{
"uniprot_canonical_ac": "P00480-1",
"uniprot_ac": "P00480",
"uniprot_id": "OTC_HUMAN",
"mass": {
"chemical_mass": 39935.0,
"monoisotopic_mass": 39935.0
},
"refseq": {
"ac": "NP_000522",
"name": "ornithine transcarbamylase, mitochondrial precursor",
"summary": "This nuclear gene encodes a mitochondrial matrix enzyme. The encoded protein is involved in the urea cycle which functions to detoxify ammonia into urea for excretion. Mutations in this enzyme lead to ornithine transcarbamylase deficiency, which causes hyperammonemia. [provided by RefSeq, May 2022].",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000522"
},
"gene_names": [
{
"name": "OTC",
"resource": "UniProtKB",
"type": "recommended",
"url": "https://www.uniprot.org/uniprot/P00480",
"id": "P00480"
},
{
"name": "OCTD; OTC1; OTCase; OTCD",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000522",
"id": "NP_000522"
},
{
"name": "OTC",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000522",
"id": "NP_000522"
}
],
"protein_names": [
{
"name": "Ornithine transcarbamylase, mitochondrial",
"resource": "UniProtKB",
"type": "recommended",
"url": "",
"id": "P00480"
},
{
"name": "2.1.3.3",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P00480"
},
{
"name": "OTCase",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P00480"
},
{
"name": "Ornithine carbamoyltransferase, mitochondrial",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P00480"
},
{
"name": "ornithine carbamoyltransferase, mitochondrial; ornithine transcarbamylase, mitochondrial",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000522",
"id": "NP_000522"
},
{
"name": "ornithine transcarbamylase, mitochondrial precursor",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000522",
"id": "NP_000522"
}
],
"function": [
{
"annotation": "A promoter variant in the OTC gene associated with late and variable age of onset hyperammonemia.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000522",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000522"
},
{
"database": "PubMed",
"id": "35605046",
"url": "https://glygen.org/publication/PubMed/35605046"
}
]
},
{
"annotation": "Adult presentation of ornithine transcarbamylase deficiency: a possible cause of hyperammonemia after high-dose chemotherapy and stem cell transplantation.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000522",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000522"
},
{
"database": "PubMed",
"id": "38078487",
"url": "https://glygen.org/publication/PubMed/38078487"
}
]
},
{
"annotation": "Catalyzes the second step of the urea cycle, the condensation of carbamoyl phosphate with L-ornithine to form L-citrulline (PubMed:6372096, PubMed:8112735, PubMed:2556444). The urea cycle ensures the detoxification of ammonia by converting it to urea for excretion (PubMed:2556444).",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480#function"
},
{
"database": "PubMed",
"id": "6372096",
"url": "https://glygen.org/publication/PubMed/6372096"
},
{
"database": "PubMed",
"id": "8112735",
"url": "https://glygen.org/publication/PubMed/8112735"
},
{
"database": "PubMed",
"id": "2556444",
"url": "https://glygen.org/publication/PubMed/2556444"
}
]
},
{
"annotation": "The functional impact of 1,570 individual amino acid substitutions in human OTC.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000522",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000522"
},
{
"database": "PubMed",
"id": "37146589",
"url": "https://glygen.org/publication/PubMed/37146589"
}
]
},
{
"annotation": "This nuclear gene encodes a mitochondrial matrix enzyme. The encoded protein is involved in the urea cycle which functions to detoxify ammonia into urea for excretion. Mutations in this enzyme lead to ornithine transcarbamylase deficiency, which causes hyperammonemia. [provided by RefSeq, May 2022].",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000522",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000522"
}
]
},
{
"annotation": "[Analysis of OTC gene variants in four children with delayed onset Ornithine transcarbamylase deficiency].",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000522",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000522"
},
{
"database": "PubMed",
"id": "36854409",
"url": "https://glygen.org/publication/PubMed/36854409"
}
]
}
],
"disease": [
{
"disease_id": "DOID:9271",
"recommended_name": {
"id": "DOID:9271",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9271",
"name": "ornithine carbamoyltransferase deficiency",
"description": "An urea cycle disorder that involves a mutated and ineffective form of the enzyme ornithine transcarbamylase."
},
"synonyms": [
{
"id": "DOID:9271",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9271",
"name": "deficiency of citrulline phosphorylase",
"description": ""
},
{
"id": "DOID:9271",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9271",
"name": "ornithine transcarbamylase deficiency",
"description": ""
},
{
"id": "MONDO:0010703",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010703",
"name": "ornithine carbamoyltransferase deficiency",
"description": "Ornithine transcarbamylase deficiency (OTCD) is a disorder of urea cycle metabolism and ammonia detoxification characterized by either a severe, neonatal-onset disease found almost exclusively in males, or later-onset (partial) forms of the disease. Both present with episodes of hyperammonemia that can be fatal and which can lead to neurological complications."
},
{
"id": "MONDO:0010703",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010703",
"name": "OCT deficiency",
"description": ""
},
{
"id": "MONDO:0010703",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010703",
"name": "OTC deficiency",
"description": ""
},
{
"id": "MONDO:0010703",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010703",
"name": "OTCD",
"description": ""
},
{
"id": "MONDO:0010703",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010703",
"name": "deficiency of citrulline phosphorylase",
"description": ""
},
{
"id": "MONDO:0010703",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010703",
"name": "ornithine carbamoyltransferase deficiency",
"description": ""
},
{
"id": "MONDO:0010703",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010703",
"name": "ornithine carbamoyltransferase deficiency disease",
"description": ""
},
{
"id": "MONDO:0010703",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010703",
"name": "ornithine transcarbamylase deficiency",
"description": ""
},
{
"id": "MONDO:0010703",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010703",
"name": "ornithine transcarbamylase deficiency, hyperammonemia due to",
"description": ""
},
{
"id": "MONDO:0010703",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010703",
"name": "valproate sensitivity",
"description": ""
},
{
"id": "MIM:311250",
"resource": "MIM",
"url": "https://www.omim.org/entry/311250",
"name": "Ornithine carbamoyltransferase deficiency",
"description": "Ornithine carbamoyltransferase deficiency"
}
],
"evidence": [
{
"id": "311250",
"database": "MIM",
"url": "https://www.omim.org/entry/311250"
}
]
}
],
"snv": [],
"mutagenesis": [
{
"start_pos": 15,
"end_pos": 15,
"sequence_org": "R",
"sequence_mut": "G",
"comment": "Loss of cleavage of the transit peptide and loss of localization to mitochondrial matrix; when associated with G-23 and G-26.",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
},
{
"database": "PubMed",
"id": "6372096",
"url": "https://glygen.org/publication/PubMed/6372096"
}
]
},
{
"start_pos": 23,
"end_pos": 23,
"sequence_org": "R",
"sequence_mut": "G",
"comment": "Loss of cleavage of the transit peptide and loss of localization to mitochondrial matrix; when associated with G-15 and G-26.",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
},
{
"database": "PubMed",
"id": "3895227",
"url": "https://glygen.org/publication/PubMed/3895227"
}
]
},
{
"start_pos": 26,
"end_pos": 26,
"sequence_org": "R",
"sequence_mut": "G",
"comment": "Loss of cleavage of the transit peptide and loss of localization to mitochondrial matrix; when associated with G-15 and G-23.",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
},
{
"database": "PubMed",
"id": "3895227",
"url": "https://glygen.org/publication/PubMed/3895227"
}
]
}
],
"expression_tissue": [
{
"tissue": {
"name": "Adult mammalian kidney",
"namespace": "UBERON",
"id": "0000082",
"url": "http://purl.obolibrary.org/obo/UBERON_0000082"
},
"score": "40.95",
"present": "ABSENT",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000036473",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000036473"
}
]
},
{
"tissue": {
"name": "Oral cavity",
"namespace": "UBERON",
"id": "0000167",
"url": "http://purl.obolibrary.org/obo/UBERON_0000167"
},
"score": "41.27",
"present": "ABSENT",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000036473",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000036473"
}
]
},
{
"tissue": {
"name": "Stomach",
"namespace": "UBERON",
"id": "0000945",
"url": "http://purl.obolibrary.org/obo/UBERON_0000945"
},
"score": "49.96",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000036473",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000036473"
}
]
},
{
"tissue": {
"name": "Uterus",
"namespace": "UBERON",
"id": "0000995",
"url": "http://purl.obolibrary.org/obo/UBERON_0000995"
},
"score": "49.96",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000036473",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000036473"
}
]
},
{
"tissue": {
"name": "Esophagus",
"namespace": "UBERON",
"id": "0001043",
"url": "http://purl.obolibrary.org/obo/UBERON_0001043"
},
"score": "59.09",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000036473",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000036473"
}
]
},
{
"tissue": {
"name": "Rectum",
"namespace": "UBERON",
"id": "0001052",
"url": "http://purl.obolibrary.org/obo/UBERON_0001052"
},
"score": "73.4",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000036473",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000036473"
}
]
},
{
"tissue": {
"name": "Colon",
"namespace": "UBERON",
"id": "0001155",
"url": "http://purl.obolibrary.org/obo/UBERON_0001155"
},
"score": "47.76",
"present": "LOW",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000036473",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000036473"
}
]
},
{
"tissue": {
"name": "Urinary bladder",
"namespace": "UBERON",
"id": "0001255",
"url": "http://purl.obolibrary.org/obo/UBERON_0001255"
},
"score": "48.31",
"present": "LOW",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000036473",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000036473"
}
]
},
{
"tissue": {
"name": "Thyroid gland",
"namespace": "UBERON",
"id": "0002046",
"url": "http://purl.obolibrary.org/obo/UBERON_0002046"
},
"score": "48.63",
"present": "LOW",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000036473",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000036473"
}
]
},
{
"tissue": {
"name": "Lung",
"namespace": "UBERON",
"id": "0002048",
"url": "http://purl.obolibrary.org/obo/UBERON_0002048"
},
"score": "47.6",
"present": "LOW",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000036473",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000036473"
}
]
},
{
"tissue": {
"name": "Liver",
"namespace": "UBERON",
"id": "0002107",
"url": "http://purl.obolibrary.org/obo/UBERON_0002107"
},
"score": "92.94",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000036473",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000036473"
}
]
},
{
"tissue": {
"name": "Prostate gland",
"namespace": "UBERON",
"id": "0002367",
"url": "http://purl.obolibrary.org/obo/UBERON_0002367"
},
"score": "24.32",
"present": "LOW",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000036473",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000036473"
}
]
},
{
"tissue": {
"name": "Thoracic mammary gland",
"namespace": "UBERON",
"id": "0005200",
"url": "http://purl.obolibrary.org/obo/UBERON_0005200"
},
"score": "41.48",
"present": "LOW",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000036473",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000036473"
}
]
}
],
"expression_disease": [
{
"significant": "No",
"trend": "down",
"name": "Prostate cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10283",
"evidence": [
{
"database": "BioXpress",
"id": "P00480",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00480"
}
],
"disease": [
{
"disease_id": "DOID:10283",
"recommended_name": {
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer",
"description": "A male reproductive organ cancer that is located_in the prostate."
