniprot_ac": "Q5U2X5",
"gene_name": "Tnk2",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q5U2X5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5U2X5"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q5U2X5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5U2X5"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q5U2X5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5U2X5"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "Q5U2X5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5U2X5"
}
]
}
]
},
{
"uniprot_ac": "Q5U4C9",
"gene_name": "Dyrk2",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q5U4C9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5U4C9"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "Q5U4C9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5U4C9"
}
]
}
]
},
{
"uniprot_ac": "Q60629",
"gene_name": "Epha5",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q60629",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q60629"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q60629",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q60629"
}
]
}
]
},
{
"uniprot_ac": "Q60750",
"gene_name": "Epha1",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q60750",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q60750"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q60750",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q60750"
}
]
}
]
},
{
"uniprot_ac": "Q60751",
"gene_name": "Igf1r",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q60751",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q60751"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q60751",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q60751"
}
]
}
]
},
{
"uniprot_ac": "Q60805",
"gene_name": "Mertk",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q60805",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q60805"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q60805",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q60805"
}
]
}
]
},
{
"uniprot_ac": "Q61006",
"gene_name": "Musk",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q61006",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q61006"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q61006",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q61006"
}
]
}
]
},
{
"uniprot_ac": "Q61214",
"gene_name": "Dyrk1a",
"activity": [
{
"ec_number": "2.7.11.23",
"activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].",
"evidence": [
{
"id": "Q61214",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q61214"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q61214",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q61214"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "Q61214",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q61214"
}
]
},
{
"ec_number": "2.7.11.23",
"activity": "",
"evidence": [
{
"id": "Q61214",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q61214"
}
]
}
]
},
{
"uniprot_ac": "Q61526",
"gene_name": "Erbb3",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q61526",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q61526"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q61526",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q61526"
}
]
}
]
},
{
"uniprot_ac": "Q61527",
"gene_name": "Erbb4",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q61527",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q61527"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q61527",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q61527"
}
]
}
]
},
{
"uniprot_ac": "Q61772",
"gene_name": "Epha7",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q61772",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q61772"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q61772",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q61772"
}
]
}
]
},
{
"uniprot_ac": "Q61846",
"gene_name": "Melk",
"activity": [
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q61846",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q61846"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "Q61846",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q61846"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q61846",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q61846"
}
]
}
]
},
{
"uniprot_ac": "Q61851",
"gene_name": "Fgfr3",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q61851",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q61851"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q61851",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q61851"
}
]
}
]
},
{
"uniprot_ac": "Q62120",
"gene_name": "Jak2",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q62120",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q62120"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q62120",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q62120"
}
]
}
]
},
{
"uniprot_ac": "Q62137",
"gene_name": "Jak3",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q62137",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q62137"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q62137",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q62137"
}
]
}
]
},
{
"uniprot_ac": "Q62190",
"gene_name": "Mst1r",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q62190",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q62190"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q62190",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q62190"
}
]
}
]
},
{
"uniprot_ac": "Q62270",
"gene_name": "Srms",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q62270",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q62270"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q62270",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q62270"
}
]
}
]
},
{
"uniprot_ac": "Q62371",
"gene_name": "Ddr2",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q62371",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q62371"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q62371",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q62371"
}
]
}
]
},
{
"uniprot_ac": "Q62413",
"gene_name": "Epha6",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q62413",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q62413"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q62413",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q62413"
}
]
}
]
},
{
"uniprot_ac": "Q62662",
"gene_name": "Frk",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q62662",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q62662"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q62662",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q62662"