},
"synonyms": [
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "NGP - new growth of prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "malignant tumor of the prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "tumor of the prostate",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, type 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "HPC9",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene."
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "EHBP1 familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "familial prostate cancer caused by mutation in EHBP1",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, type 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "HPC12",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, type 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "HPC5",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, type 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, susceptibility to, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "HPC3",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, type 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, susceptibility to, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "HPC4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, on chromosome 7",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene."
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "MSMB familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "familial prostate cancer caused by mutation in MSMB",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, type 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "HPC13",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, type 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "HPC8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "predisposing for prostate cancer",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, type 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "HPC6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "HPC10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate carcinoma",
"description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma."
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate carcinoma",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, somatic",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, hereditary",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "HPC7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer aggressiveness",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene."
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "RNASEL familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "familial prostate cancer caused by mutation in RNASEL",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, type 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "HPC1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "Prca1",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "HPC11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "HPC14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "HPC15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "HPCX1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer susceptibility, X-linked",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "HPCX2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MIM:611868",
"resource": "MIM",
"url": "https://www.omim.org/entry/611868",
"name": "Prostate cancer, hereditary, 12",
"description": "Prostate cancer, hereditary, 12"
},
{
"id": "MIM:611928",
"resource": "MIM",
"url": "https://www.omim.org/entry/611928",
"name": "Prostate cancer, hereditary, 13",
"description": "Prostate cancer, hereditary, 13"
},
{
"id": "MIM:176807",
"resource": "MIM",
"url": "https://www.omim.org/entry/176807",
"name": "Prostate cancer",
"description": "Prostate cancer"
},
{
"id": "MIM:601518",
"resource": "MIM",
"url": "https://www.omim.org/entry/601518",
"name": "Prostate cancer, hereditary, 1",
"description": "Prostate cancer, hereditary, 1"
},
{
"id": "MIM:611955",
"resource": "MIM",
"url": "https://www.omim.org/entry/611955",
"name": "Prostate cancer, hereditary, 11",
"description": "Prostate cancer, hereditary, 11"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Stomach cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10534",
"evidence": [
{
"database": "BioXpress",
"id": "P00480",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00480"
}
],
"disease": [
{
"disease_id": "DOID:10534",
"recommended_name": {
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "stomach cancer",
"description": "A gastrointestinal system cancer that is located_in the stomach."
},
"synonyms": [
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric cancer",
"description": ""
},
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": "A primary or metastatic malignant neoplasm involving the stomach."
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca lesser curvature - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "cancer of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer risk after h. pylori infection",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumor",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumour",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant stomach neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "stomach cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca body - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "ca greater curvature of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, intestinal",
"description": ""
},
{
"id": "MIM:613659",
"resource": "MIM",
"url": "https://www.omim.org/entry/613659",
"name": "Gastric cancer",
"description": "Gastric cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Urinary bladder cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11054",
"evidence": [
{
"database": "BioXpress",
"id": "P00480",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00480"
}
],
"disease": [
{
"disease_id": "DOID:11054",
"recommended_name": {
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "urinary bladder cancer",
"description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder."
},
"synonyms": [
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "bladder cancer",
"description": ""
},
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": "A primary or metastatic malignant neoplasm involving the bladder."
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "bladder cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "cancer of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumour",
"description": ""
},
{
"id": "MIM:109800",
"resource": "MIM",
"url": "https://www.omim.org/entry/109800",
"name": "Bladder cancer",
"description": "Bladder cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Head and neck cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11934",
"evidence": [
{
"database": "BioXpress",
"id": "P00480",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00480"
}
],
"disease": [
{
"disease_id": "DOID:11934",
"recommended_name": {
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck cancer",
"description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx."
},
"synonyms": [
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck tumours",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head/neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "tumor of head and neck",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Lung cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1324",
"evidence": [
{
"database": "BioXpress",
"id": "P00480",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00480"
}
],
"disease": [
{
"disease_id": "DOID:1324",
"recommended_name": {
"id": "DOID:1324",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1324",
"name": "lung cancer",
"description": "A respiratory system cancer that is located_in the lung."
},
"synonyms": [
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "LNCR1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "LNCR3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "adenocarcinoma of lung, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "LNCR4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "LNCR5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": "A malignant neoplasm involving the lung."
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "cancer of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung neoplasm",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumor",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumour",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "Nonsmall cell lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "alveolar cell carcinoma",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung neoplasm",
"description": ""
},
{
"id": "MIM:211980",
"resource": "MIM",
"url": "https://www.omim.org/entry/211980",
"name": "Lung cancer",
"description": "Lung cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Breast cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1612",
"evidence": [
{
"database": "BioXpress",
"id": "P00480",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00480"
}
],
"disease": [
{
"disease_id": "DOID:1612",
"recommended_name": {
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast cancer",
"description": "A thoracic cancer that originates in the mammary gland."
},
"synonyms": [
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant neoplasm of breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant tumor of the breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary cancer",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "primary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma."
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer susceptibility, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, lobular, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of the breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial Male",
"description": ""
},
{
"id": "MIM:114480",
"resource": "MIM",
"url": "https://www.omim.org/entry/114480",
"name": "Breast cancer",
"description": "Breast cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Thyroid cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1781",
"evidence": [
{
"database": "BioXpress",
"id": "P00480",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00480"
}
],
"disease": [
{
"disease_id": "DOID:1781",
"recommended_name": {
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid cancer",
"description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage."
},
"synonyms": [
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid gland cancer",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "Thyroid gland neoplasm",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant tumour of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Kidney cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:263",
"evidence": [
{
"database": "BioXpress",
"id": "P00480",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00480"
}
],
"disease": [
{
"disease_id": "DOID:263",
"recommended_name": {
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "kidney cancer",
"description": "A urinary system cancer that is located_in the kidney."
},
"synonyms": [
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant neoplasm of kidney except pelvis",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant tumour of kidney",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "renal cancer",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Liver cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:3571",
"evidence": [
{
"database": "BioXpress",
"id": "P00480",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00480"
}
],
"disease": [
{
"disease_id": "DOID:3571",
"recommended_name": {
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "liver cancer",
"description": "A hepatobiliary system cancer that is located_in the liver."
},
"synonyms": [
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Ca liver - primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Resectable malignant neoplasm of Liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant hepato-biliary neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant tumor of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "non-resectable primary hepatic malignant neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary liver cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "resectable malignant neoplasm of the liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, not specified as primary or secondary",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Uterine cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:363",
"evidence": [
{
"database": "BioXpress",
"id": "P00480",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00480"
}
],
"disease": [
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Esophageal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:5041",
"evidence": [
{
"database": "BioXpress",
"id": "P00480",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00480"
}
],
"disease": [
{
"disease_id": "DOID:5041",
"recommended_name": {
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophageal cancer",
"description": "A gastrointestinal system cancer that is located_in the esophagus."