}
]
}
]
},
{
"uniprot_ac": "Q62689",
"gene_name": "Jak2",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q62689",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q62689"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q62689",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q62689"
}
]
}
]
},
{
"uniprot_ac": "Q62799",
"gene_name": "Erbb3",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q62799",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q62799"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q62799",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q62799"
}
]
}
]
},
{
"uniprot_ac": "Q62838",
"gene_name": "Musk",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q62838",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q62838"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q62838",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q62838"
}
]
}
]
},
{
"uniprot_ac": "Q62844",
"gene_name": "Fyn",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q62844",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q62844"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q62844",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q62844"
}
]
}
]
},
{
"uniprot_ac": "Q62862",
"gene_name": "Map2k5",
"activity": [
{
"ec_number": "2.7.12.2",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q62862",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q62862"
}
]
},
{
"ec_number": "2.7.12.2",
"activity": "",
"evidence": [
{
"id": "Q62862",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q62862"
}
]
}
]
},
{
"uniprot_ac": "Q62956",
"gene_name": "Erbb4",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q62956",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q62956"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q62956",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q62956"
}
]
}
]
},
{
"uniprot_ac": "Q63116",
"gene_name": "Kit",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q63116",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q63116"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q63116",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q63116"
}
]
}
]
},
{
"uniprot_ac": "Q63117",
"gene_name": "Clk3",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q63117",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q63117"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "Q63117",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q63117"
}
]
}
]
},
{
"uniprot_ac": "Q63132",
"gene_name": "Ros1",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q63132",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q63132"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q63132",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q63132"
}
]
}
]
},
{
"uniprot_ac": "Q63184",
"gene_name": "Eif2ak2",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q63184",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q63184"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q63184",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q63184"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "Q63184",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q63184"
}
]
}
]
},
{
"uniprot_ac": "Q63272",
"gene_name": "Jak3",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q63272",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q63272"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q63272",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q63272"
}
]
}
]
},
{
"uniprot_ac": "Q63470",
"gene_name": "Dyrk1a",
"activity": [
{
"ec_number": "2.7.11.23",
"activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].",
"evidence": [
{
"id": "Q63470",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q63470"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q63470",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q63470"
}
]
},
{
"ec_number": "2.7.11.23",
"activity": "",
"evidence": [
{
"id": "Q63470",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q63470"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "Q63470",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q63470"
}
]
}
]
},
{
"uniprot_ac": "Q63474",
"gene_name": "Ddr1",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q63474",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q63474"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q63474",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q63474"
}
]
}
]
},
{
"uniprot_ac": "Q63572",
"gene_name": "Tesk1",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q63572",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q63572"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "Q63572",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q63572"
}
]
}
]
},
{
"uniprot_ac": "Q63604",
"gene_name": "Ntrk2",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q63604",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q63604"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q63604",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q63604"
}
]
}
]
},
{
"uniprot_ac": "Q63802",
"gene_name": "Wee1",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q63802",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q63802"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q63802",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q63802"
}
]
}
]
},
{
"uniprot_ac": "Q63932",
"gene_name": "Map2k2",
"activity": [
{
"ec_number": "2.7.12.2",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q63932",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q63932"
}
]
},
{
"ec_number": "2.7.12.2",
"activity": "",
"evidence": [
{
"id": "Q63932",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q63932"
}
]
}
]
},
{
"uniprot_ac": "Q64434",
"gene_name": "Ptk6",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q64434",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64434"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q64434",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64434"
}
]
}
]
},
{
"uniprot_ac": "Q64716",
"gene_name": "Insrr",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q64716",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64716"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q64716",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64716"
}
]
}
]
},
{
"uniprot_ac": "Q64725",
"gene_name": "Syk",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q64725",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64725"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q64725",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64725"