},
"synonyms": [
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophagus cancer",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Distal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Proximal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of the middle Third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": "A primary or metastatic malignant neoplasm involving the esophagus."
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "oesophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the middle third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of abdominal oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the middle third of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Aerodigestive tract cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Escc, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "gastric cardia adenocarcinoma, susceptibility to",
"description": ""
},
{
"id": "MIM:133239",
"resource": "MIM",
"url": "https://www.omim.org/entry/133239",
"name": "Esophageal cancer",
"description": "Esophageal cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Colorectal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:9256",
"evidence": [
{
"database": "BioXpress",
"id": "P00480",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00480"
}
],
"disease": [
{
"disease_id": "DOID:9256",
"recommended_name": {
"id": "DOID:9256",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9256",
"name": "colorectal cancer",
"description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
},
"synonyms": [
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, advanced, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer with chromosomal instability, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectum cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectum neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "CRC",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "large intestine cancer",
"description": ""
},
{
"id": "MIM:114500",
"resource": "MIM",
"url": "https://www.omim.org/entry/114500",
"name": "Colorectal cancer",
"description": "Colorectal cancer"
}
]
}
]
}
],
"species": [
{
"name": "Homo sapiens",
"taxid": 9606,
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"common_name": "Human"
}
],
"gene": [
{
"name": "OTC",
"url": "https://www.uniprot.org/uniprot/P00480",
"locus": {
"chromosome": "X",
"start_pos": 38421446,
"end_pos": 38352586,
"strand": "-",
"evidence": [
{
"database": "Ensembl Gene",
"id": "ENSG00000036473",
"url": "https://www.ensembl.org/id/ENSG00000036473"
}
]
}
}
],
"crossref": [
{
"id": "ENSG00000036473",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000036473",
"database": "Bgee",
"categories": [
"Gene Expression"
]
},
{
"id": "2.1.3.3",
"url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.1.3.3&UniProtAcc=P00480",
"database": "BRENDA",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "CHEMBL2222",
"url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2222",
"database": "ChEMBL",
"categories": [
"Other"
]
},
{
"id": "OTC",
"url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=OTC",
"database": "GeneCards",
"categories": [
"Gene Annotation",
"Organism-specific"
]
},
{
"id": "5009",
"url": "https://www.ncbi.nlm.nih.gov/gene/5009",
"database": "GeneID",
"categories": [
"Genome Annotation"
]
},
{
"id": "8512",
"url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=8512",
"database": "HGNC",
"categories": [
"Organism-specific"
]
},
{
"id": "P00480",
"url": "https://www.ebi.ac.uk/intact/interactors/id:P00480*",
"database": "IntAct",
"categories": [
"Other"
]
},
{
"id": "IPR002292",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR002292",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR006130",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR006130",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR006131",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR006131",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR006132",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR006132",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR036901",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR036901",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "hsa:5009",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5009",
"database": "KEGG Pathway",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "300461",
"url": "http://www.omim.org/entry/300461",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "311250",
"url": "http://www.omim.org/entry/311250",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "NX_P00480",
"url": "https://www.nextprot.org/entry/NX_P00480",
"database": "neXtProt",
"categories": [
"Protein",
"Organism-specific"
]
},
{
"id": "DGNNVCN",
"url": "https://omabrowser.org/oma/group/DGNNVCN/",
"database": "OMA",
"categories": [
"Protein Classification"
]
},
{
"id": "2782890at2759",
"url": "http://www.orthodb.org/?query=2782890at2759",
"database": "OrthoDB",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR45753",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45753",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR45753:SF3",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45753:SF3",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "1C9Y",
"url": "https://www.rcsb.org/structure/1C9Y",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1EP9",
"url": "https://www.rcsb.org/structure/1EP9",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1FVO",
"url": "https://www.rcsb.org/structure/1FVO",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1OTH",
"url": "https://www.rcsb.org/structure/1OTH",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "PF00185",
"url": "http://pfam.xfam.org/family/PF00185",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "PF02729",
"url": "http://pfam.xfam.org/family/PF02729",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "P00480",
"url": "https://pharos.nih.gov/targets/P00480",
"database": "PHAROS",
"categories": [
"Organism-specific"
]
},
{
"id": "PR_P00480",
"url": "http://purl.obolibrary.org/obo/PR_P00480",
"database": "PRO",
"categories": [
"Protein"
]
},
{
"id": "R-HSA-1268020",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1268020",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-70635",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70635",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "NP_000522",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000522",
"database": "RefSeq",
"categories": [
"Protein"
]
},
{
"id": "19513",
"url": "https://www.rhea-db.org/rhea/19513",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "A0A2R8Y829",
"url": "https://www.uniprot.org/uniprot/A0A2R8Y829",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A2R8Y829-1",
"url": "https://www.uniprot.org/uniprot/A0A2R8Y829-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P00480-1",
"url": "https://www.uniprot.org/uniprot/P00480-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
}
],
"sequence": {
"sequence": "MLFNLRILLNNAAFRNGHNFMVRNFRCGQPLQNKVQLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQKGEYLPLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPCFLTTQDIHLGVNESLTDTARVLSSMADAVLARVYKQSDLDTLAKEASIPIINGLSDLYHPIQILADYLTLQEHYSSLKGLTLSWIGDGNNILHSIMMSAAKFGMHLQAATPKGYEPDASVTKLAEQYAKENGTKLLLTNDPLEAAHGGNVLITDTWISMGQEEEKKKRLQAFQGYQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSPRSLVFPEAENRKWTIMAVMVSLLTDYSPQLQKPKF",
"length": 354,
"header": "sp|P00480-1|OTC_HUMAN Isoform 1 of Ornithine transcarbamylase, mitochondrial OS=Homo sapiens OX=9606 GN=OTC PE=1 SV=3 CANONICAL=P00480-1"
},
"isoforms": [
{
"isoform_ac": "A0A2R8Y829-1",
"url": "",
"sequence": {
"sequence": "MLFNLRILLNNAAFRNGHNFMVRNFRCGQPLQNKVQLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQKGEYLPLLQGKSLGMIFEKRSTRTRLSTETGEIETGVLTAVSKSSSVQRCQCKNCDTIVQL",
"length": 130,
"header": "tr|A0A2R8Y829-1|A0A2R8Y829_HUMAN Computationally mapped isoform of ornithine carbamoyltransferase OS=Homo sapiens OX=9606 GN=OTC PE=1 SV=1 CANONICAL=P00480-1"
},
"locus": {
"chromosome": "X",
"start_pos": 38373687,
"end_pos": 38352697,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000643344.1",
"url": "https://www.ensembl.org/id/ENST00000643344.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000496606.1",
"url": "https://www.ensembl.org/id/ENSP00000496606.1"
}
]
}
},
{
"isoform_ac": "P00480-1",
"url": "",
"sequence": {
"sequence": "MLFNLRILLNNAAFRNGHNFMVRNFRCGQPLQNKVQLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQKGEYLPLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPCFLTTQDIHLGVNESLTDTARVLSSMADAVLARVYKQSDLDTLAKEASIPIINGLSDLYHPIQILADYLTLQEHYSSLKGLTLSWIGDGNNILHSIMMSAAKFGMHLQAATPKGYEPDASVTKLAEQYAKENGTKLLLTNDPLEAAHGGNVLITDTWISMGQEEEKKKRLQAFQGYQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSPRSLVFPEAENRKWTIMAVMVSLLTDYSPQLQKPKF",
"length": 354,
"header": "sp|P00480-1|OTC_HUMAN Isoform 1 of Ornithine transcarbamylase, mitochondrial OS=Homo sapiens OX=9606 GN=OTC PE=1 SV=3 CANONICAL=P00480-1"
},
"locus": {
"chromosome": "X",
"start_pos": 38421079,
"end_pos": 38352697,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000039007.5",
"url": "https://www.ensembl.org/id/ENST00000039007.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000039007.4",
"url": "https://www.ensembl.org/id/ENSP00000039007.4"
}
]
}
}
],
"glycosylation": [],
"phosphorylation": [
{
"start_pos": 133,
"end_pos": 133,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "Phosphoserine",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
},
{
"database": "PubMed",
"id": "24275569",
"url": "https://glygen.org/publication/PubMed/24275569"
},
{
"database": "iPTMnet",
"id": "P00480",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00480"
}
],
"site_lbl": "Ser133"
}
],
"glycation": [],
"keywords": [
"enzyme"
],
"publication": [
{
"title": "Three novel and one recurrent ornithine carbamoyltransferase gene mutations in Polish patients.",
"journal": "Journal of inherited metabolic disease",
"date": "1999",
"authors": "Popowska E, Ciara E, Rokicki D, Pronicka E",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "10070627",
"url": "https://glygen.org/publication/PubMed/10070627"
}
]
},
{
"title": "Hyperornithinaemia-hyperammonaemia-homocitrullinuria syndrome is caused by mutations in a gene encoding a mitochondrial ornithine transporter.",
"journal": "Nature genetics",
"date": "1999",
"authors": "Camacho JA, Obie C, Biery B, Goodman BK, Hu CA, Almashanu S, Steel G, Casey R, Lambert M, Mitchell GA, Valle D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-70635",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70635"
}
],
"reference": [
{
"type": "PubMed",
"id": "10369256",
"url": "https://glygen.org/publication/PubMed/10369256"
}
]
},
{
"title": "Identification of a cytogenetic deletion and of four novel mutations (Q69X, I172F, G188V, G197R) affecting the gene for ornithine transcarbamylase (OTC) in Spanish patients with OTC deficiency.",
"journal": "Human mutation",
"date": "1999",
"authors": "Climent C, Garcia-Perez MA, Sanjurjo P, Ruiz-Sanz JI, Vilaseca MA, Pineda M, Campistol J, Rubio V",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "10502831",
"url": "https://glygen.org/publication/PubMed/10502831"
}
]
},
{
"title": "Lymphocyte mRNA analysis of the ornithine transcarbamylase gene in Italian OTCD male patients and manifesting carriers: identification of novel mutations.",
"journal": "Human mutation",
"date": "2000",
"authors": "Giorgi M, Morrone A, Donati MA, Ciani F, Bardelli T, Biasucci G, Zammarchi E",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "10737985",
"url": "https://glygen.org/publication/PubMed/10737985"
}
]
},
{
"title": "Crystal structure of human ornithine transcarbamylase complexed with carbamoyl phosphate and L-norvaline at 1.9 A resolution.",
"journal": "Proteins",
"date": "2000",
"authors": "Shi D, Morizono H, Aoyagi M, Tuchman M, Allewell NM",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "10813810",
"url": "https://glygen.org/publication/PubMed/10813810"
}
]
},
{
"title": "Human ornithine transcarbamylase: crystallographic insights into substrate recognition and conformational changes.",
"journal": "The Biochemical journal",
"date": "2001",
"authors": "Shi D, Morizono H, Yu X, Tong L, Allewell NM, Tuchman M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-70635",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70635"
}
],
"reference": [
{
"type": "PubMed",
"id": "11237854",
"url": "https://glygen.org/publication/PubMed/11237854"
}
]
},
{
"title": "Identification of seven novel missense mutations, two splice-site mutations, two microdeletions and a polymorphic amino acid substitution in the gene for ornithine transcarbamylase (OTC) in patients with OTC deficiency.",
"journal": "Human mutation",
"date": "2002",
"authors": "Climent C, Rubio V",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "11793483",
"url": "https://glygen.org/publication/PubMed/11793483"
}
]
},
{
"title": "Cloning and expression of the human N-acetylglutamate synthase gene.",
"journal": "Biochemical and biophysical research communications",
"date": "2002",
"authors": "Caldovic L, Morizono H, Gracia Panglao M, Gallegos R, Yu X, Shi D, Malamy MH, Allewell NM, Tuchman M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-70635",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70635"
}
],
"reference": [
{
"type": "PubMed",
"id": "12459178",
"url": "https://glygen.org/publication/PubMed/12459178"
}
]
},
{
"title": "The mitochondrial ornithine transporter. Bacterial expression, reconstitution, functional characterization, and tissue distribution of two human isoforms.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Fiermonte G, Dolce V, David L, Santorelli FM, Dionisi-Vici C, Palmieri F, Walker JE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-70635",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70635"
}
],
"reference": [
{
"type": "PubMed",
"id": "12807890",
"url": "https://glygen.org/publication/PubMed/12807890"
}
]
},
{
"title": "Human arginase II: crystal structure and physiological role in male and female sexual arousal.",
"journal": "Biochemistry",
"date": "2003",
"authors": "Cama E, Colleluori DM, Emig FA, Shin H, Kim SW, Kim NN, Traish AM, Ash DE, Christianson DW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-70635",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70635"
}
],
"reference": [
{
"type": "PubMed",
"id": "12859189",
"url": "https://glygen.org/publication/PubMed/12859189"
}
]
},
{
"title": "Cloning and characterization of human ORNT2: a second mitochondrial ornithine transporter that can rescue a defective ORNT1 in patients with the hyperornithinemia-hyperammonemia-homocitrullinuria syndrome, a urea cycle disorder.",
"journal": "Molecular genetics and metabolism",
"date": "2003",
"authors": "Camacho JA, Rioseco-Camacho N, Andrade D, Porter J, Kong J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-70635",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70635"
}
],
"reference": [
{
"type": "PubMed",
"id": "12948741",
"url": "https://glygen.org/publication/PubMed/12948741"
}
]
},
{
"title": "Organization and function of the small Tim complexes acting along the import pathway of metabolite carriers into mammalian mitochondria.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Muhlenbein N, Hofmann S, Rothbauer U, Bauer MF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1268020",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1268020"
}
],
"reference": [
{
"type": "PubMed",
"id": "14726512",
"url": "https://glygen.org/publication/PubMed/14726512"
}
]
},
{
"title": "Six new mutations in the ornithine transcarbamylase gene detected by single-strand conformational polymorphism.",
"journal": "Pediatric research",
"date": "1992",
"authors": "Tuchman M, Holzknecht RA, Gueron AB, Berry SA, Tsai MY",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "1480464",
"url": "https://glygen.org/publication/PubMed/1480464"
}
]
},
{
"title": "Mammalian N-acetylglutamate synthase.",
"journal": "Molecular genetics and metabolism",
"date": "2004",
"authors": "Morizono H, Caldovic L, Shi D, Tuchman M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-70635",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70635"
}
],
"reference": [
{
"type": "PubMed",
"id": "15050968",
"url": "https://glygen.org/publication/PubMed/15050968"
}
]
},
{
"title": "The calcium-binding aspartate/glutamate carriers, citrin and aralar1, are new substrates for the DDP1/TIMM8a-TIMM13 complex.",
"journal": "Human molecular genetics",
"date": "2004",
"authors": "Roesch K, Hynds PJ, Varga R, Tranebjaerg L, Koehler CM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1268020",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1268020"
}
],
"reference": [
{
"type": "PubMed",
"id": "15254020",
"url": "https://glygen.org/publication/PubMed/15254020"
}
]
},
{
"title": "Dissection of the mitochondrial import and assembly pathway for human Tom40.",
"journal": "The Journal of biological chemistry",
"date": "2005",
"authors": "Humphries AD, Streimann IC, Stojanovski D, Johnston AJ, Yano M, Hoogenraad NJ, Ryan MT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1268020",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1268020"
}
],
"reference": [
{
"type": "PubMed",
"id": "15644312",
"url": "https://glygen.org/publication/PubMed/15644312"
}
]
},
{
"title": "Augmenter of liver regeneration: a flavin-dependent sulfhydryl oxidase with cytochrome c reductase activity.",
"journal": "Biochemistry",
"date": "2005",
"authors": "Farrell SR, Thorpe C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1268020",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1268020"
}
],
"reference": [
{
"type": "PubMed",
"id": "15683237",
"url": "https://glygen.org/publication/PubMed/15683237"
}
]
},
{
"title": "Crystal structure of human arginase I at 1.29-A resolution and exploration of inhibition in the immune response.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2005",
"authors": "Di Costanzo L, Sabio G, Mora A, Rodriguez PC, Ochoa AC, Centeno F, Christianson DW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-70635",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70635"
}
],
"reference": [
{
"type": "PubMed",
"id": "16141327",
"url": "https://glygen.org/publication/PubMed/16141327"
}
]
},
{
"title": "Functional and mutational characterization of human MIA40 acting during import into the mitochondrial intermembrane space.",
"journal": "Journal of molecular biology",
"date": "2005",
"authors": "Hofmann S, Rothbauer U, Muhlenbein N, Baiker K, Hell K, Bauer MF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1268020",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1268020"
}
],
"reference": [
{
"type": "PubMed",
"id": "16185709",
"url": "https://glygen.org/publication/PubMed/16185709"
}
]
},
{
"title": "Improved molecular diagnostics for ornithine transcarbamylase deficiency.",
"journal": "American journal of human genetics",
"date": "1991",
"authors": "Grompe M, Caskey CT, Fenwick RG",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "1671317",