}
]
}
]
},
{
"uniprot_ac": "Q66JT0",
"gene_name": "Wee2",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q66JT0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q66JT0"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q66JT0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q66JT0"
}
]
}
]
},
{
"uniprot_ac": "Q6J9G0",
"gene_name": "STYK1",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q6J9G0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6J9G0"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q6J9G0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6J9G0"
}
]
}
]
},
{
"uniprot_ac": "Q6J9G1",
"gene_name": "Styk1",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q6J9G1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6J9G1"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q6J9G1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6J9G1"
}
]
}
]
},
{
"uniprot_ac": "Q6P6U0",
"gene_name": "Fgr",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q6P6U0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6P6U0"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q6P6U0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6P6U0"
}
]
}
]
},
{
"uniprot_ac": "Q6VNS1",
"gene_name": "Ntrk3",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q6VNS1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6VNS1"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q6VNS1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6VNS1"
}
]
}
]
},
{
"uniprot_ac": "Q6XUX1",
"gene_name": "Dstyk",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q6XUX1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6XUX1"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "Q6XUX1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6XUX1"
}
]
}
]
},
{
"uniprot_ac": "Q6XUX2",
"gene_name": "Dstyk",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q6XUX2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6XUX2"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "Q6XUX2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6XUX2"
}
]
}
]
},
{
"uniprot_ac": "Q6XUX3",
"gene_name": "DSTYK",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q6XUX3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6XUX3"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "Q6XUX3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6XUX3"
}
]
}
]
},
{
"uniprot_ac": "Q75JK0",
"gene_name": "zakA",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q75JK0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q75JK0"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "Q75JK0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q75JK0"
}
]
}
]
},
{
"uniprot_ac": "Q76NV1",
"gene_name": "dyrk1",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q76NV1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q76NV1"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "Q76NV1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q76NV1"
}
]
}
]
},
{
"uniprot_ac": "Q78DX7",
"gene_name": "Ros1",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q78DX7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q78DX7"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q78DX7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q78DX7"
}
]
}
]
},
{
"uniprot_ac": "Q7KJ08",
"gene_name": "Alk",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q7KJ08",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7KJ08"
}
]
}
]
},
{
"uniprot_ac": "Q7KT06",
"gene_name": "Ret",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q7KT06",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7KT06"
}
]
}
]
},
{
"uniprot_ac": "Q8BI55",
"gene_name": "Dyrk4",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q8BI55",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8BI55"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "Q8BI55",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8BI55"
}
]
}
]
},
{
"uniprot_ac": "Q8BYG9",
"gene_name": "Epha10",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q8BYG9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8BYG9"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q8BYG9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8BYG9"
}
]
}
]
},
{
"uniprot_ac": "Q8CBF3",
"gene_name": "Ephb1",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q8CBF3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8CBF3"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q8CBF3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8CBF3"
}
]
}
]
},
{
"uniprot_ac": "Q8CE90",
"gene_name": "Map2k7",
"activity": [
{
"ec_number": "2.7.12.2",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q8CE90",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8CE90"
}
]
},
{
"ec_number": "2.7.12.2",
"activity": "",
"evidence": [
{
"id": "Q8CE90",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8CE90"
}
]
}
]
},
{
"uniprot_ac": "Q8INJ8",
"gene_name": "Csk",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q8INJ8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8INJ8"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q8INJ8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8INJ8"
}
]
}
]
},
{
"uniprot_ac": "Q8VCT9",
"gene_name": "Tesk2",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q8VCT9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8VCT9"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "Q8VCT9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8VCT9"
}
]
}
]
},
{
"uniprot_ac": "Q91ZT1",
"gene_name": "Flt4",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q91ZT1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q91ZT1"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q91ZT1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q91ZT1"
}
]
}
]
},
{
"uniprot_ac": "Q922K9",
"gene_name": "Frk",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q922K9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q922K9"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q922K9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q922K9"
}
]
}
]
},
{
"uniprot_ac": "Q922Y0",
"gene_name": "Dyrk3",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q922Y0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q922Y0"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "Q922Y0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q922Y0"
}
]
}
]
},
{
"uniprot_ac": "Q924U5",