"url": "https://glygen.org/publication/PubMed/1671317"
}
]
},
{
"title": "Degradation of the amyloid beta-protein by the novel mitochondrial peptidasome, PreP.",
"journal": "The Journal of biological chemistry",
"date": "2006",
"authors": "Falkevall A, Alikhani N, Bhushan S, Pavlov PF, Busch K, Johnson KA, Eneqvist T, Tjernberg L, Ankarcrona M, Glaser E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1268020",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1268020"
}
],
"reference": [
{
"type": "PubMed",
"id": "16849325",
"url": "https://glygen.org/publication/PubMed/16849325"
}
]
},
{
"title": "The consensus coding sequences of human breast and colorectal cancers.",
"journal": "Science",
"date": "2006",
"authors": "Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "16959974",
"url": "https://glygen.org/publication/PubMed/16959974"
}
]
},
{
"title": "Fatal hyperammonemia resulting from a C-to-T mutation at a MspI site of the ornithine transcarbamylase gene.",
"journal": "Human genetics",
"date": "1991",
"authors": "Hentzen D, Pelet A, Feldman D, Rabier D, Berthelot J, Munnich A",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "1721894",
"url": "https://glygen.org/publication/PubMed/1721894"
}
]
},
{
"title": "Restructuring of the dinucleotide-binding fold in an NADP(H) sensor protein.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2007",
"authors": "Zheng X, Dai X, Zhao Y, Chen Q, Lu F, Yao D, Yu Q, Liu X, Zhang C, Gu X, Luo M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-70635",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70635"
}
],
"reference": [
{
"type": "PubMed",
"id": "17496144",
"url": "https://glygen.org/publication/PubMed/17496144"
}
]
},
{
"title": "Conserved roles of Sam50 and metaxins in VDAC biogenesis.",
"journal": "EMBO reports",
"date": "2007",
"authors": "Kozjak-Pavlovic V, Ross K, Benlasfer N, Kimmig S, Karlas A, Rudel T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1268020",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1268020"
}
],
"reference": [
{
"type": "PubMed",
"id": "17510655",
"url": "https://glygen.org/publication/PubMed/17510655"
}
]
},
{
"title": "Multiple pathways for sorting mitochondrial precursor proteins.",
"journal": "EMBO reports",
"date": "2008",
"authors": "Bolender N, Sickmann A, Wagner R, Meisinger C, Pfanner N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1268020",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1268020"
}
],
"reference": [
{
"type": "PubMed",
"id": "18174896",
"url": "https://glygen.org/publication/PubMed/18174896"
}
]
},
{
"title": "An NADPH sensor protein (HSCARG) down-regulates nitric oxide synthesis by association with argininosuccinate synthetase and is essential for epithelial cell viability.",
"journal": "The Journal of biological chemistry",
"date": "2008",
"authors": "Zhao Y, Zhang J, Li H, Li Y, Ren J, Luo M, Zheng X",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-70635",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70635"
}
],
"reference": [
{
"type": "PubMed",
"id": "18263583",
"url": "https://glygen.org/publication/PubMed/18263583"
}
]
},
{
"title": "Structure of human argininosuccinate synthetase.",
"journal": "Acta crystallographica. Section D, Biological crystallography",
"date": "2008",
"authors": "Karlberg T, Collins R, van den Berg S, Flores A, Hammarstrom M, Hogbom M, Holmberg Schiavone L, Uppenberg J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-70635",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70635"
}
],
"reference": [
{
"type": "PubMed",
"id": "18323623",
"url": "https://glygen.org/publication/PubMed/18323623"
}
]
},
{
"title": "Step-size analyses of the mitochondrial Hsp70 import motor reveal the Brownian ratchet in operation.",
"journal": "The Journal of biological chemistry",
"date": "2008",
"authors": "Yamano K, Kuroyanagi-Hasegawa M, Esaki M, Yokota M, Endo T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1268020",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1268020"
}
],
"reference": [
{
"type": "PubMed",
"id": "18678864",
"url": "https://glygen.org/publication/PubMed/18678864"
}
]
},
{
"title": "Mutations and polymorphisms in the human argininosuccinate synthetase (ASS1) gene.",
"journal": "Human mutation",
"date": "2009",
"authors": "Engel K, Hohne W, Haberle J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-70635",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70635"
}
],
"reference": [
{
"type": "PubMed",
"id": "19006241",
"url": "https://glygen.org/publication/PubMed/19006241"
}
]
},
{
"title": "Lysine 88 acetylation negatively regulates ornithine carbamoyltransferase activity in response to nutrient signals.",
"journal": "The Journal of biological chemistry",
"date": "2009",
"authors": "Yu W, Lin Y, Yao J, Huang W, Lei Q, Xiong Y, Zhao S, Guan KL",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "19318352",
"url": "https://glygen.org/publication/PubMed/19318352"
}
]
},
{
"title": "The mitochondrial disulfide relay system protein GFER is mutated in autosomal-recessive myopathy with cataract and combined respiratory-chain deficiency.",
"journal": "American journal of human genetics",
"date": "2009",
"authors": "Di Fonzo A, Ronchi D, Lodi T, Fassone E, Tigano M, Lamperti C, Corti S, Bordoni A, Fortunato F, Nizzardo M, Napoli L, Donadoni C, Salani S, Saladino F, Moggio M, Bresolin N, Ferrero I, Comi GP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1268020",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1268020"
}
],
"reference": [
{
"type": "PubMed",
"id": "19409522",
"url": "https://glygen.org/publication/PubMed/19409522"
}
]
},
{
"title": "Multiple pathways for mitochondrial protein traffic.",
"journal": "Biological chemistry",
"date": "2009",
"authors": "Endo T, Yamano K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1268020",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1268020"
}
],
"reference": [
{
"type": "PubMed",
"id": "19453276",
"url": "https://glygen.org/publication/PubMed/19453276"
}
]
},
{
"title": "Roles of Tom70 in import of presequence-containing mitochondrial proteins.",
"journal": "The Journal of biological chemistry",
"date": "2009",
"authors": "Yamamoto H, Fukui K, Takahashi H, Kitamura S, Shiota T, Terao K, Uchida M, Esaki M, Nishikawa S, Yoshihisa T, Yamano K, Endo T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1268020",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1268020"
}
],
"reference": [
{
"type": "PubMed",
"id": "19767391",
"url": "https://glygen.org/publication/PubMed/19767391"
}
]
},
{
"title": "Genetic and biochemical studies of SNPs of the mitochondrial A beta-degrading protease, hPreP.",
"journal": "Neuroscience letters",
"date": "2010",
"authors": "Pinho CM, Bjork BF, Alikhani N, Backman HG, Eneqvist T, Fratiglioni L, Glaser E, Graff C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1268020",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1268020"
}
],
"reference": [
{
"type": "PubMed",
"id": "19962426",
"url": "https://glygen.org/publication/PubMed/19962426"
}
]
},
{
"title": "Structure of the human sulfhydryl oxidase augmenter of liver regeneration and characterization of a human mutation causing an autosomal recessive myopathy .",
"journal": "Biochemistry",
"date": "2010",
"authors": "Daithankar VN, Schaefer SA, Dong M, Bahnson BJ, Thorpe C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1268020",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1268020"
}
],
"reference": [
{
"type": "PubMed",
"id": "20593814",
"url": "https://glygen.org/publication/PubMed/20593814"
}
]
},
{
"title": "Decreased proteolytic activity of the mitochondrial amyloid-beta degrading enzyme, PreP peptidasome, in Alzheimer's disease brain mitochondria.",
"journal": "Journal of Alzheimer's disease : JAD",
"date": "2011",
"authors": "Alikhani N, Guo L, Yan S, Du H, Pinho CM, Chen JX, Glaser E, Yan SS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1268020",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1268020"
}
],
"reference": [
{
"type": "PubMed",
"id": "21750375",
"url": "https://glygen.org/publication/PubMed/21750375"
}
]
},
{
"title": "Molecular analysis of human argininosuccinate lyase: mutant characterization and alternative splicing of the coding region.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1990",
"authors": "Walker DC, McCloskey DA, Simard LR, McInnes RR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-70635",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70635"
}
],
"reference": [
{
"type": "PubMed",
"id": "2263616",
"url": "https://glygen.org/publication/PubMed/2263616"
}
]
},
{
"title": "In vitro oxidative inactivation of human presequence protease (hPreP).",
"journal": "Free radical biology & medicine",
"date": "2012",
"authors": "Teixeira PF, Pinho CM, Branca RM, Lehtio J, Levine RL, Glaser E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1268020",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1268020"
}
],
"reference": [
{
"type": "PubMed",
"id": "23041349",
"url": "https://glygen.org/publication/PubMed/23041349"
}
]
},
{
"title": "Use of denaturing gradient gel electrophoresis for detection of mutation and prospective diagnosis in late onset ornithine transcarbamylase deficiency.",
"journal": "Genomics",
"date": "1990",
"authors": "Finkelstein JE, Francomano CA, Brusilow SW, Traystman MD",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "2347583",
"url": "https://glygen.org/publication/PubMed/2347583"
}
]
},
{
"title": "A small molecule inhibitor of redox-regulated protein translocation into mitochondria.",
"journal": "Developmental cell",
"date": "2013",
"authors": "Dabir DV, Hasson SA, Setoguchi K, Johnson ME, Wongkongkathep P, Douglas CJ, Zimmerman J, Damoiseaux R, Teitell MA, Koehler CM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1268020",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1268020"
}
],
"reference": [
{
"type": "PubMed",
"id": "23597483",
"url": "https://glygen.org/publication/PubMed/23597483"
}
]
},
{
"title": "Interaction of presequence peptides with human translocase of inner membrane of mitochondria Tim23.",
"journal": "Biochemical and biophysical research communications",
"date": "2013",
"authors": "Zhang Y, Deng H, Zhao Q, Li SJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1268020",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1268020"
}
],
"reference": [
{
"type": "PubMed",
"id": "23811401",
"url": "https://glygen.org/publication/PubMed/23811401"
}
]
},
{
"title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.",
"journal": "Journal of proteomics",
"date": "2014",
"authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
},
{
"database": "iPTMnet",
"id": "P00480",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "24275569",
"url": "https://glygen.org/publication/PubMed/24275569"
}
]
},
{
"title": "Scanning detection of mutations in human ornithine transcarbamoylase by chemical mismatch cleavage.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1989",
"authors": "Grompe M, Muzny DM, Caskey CT",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "2474822",
"url": "https://glygen.org/publication/PubMed/2474822"
}
]
},
{
"title": "MNRR1 (formerly CHCHD2) is a bi-organellar regulator of mitochondrial metabolism.",
"journal": "Mitochondrion",
"date": "2015",
"authors": "Aras S, Bai M, Lee I, Springett R, Huttemann M, Grossman LI",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1268020",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1268020"
}
],
"reference": [
{
"type": "PubMed",
"id": "25315652",
"url": "https://glygen.org/publication/PubMed/25315652"
}
]
},
{
"title": "An arginine to glutamine mutation in residue 109 of human ornithine transcarbamylase completely abolishes enzymatic activity in Cos1 cells.",
"journal": "The Journal of clinical investigation",
"date": "1989",
"authors": "Lee JT, Nussbaum RL",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "2556444",
"url": "https://glygen.org/publication/PubMed/2556444"
}
]
},
{
"title": "Defective PITRM1 mitochondrial peptidase is associated with Abeta amyloidotic neurodegeneration.",
"journal": "EMBO molecular medicine",
"date": "2016",
"authors": "Brunetti D, Torsvik J, Dallabona C, Teixeira P, Sztromwasser P, Fernandez-Vizarra E, Cerutti R, Reyes A, Preziuso C, D'Amati G, Baruffini E, Goffrini P, Viscomi C, Ferrero I, Boman H, Telstad W, Johansson S, Glaser E, Knappskog PM, Zeviani M, Bindoff LA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1268020",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1268020"
}
],
"reference": [
{
"type": "PubMed",
"id": "26697887",
"url": "https://glygen.org/publication/PubMed/26697887"
}
]
},
{
"title": "Structure of the human ornithine transcarbamylase gene.",
"journal": "J. Biochem.",
"date": "1988",
"authors": "Hata A, Tsuzuki T, Shimada K, Takiguchi M, Mori M, Matsuda I",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "2836378",
"url": "https://glygen.org/publication/PubMed/2836378"
}
]
},
{
"title": "Characterization of point mutations in the same arginine codon in three unrelated patients with ornithine transcarbamylase deficiency.",
"journal": "The Journal of clinical investigation",
"date": "1988",
"authors": "Maddalena A, Spence JE, O'Brien WE, Nussbaum RL",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "3170748",
"url": "https://glygen.org/publication/PubMed/3170748"
}
]
},
{
"title": "A promoter variant in the OTC gene associated with late and variable age of onset hyperammonemia.",
"journal": "Journal of inherited metabolic disease",
"date": "2022",
"authors": "Han ST, Anderson KJ, Bjornsson HT, Longo N, Valle D",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000522",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000522"
}
],
"reference": [
{
"type": "PubMed",
"id": "35605046",
"url": "https://glygen.org/publication/PubMed/35605046"
}
]
},
{
"title": "[Analysis of OTC gene variants in four children with delayed onset Ornithine transcarbamylase deficiency].",
"journal": "Zhonghua yi xue yi chuan xue za zhi = Zhonghua yixue yichuanxue zazhi = Chinese journal of medical genetics",
"date": "2023-03-10",
"authors": "Xie Lei, Wang Yao, Ma Wei, Fan Xiaolei, Pang Lulu, Wei Erhu, Wang Huaili",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000522",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000522"
}
],
"reference": [
{
"type": "PubMed",
"id": "36854409",
"url": "https://glygen.org/publication/PubMed/36854409"
}
]
},
{
"title": "The functional impact of 1,570 individual amino acid substitutions in human OTC.",
"journal": "American journal of human genetics",
"date": "2023-05-04",
"authors": "Lo Russell S, Cromie Gareth A, Tang Michelle, Teng Kevin, Owens Katherine, Sirr Amy, Kutz J Nathan, Morizono Hiroki, Caldovic Ljubica, Ah Mew Nicholas, Gropman Andrea, Dudley Aim\u00e9e M",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000522",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000522"
}
],
"reference": [
{
"type": "PubMed",
"id": "37146589",
"url": "https://glygen.org/publication/PubMed/37146589"
}
]
},
{
"title": "Isolation and characterization of the human ornithine transcarbamylase gene: structure of the 5'-end region.",
"journal": "J. Biochem.",
"date": "1986",
"authors": "Hata A, Tsuzuki T, Shimada K, Takiguchi M, Mori M, Matsuda I",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "3782067",
"url": "https://glygen.org/publication/PubMed/3782067"
}
]
},
{
"title": "Adult presentation of ornithine transcarbamylase deficiency: a possible cause of hyperammonemia after high-dose chemotherapy and stem cell transplantation.",
"journal": "Hematology (Amsterdam, Netherlands)",
"date": "2023-12",
"authors": "Tsykunova Galina, Kristensen Erle, Stray-Pedersen Asbj\u00f8rg, Bruserud \u00d8yvind, S\u00f8rensen Ida Wiig, Bruserud \u00d8ystein, Tvedt Tor Henrik Anderson",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000522",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000522"
}
],
"reference": [
{
"type": "PubMed",
"id": "38078487",
"url": "https://glygen.org/publication/PubMed/38078487"
}
]
},
{
"title": "Arginine in the leader peptide is required for both import and proteolytic cleavage of a mitochondrial precursor.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1985",
"authors": "Horwich AL, Kalousek F, Rosenberg LE",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "3895227",
"url": "https://glygen.org/publication/PubMed/3895227"
}
]
},
{
"title": "Isolation and characterization of argininosuccinate synthetase from human liver.",
"journal": "Biochemistry",
"date": "1979",
"authors": "O'Brien WE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-70635",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70635"
}
],
"reference": [
{
"type": "PubMed",
"id": "518841",
"url": "https://glygen.org/publication/PubMed/518841"
}
]
},
{
"title": "Human carbamylphosphate synthetase I. Stabilization, purification, and partial characterization of the enzyme from human liver.",
"journal": "The Journal of biological chemistry",
"date": "1980",
"authors": "Pierson DL, Brien JM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-70635",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70635"
}
],
"reference": [
{
"type": "PubMed",
"id": "6249820",
"url": "https://glygen.org/publication/PubMed/6249820"
}
]
},
{
"title": "Structure and expression of a complementary DNA for the nuclear coded precursor of human mitochondrial ornithine transcarbamylase.",
"journal": "Science (New York, N.Y.)",
"date": "1984",
"authors": "Horwich AL, Fenton WA, Williams KR, Kalousek F, Kraus JP, Doolittle RF, Konigsberg W, Rosenberg LE",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
},
{
"database": "Reactome",
"id": "R-HSA-70635",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70635"
}
],
"reference": [
{
"type": "PubMed",
"id": "6372096",
"url": "https://glygen.org/publication/PubMed/6372096"
}
]
},
{
"title": "A novel point mutation at codon 269 of the ornithine transcarbamylase (OTC) gene causing neonatal onset of OTC deficiency.",
"journal": "Journal of inherited metabolic disease",
"date": "1995",
"authors": "Zimmer KP, Matsuura T, Colombo JP, Koch HG, Ullrich K, Deufel T, Harms E, Matsuda I",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "7474905",
"url": "https://glygen.org/publication/PubMed/7474905"
}
]
},
{
"title": "Mutations and polymorphisms in the human ornithine transcarbamylase gene: mutation update addendum.",
"journal": "Hum. Mutat.",
"date": "1995",
"authors": "Tuchman M, Plante R J",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "7627182",
"url": "https://glygen.org/publication/PubMed/7627182"
}
]
},
{
"title": "Molecular basis of phenotypic variation in patients with argininemia.",
"journal": "Human genetics",
"date": "1995",
"authors": "Uchino T, Snyderman SE, Lambert M, Qureshi IA, Shapira SK, Sansaricq C, Smit LM, Jakobs C, Matsuda I",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-70635",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70635"
}
],
"reference": [
{
"type": "PubMed",
"id": "7649538",
"url": "https://glygen.org/publication/PubMed/7649538"
}
]
},
{