"gene_name": "Tesk2",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q924U5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q924U5"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "Q924U5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q924U5"
}
]
}
]
},
{
"uniprot_ac": "Q925D6",
"gene_name": "Map2k6",
"activity": [
{
"ec_number": "2.7.12.2",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q925D6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q925D6"
}
]
},
{
"ec_number": "2.7.12.2",
"activity": "",
"evidence": [
{
"id": "Q925D6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q925D6"
}
]
}
]
},
{
"uniprot_ac": "Q92630",
"gene_name": "DYRK2",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q92630",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q92630"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "Q92630",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q92630"
}
]
}
]
},
{
"uniprot_ac": "Q96KB5",
"gene_name": "PBK",
"activity": [
{
"ec_number": "2.7.12.2",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q96KB5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96KB5"
}
]
},
{
"ec_number": "2.7.12.2",
"activity": "",
"evidence": [
{
"id": "Q96KB5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96KB5"
}
]
}
]
},
{
"uniprot_ac": "Q96S53",
"gene_name": "TESK2",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q96S53",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96S53"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "Q96S53",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96S53"
}
]
}
]
},
{
"uniprot_ac": "Q99ML2",
"gene_name": "Tnk1",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q99ML2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99ML2"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q99ML2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99ML2"
}
]
}
]
},
{
"uniprot_ac": "Q9H3Y6",
"gene_name": "SRMS",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q9H3Y6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9H3Y6"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q9H3Y6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9H3Y6"
}
]
}
]
},
{
"uniprot_ac": "Q9HAZ1",
"gene_name": "CLK4",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q9HAZ1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9HAZ1"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "Q9HAZ1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9HAZ1"
}
]
}
]
},
{
"uniprot_ac": "Q9I7F7",
"gene_name": "Ack-like",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q9I7F7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9I7F7"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q9I7F7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9I7F7"
}
]
}
]
},
{
"uniprot_ac": "Q9JJ78",
"gene_name": "Pbk",
"activity": [
{
"ec_number": "2.7.12.2",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q9JJ78",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9JJ78"
}
]
},
{
"ec_number": "2.7.12.2",
"activity": "",
"evidence": [
{
"id": "Q9JJ78",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9JJ78"
}
]
}
]
},
{
"uniprot_ac": "Q9NR20",
"gene_name": "DYRK4",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q9NR20",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9NR20"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "Q9NR20",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9NR20"
}
]
}
]
},
{
"uniprot_ac": "Q9QVP9",
"gene_name": "Ptk2b",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q9QVP9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9QVP9"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q9QVP9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9QVP9"
}
]
}
]
},
{
"uniprot_ac": "Q9R117",
"gene_name": "Tyk2",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q9R117",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9R117"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q9R117",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9R117"
}
]
}
]
},
{
"uniprot_ac": "Q9UF33",
"gene_name": "EPHA6",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q9UF33",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UF33"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q9UF33",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UF33"
}
]
}
]
},
{
"uniprot_ac": "Q9UIG0",
"gene_name": "BAZ1B",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q9UIG0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UIG0"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q9UIG0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UIG0"
}
]
}
]
},
{
"uniprot_ac": "Q9UM73",
"gene_name": "ALK",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q9UM73",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UM73"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q9UM73",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UM73"
}
]
}
]
},
{
"uniprot_ac": "Q9V3D5",
"gene_name": "Dyrk2",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q9V3D5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9V3D5"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "Q9V3D5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9V3D5"
}
]
}
]
},
{
"uniprot_ac": "Q9V422",
"gene_name": "dnt",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q9V422",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9V422"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q9V422",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9V422"
}
]
}
]
},
{
"uniprot_ac": "Q9V6K3",
"gene_name": "Nrk",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q9V6K3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9V6K3"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q9V6K3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9V6K3"
}
]
}
]
},
{
"uniprot_ac": "Q9V9J3",
"gene_name": "Src42A",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q9V9J3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9V9J3"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q9V9J3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9V9J3"
}
]
}
]
},
{
"uniprot_ac": "Q9VBW3",
"gene_name": "Cad96Ca",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q9VBW3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VBW3"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q9VBW3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VBW3"
}
]
}
]
},
{
"uniprot_ac": "Q9VE06",
"gene_name": "cdi",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q9VE06",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VE06"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "Q9VE06",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VE06"
}
]
}
]
},