"title": "Seven new mutations in the human ornithine transcarbamylase gene.",
"journal": "Human mutation",
"date": "1994",
"authors": "Tuchman M, Plante RJ, McCann MT, Qureshi AA",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "7951259",
"url": "https://glygen.org/publication/PubMed/7951259"
}
]
},
{
"title": "The ornithine transcarbamylase gene: new `private` mutations in four patients and study of a polymorphism.",
"journal": "Human mutation",
"date": "1994",
"authors": "Tuchman M, Plante RJ, Giguere Y, Lemieux B",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "8019569",
"url": "https://glygen.org/publication/PubMed/8019569"
}
]
},
{
"title": "A novel arginine (245) to glutamine change in exon 8 of the ornithine carbamoyl transferase gene in two unrelated children presenting with late onset deficiency and showing the same enzymatic pattern.",
"journal": "Human molecular genetics",
"date": "1994",
"authors": "Gilbert-Dussardier B, Rabier D, Strautnieks S, Segues B, Bonnefont JP, Munnich A",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "8081373",
"url": "https://glygen.org/publication/PubMed/8081373"
}
]
},
{
"title": "Four newly identified ornithine transcarbamylase (OTC) mutations (D126G, R129H, I172M and W332X) in Japanese male patients with early-onset OTC deficiency.",
"journal": "Human mutation",
"date": "1994",
"authors": "Matsuura T, Hoshide R, Kiwaki K, Komaki S, Koike E, Endo F, Oyanagi K, Suzuki Y, Kato I, Ishikawa K, et al.",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "8081398",
"url": "https://glygen.org/publication/PubMed/8081398"
}
]
},
{
"title": "Single-strand conformational polymorphism and direct sequencing applied to carrier testing in families with ornithine transcarbamylase deficiency.",
"journal": "Human genetics",
"date": "1993",
"authors": "Tsai MY, Holzknecht RA, Tuchman M",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "8099056",
"url": "https://glygen.org/publication/PubMed/8099056"
}
]
},
{
"title": "Expression of four mutant human ornithine transcarbamylase genes in cultured Cos 1 cells relates to clinical phenotypes.",
"journal": "Human genetics",
"date": "1994",
"authors": "Matsuura T, Hoshide R, Setoyama C, Komaki S, Kiwaki K, Endo F, Nishikawa S, Matsuda I",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "8112735",
"url": "https://glygen.org/publication/PubMed/8112735"
}
]
},
{
"title": "Mutations and polymorphisms in the human ornithine transcarbamylase gene.",
"journal": "Hum. Mutat.",
"date": "1993",
"authors": "Tuchman M",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "8364586",
"url": "https://glygen.org/publication/PubMed/8364586"
}
]
},
{
"title": "A splicing mutation, a nonsense mutation (Y167X) and two missense mutations (I159T and A209V) in Spanish patients with ornithine transcarbamylase deficiency.",
"journal": "Human genetics",
"date": "1995",
"authors": "Garcia-Perez MA, Paz Briones PS, Garcia-Munnoz MJ, Rubio V",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "8530002",
"url": "https://glygen.org/publication/PubMed/8530002"
}
]
},
{
"title": "The molecular basis of ornithine transcarbamylase deficiency: modelling the human enzyme and the effects of mutations.",
"journal": "J. Med. Genet.",
"date": "1995",
"authors": "Tuchman M, Morizono H, Reish O, Yuan X, Allewell N M",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "8544185",
"url": "https://glygen.org/publication/PubMed/8544185"
}
]
},
{
"title": "Partial duplication [dup. TCAC (178)] and novel point mutations (T125M, G188R, A209V, and H302L) of the ornithine transcarbamylase gene in congenital hyperammonemia.",
"journal": "Human mutation",
"date": "1996",
"authors": "Gilbert-Dussardier B, Segues B, Rozet JM, Rabier D, Calvas P, de Lumley L, Bonnefond JP, Munnich A",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "8807340",
"url": "https://glygen.org/publication/PubMed/8807340"
}
]
},
{
"title": "Identification of new mutations in the ornithine transcarbamylase (OTC) gene in Korean families.",
"journal": "Journal of inherited metabolic disease",
"date": "1996",
"authors": "Yoo HW, Kim GH, Lee DH",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "8830175",
"url": "https://glygen.org/publication/PubMed/8830175"
}
]
},
{
"title": "Molecular cloning of cDNA for nonhepatic mitochondrial arginase (arginase II) and comparison of its induction with nitric oxide synthase in a murine macrophage-like cell line.",
"journal": "FEBS letters",
"date": "1996",
"authors": "Gotoh T, Sonoki T, Nagasaki A, Terada K, Takiguchi M, Mori M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-70635",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70635"
}
],
"reference": [
{
"type": "PubMed",
"id": "8898077",
"url": "https://glygen.org/publication/PubMed/8898077"
}
]
},
{
"title": "Ornithine transcarbamylase deficiency: characterization of gene mutations and polymorphisms.",
"journal": "Human mutation",
"date": "1996",
"authors": "Oppliger Leibundgut EO, Wermuth B, Colombo JP, Liechti-Gallati S",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "8956038",
"url": "https://glygen.org/publication/PubMed/8956038"
}
]
},
{
"title": "A 3-base pair in-frame deletion in exon 8 (delGlu272/273) of the ornithine transcarbamylase gene in late-onset hyperammonemic coma.",
"journal": "Human mutation",
"date": "1996",
"authors": "Segues B, Veber PS, Rabier D, Calvas P, Saudubray JM, Gilbert-Dussardier B, Bonnefont JP, Munnich A",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "8956045",
"url": "https://glygen.org/publication/PubMed/8956045"
}
]
},
{
"title": "Expression, purification and kinetic characterization of wild-type human ornithine transcarbamylase and a recurrent mutant that produces 'late onset' hyperammonaemia.",
"journal": "The Biochemical journal",
"date": "1997",
"authors": "Morizono H, Tuchman M, Rajagopal BS, McCann MT, Listrom CD, Yuan X, Venugopal D, Barany G, Allewell NM",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "9065786",
"url": "https://glygen.org/publication/PubMed/9065786"
}
]
},
{
"title": "Ornithine transcarbamylase deficiency: ten new mutations and high proportion of de novo mutations in heterozygous females.",
"journal": "Human mutation",
"date": "1997",
"authors": "Oppliger Leibundgut E, Liechti-Gallati S, Colombo JP, Wermuth B",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "9143919",
"url": "https://glygen.org/publication/PubMed/9143919"
}
]
},
{
"title": "Human argininosuccinate lyase: a structural basis for intragenic complementation.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1997",
"authors": "Turner MA, Simpson A, McInnes RR, Howell PL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-70635",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70635"
}
],
"reference": [
{
"type": "PubMed",
"id": "9256435",
"url": "https://glygen.org/publication/PubMed/9256435"
}
]
},
{
"title": "Identification of 'private' mutations in patients with ornithine transcarbamylase deficiency.",
"journal": "J. Inherit. Metab. Dis.",
"date": "1997",
"authors": "Tuchman M, Morizono H, Rajagopal B S, Plante R J, Allewell N M",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "9266388",
"url": "https://glygen.org/publication/PubMed/9266388"
}
]
},
{
"title": "The ornithine transcarbamylase (OTC) gene: mutations in 50 Japanese families with OTC deficiency.",
"journal": "Am. J. Med. Genet.",
"date": "1997",
"authors": "Matsuda I, Tanase S",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "9286441",
"url": "https://glygen.org/publication/PubMed/9286441"
}
]
},
{
"title": "Ten novel mutations of the ornithine transcarbamylase (OTC) gene in OTC deficiency.",
"journal": "Human mutation",
"date": "1998",
"authors": "Shimadzu M, Matsumoto H, Matsuura T, Kobayashi K, Komaki S, Kiwaki K, Hoshide R, Endo F, Saheki T, Matsuda I",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "9452024",
"url": "https://glygen.org/publication/PubMed/9452024"
}
]
},
{
"title": "Novel intragenic deletions and point mutations of the ornithine transcarbamylase gene in congenital hyperammonemia.",
"journal": "Human mutation",
"date": "1998",
"authors": "Calvas P, Segues B, Rozet JM, Rabier D, Bonnefond JP, Munnich A",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "9452049",
"url": "https://glygen.org/publication/PubMed/9452049"
}
]
},
{
"title": "Y55D mutation in ornithine transcarbamylase associated with late-onset hyperammonemia in a male.",
"journal": "Human mutation",
"date": "1998",
"authors": "Nishiyori A, Yoshino M, Tananari Y, Matsuura T, Hoshide R, Mastuda I, Mori M, Kato H",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "9452065",
"url": "https://glygen.org/publication/PubMed/9452065"
}
]
},
{
"title": "The human arginases and arginase deficiency.",
"journal": "Journal of inherited metabolic disease",
"date": "1998",
"authors": "Iyer R, Jenkinson CP, Vockley JG, Kern RM, Grody WW, Cederbaum S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-70635",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70635"
}
],
"reference": [
{
"type": "PubMed",
"id": "9686347",
"url": "https://glygen.org/publication/PubMed/9686347"
}
]
},
{
"title": "1.85-A resolution crystal structure of human ornithine transcarbamoylase complexed with N-phosphonacetyl-L-ornithine. Catalytic mechanism and correlation with inherited deficiency.",
"journal": "J. Biol. Chem.",
"date": "1998",
"authors": "Shi D, Morizono H, Ha Y, Aoyagi M, Tuchman M, Allewell N M",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"reference": [
{
"type": "PubMed",
"id": "9852088",
"url": "https://glygen.org/publication/PubMed/9852088"