{
"uniprot_ac": "Q9VJ04",
"gene_name": "Dmel\\CG10702",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q9VJ04",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VJ04"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q9VJ04",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VJ04"
}
]
}
]
},
{
"uniprot_ac": "Q9VPC0",
"gene_name": "Pitslre",
"activity": [
{
"ec_number": "2.7.11.22",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q9VPC0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VPC0"
}
]
},
{
"ec_number": "2.7.11.22",
"activity": "",
"evidence": [
{
"id": "Q9VPC0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VPC0"
}
]
}
]
},
{
"uniprot_ac": "Q9VZA8",
"gene_name": "Tie",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q9VZA8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VZA8"
}
]
}
]
},
{
"uniprot_ac": "Q9VZI2",
"gene_name": "Ack",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q9VZI2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VZI2"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q9VZI2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VZI2"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "Q9VZI2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VZI2"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q9VZI2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VZI2"
}
]
}
]
},
{
"uniprot_ac": "Q9WTL4",
"gene_name": "Insrr",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q9WTL4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9WTL4"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q9WTL4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9WTL4"
}
]
}
]
},
{
"uniprot_ac": "Q9WUD9",
"gene_name": "Src",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q9WUD9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9WUD9"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q9WUD9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9WUD9"
}
]
}
]
},
{
"uniprot_ac": "Q9WVS7",
"gene_name": "Map2k5",
"activity": [
{
"ec_number": "2.7.12.2",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q9WVS7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9WVS7"
}
]
},
{
"ec_number": "2.7.12.2",
"activity": "",
"evidence": [
{
"id": "Q9WVS7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9WVS7"
}
]
}
]
},
{
"uniprot_ac": "Q9Y463",
"gene_name": "DYRK1B",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q9Y463",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y463"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "Q9Y463",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y463"
}
]
}
]
},
{
"uniprot_ac": "Q9Z138",
"gene_name": "Ror2",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q9Z138",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Z138"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "Q9Z138",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Z138"
}
]
}
]
},
{
"uniprot_ac": "Q9Z188",
"gene_name": "Dyrk1b",
"activity": [
{
"ec_number": "2.7.12.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q9Z188",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Z188"
}
]
},
{
"ec_number": "2.7.12.1",
"activity": "",
"evidence": [
{
"id": "Q9Z188",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Z188"
}
]
}
]
},
{
"uniprot_ac": "Q9Z277",
"gene_name": "Baz1b",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q9Z277",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Z277"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q9Z277",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Z277"
}
]
}
]
}
],
"biomarkers": [],
"synthesized_glycans": [],
"cluster_types": [
{
"name": "isoformset.uniprotkb",
"label": "Isoforms"
},
{
"name": "homologset.mgi",
"label": "MGI Homologs"
},
{
"name": "homologset.oma",
"label": "OMA Homologs"
}
],
"sequence_features": {
"n_linked_sites": [],
"o_linked_sites": [
840,
854,
855
],
"snv_sites": [
96,
137,
480,
501,
645,
688,
694,
840,
854,
855
],
"glycation_sites": [],
"phosphorylation_sites": [
50,
70,
79,
115,
128,
139,
172,
185,
215,
226,
229,
232,
253,
257,
264,
315,
392,
393,
394,
413,
446,
469,
559,
569,
613,
618,
619,
620,
659,
683,
710,
718,
735,
751,
781,
804,
805,
808,
809,
814,
823,
844,
852,
854,
855,
915,
917,
919,
936,
949,
977,
989
],
"sequon_annotation_sites": [
{
"start_pos": 146,
"end_pos": 148
},
{
"start_pos": 770,
"end_pos": 772
},
{
"start_pos": 812,
"end_pos": 814
}
]
},
"section_stats": [
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 3
},
{
"field": "total_sites",
"count": 3
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 1
},
{
"field": "o_linked_glycan_sites",
"count": 3
}
],
"sort_fields": [
"glytoucan_ac",
"type",
"subtype",
"site_category",
"site_seq",
"relation",
"comment",
"start_pos",
"start_aa",
"end_pos",
"end_aa",
"residue",
"site_lbl"
]
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 3
},
{
"field": "total_sites",
"count": 3
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 1
},
{
"field": "o_linked_glycan_sites",
"count": 3
}
],
"sort_fields": [
"glytoucan_ac",
"type",
"subtype",
"site_category",
"site_seq",
"relation",
"comment",
"start_pos",
"start_aa",
"end_pos",
"end_aa",
"residue",
"site_lbl"
]
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 67
},
{
"field": "total_sites",
"count": 52
}
],
"sort_fields": [
"start_pos",
"end_pos",
"kinase_uniprot_canonical_ac",
"kinase_gene_name",
"residue",
"comment",
"site_lbl"
]
},
{
"table_id": "snv",
"table_stats": [
{
"field": "total",
"count": 14
},
{
"field": "total_sites",
"count": 10
}
],
"sort_fields": [
"start_pos",
"end_pos",
"sequence_org",
"sequence_mut",
"comment",
"chr_id",
"chr_pos",
"ref_nt",
"alt_nt",
"minor_allelic_frequency",
"site_lbl",
"subjects_tested",
"subjects_positive",
"frequency"
]
},
{
"table_id": "snv_disease",
"table_stats": [
{
"field": "total",
"count": 1
},
{
"field": "total_sites",
"count": 1
}
],
"sort_fields": [
"start_pos",
"end_pos",
"sequence_org",
"sequence_mut",
"comment",
"chr_id",
"chr_pos",
"ref_nt",
"alt_nt",
"minor_allelic_frequency",
"site_lbl",
"subjects_tested",
"subjects_positive",
"frequency"
]
},
{
"table_id": "snv_non_disease",
"table_stats": [
{
"field": "total",
"count": 13
},
{
"field": "total_sites",
"count": 9
}
],
"sort_fields": [
"start_pos",
"end_pos",
"sequence_org",
"sequence_mut",
"comment",
"chr_id",
"chr_pos",
"ref_nt",
"alt_nt",
"minor_allelic_frequency",
"site_lbl",
"subjects_tested",
"subjects_positive",
"frequency"
]
},
{
"table_id": "publication",
"table_stats": [
{
"field": "total",
"count": 497
}
],
"sort_fields": [
"title",
"journal",
"date",
"authors"
]
}
]
}