}
]
}
],
"pathway": [
{
"id": "hsa:5009",
"name": "",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5009",
"resource": "KEGG Pathway"
},
{
"id": "R-HSA-1268020",
"name": "Mitochondrial protein import",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1268020",
"resource": "Reactome",
"description": "Mitochondrial protein import"
},
{
"id": "R-HSA-70635",
"name": "Urea cycle",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70635",
"resource": "Reactome",
"description": "Urea cycle"
}
],
"orthologs": [
{
"uniprot_canonical_ac": "P00481-1",
"protein_name": "Ornithine transcarbamylase, mitochondrial",
"gene_name": "Otc",
"tax_id": 10116,
"organism": "Rattus norvegicus",
"sequence": {
"sequence": "MLSNLRILLNKAALRKAHTSMVRNFRYGKPVQSQVQLKGRDLLTLKNFTGEEIQYMLWLSADLKFRIKQKGEYLPLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPSFLTTQDIHLGVNESLTDTARVLSSMTDAVLARVYKQSDLDILAKEATIPIVNGLSDLYHPIQILADYLTLQEHYGSLKGLTLSWIGDGNNILHSIMMSAAKFGMHLQAATPKGYEPDPNIVKLAEQYAKENGTRLSMTNDPLEAARGGNVLITDTWISMGQEDEKKKRLQAFQGYQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSPRSLVFPEAENRKWTIMAVMVSLLTDYSPVLQKPKF",
"length": 354
},
"evidence": [
{
"id": "45927071",
"url": "http://www.informatics.jax.org/homology/45927071",
"database": "MGI"
},
{
"id": "P00480",
"url": "https://omabrowser.org/oma/group/P00480/",
"database": "OMA"
}
],
"common_name": "Rat"
},
{
"uniprot_canonical_ac": "P05150-1",
"protein_name": "Ornithine carbamoyltransferase",
"gene_name": "ARG3",
"tax_id": 559292,
"organism": "Saccharomyces cerevisiae S288C",
"sequence": {
"sequence": "MSTTASTPSSLRHLISIKDLSDEEFRILVQRAQHFKNVFKANKTNDFQSNHLKLLGRTIALIFTKRSTRTRISTEGAATFFGAQPMFLGKEDIQLGVNESFYDTTKVVSSMVSCIFARVNKHEDILAFCKDSSVPIINSLCDKFHPLQAICDLLTIIENFNISLDEVNKGINSKLKMAWIGDANNVINDMCIACLKFGISVSISTPPGIEMDSDIVDEAKKVAERNGATFELTHDSLKASTNANILVTDTFVSMGEEFAKQAKLKQFKGFQINQELVSVADPNYKFMHCLPRHQEEVSDDVFYGEHSIVFEEAENRLYAAMSAIDIFVNNKGNFKDLK",
"length": 338
},
"evidence": [
{
"id": "P00480",
"url": "https://omabrowser.org/oma/group/P00480/",
"database": "OMA"
}
],
"common_name": "Yeast"
},
{
"uniprot_canonical_ac": "P11725-1",
"protein_name": "Ornithine transcarbamylase, mitochondrial",
"gene_name": "Otc",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MLSNLRILLNNAALRKGHTSVVRHFWCGKPVQSQVQLKGRDLLTLKNFTGEEIQYMLWLSADLKFRIKQKGEYLPLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPSFLTTQDIHLGVNESLTDTARVLSSMTDAVLARVYKQSDLDTLAKEASIPIVNGLSDLYHPIQILADYLTLQEHYGSLKGLTLSWIGDGNNILHSIMMSAAKFGMHLQAATPKGYEPDPNIVKLAEQYAKENGTKLSMTNDPLEAARGGNVLITDTWISMGQEDEKKKRLQAFQGYQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSPRSLVFPEAENRKWTIMAVMVSLLTDYSPVLQKPKF",
"length": 354
},
"evidence": [
{
"id": "45927071",
"url": "http://www.informatics.jax.org/homology/45927071",
"database": "MGI"
},
{
"id": "P00480",
"url": "https://omabrowser.org/oma/group/P00480/",
"database": "OMA"
}
],
"common_name": "Mouse"
}
],
"go_annotation": {
"categories": [
{
"name": "Biological Process",
"total": 13,
"go_terms": [
{
"name": "citrulline biosynthetic process",
"id": "GO:0019240",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019240",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"pmid": ""
},
{
"name": "monoatomic anion homeostasis",
"id": "GO:0055081",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055081",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"pmid": ""
},
{
"name": "ornithine catabolic process",
"id": "GO:0006593",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006593",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"pmid": ""
},
{
"name": "ammonium homeostasis",
"id": "GO:0097272",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097272",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"pmid": ""
},
{
"name": "liver development",
"id": "GO:0001889",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001889",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"pmid": ""
},
{
"name": "response to zinc ion",
"id": "GO:0010043",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010043",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"pmid": ""
},
{
"name": "midgut development",
"id": "GO:0007494",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007494",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"pmid": ""
},
{
"name": "response to insulin",
"id": "GO:0032868",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032868",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"pmid": ""
},
{
"name": "response to xenobiotic stimulus",
"id": "GO:0009410",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009410",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"pmid": ""
},
{
"name": "urea cycle",
"id": "GO:0000050",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000050",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"pmid": ""
},
{
"name": "arginine biosynthetic process via ornithine",
"id": "GO:0042450",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042450",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"pmid": ""
},
{
"name": "response to biotin",
"id": "GO:0070781",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070781",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"pmid": ""
},
{
"name": "amino acid metabolic process",
"id": "GO:0006520",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006520",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"pmid": ""
}
]
},
{
"name": "Molecular Function",
"total": 6,
"go_terms": [
{
"name": "phosphate ion binding",
"id": "GO:0042301",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042301",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"pmid": ""
},
{
"name": "ornithine carbamoyltransferase activity",
"id": "GO:0004585",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004585",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"pmid": ""
},
{
"name": "phospholipid binding",
"id": "GO:0005543",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005543",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"pmid": ""
},
{
"name": "identical protein binding",
"id": "GO:0042802",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"pmid": ""
},
{
"name": "amino acid binding",
"id": "GO:0016597",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016597",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"pmid": ""
},
{
"name": "carboxyl- or carbamoyltransferase activity",
"id": "GO:0016743",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016743",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"pmid": ""
}
]
},
{
"name": "Cellular Component",
"total": 3,
"go_terms": [
{
"name": "mitochondrion",
"id": "GO:0005739",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"pmid": ""
},
{
"name": "mitochondrial inner membrane",
"id": "GO:0005743",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005743",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"pmid": ""
},
{
"name": "mitochondrial matrix",
"id": "GO:0005759",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005759",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
}
],
"pmid": ""
}
]
}
]
},
"pro_annotation": [],
"site_annotation": [
{
"start_pos": 121,
"end_pos": 123,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 240,
"end_pos": 242,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 47,
"end_pos": 49,
"annotation": "n_glycosylation_sequon"
}
],
"ptm_annotation": [
{
"annotation": "Acetylation at Lys-88 negatively regulates ornithine carbamoyltransferase activity in response to nutrient signals.",
"evidence": [
{
"database": "UniProtKB",
"id": "P00480",
"url": "https://www.uniprot.org/uniprot/P00480"
},
{
"database": "PubMed",
"id": "19318352",
"url": "https://glygen.org/publication/PubMed/19318352"
}
]
}
],
"interactions": [],
"reactions": [
{
"id": "19513",
"name": "",
"equation": "carbamoyl phosphate + L-ornithine = H(+) + L-citrulline + phosphate",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00481-1",
"P00480-1",
"P11725-1",
"P05150-1"
],
"evidence": [
{
"id": "19513",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/19513"
}
]
},
{
"id": "R-HSA-1299475",
"name": "TIMM23 PAM translocates proteins from the mitochondrial intermembrane space to the mitochondrial matrix",
"equation": "",
"summary": "As inferred from the yeast TIM23 complex, the human TIMM23 complex transports precursor proteins across the inner membrane and into the matrix. As in yeast, subunits TIMM50, TIMM17, and TIMM23 are probably necessary for initiating translocation while the PAM complex with mtHSP70 (HSPA9, yeast SSC1) provides the motive force that drives the transport. mtHSP70 binding to the precursor pulls the protein into the matrix in a reaction requiring ATP hydrolysis. The yeast reaction appears to use a Brownian ratchet mechanism (Yamano et al. 2008).
In yeast experimentally verified substrates of TIM23 PAM include Hsp60 (HSP60 in human) and Yfh1 (Frataxin, FXN in human). Many other matrix proteins are believed to be substrates of the TIMM23 complex",
"cellular_location": "mitochondrial inner membrane, mitochondrial matrix",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00480-1",
"Q16595-1",
"P10809-1"
],
"evidence": [
{
"id": "R-HSA-1299475",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1299475"
}
]
},
{
"id": "R-HSA-1299478",
"name": "MPP cleaves targeting peptide (presequence) of matrix precursors",
"equation": "",
"summary": "As inferred from yeast, the alpha subunit of the mitochondrial processing peptidase (MPP) binds presequences of mitochondrial precursors and the beta subunit cleaves the presequence. After cleavage, proteins destined for the matrix are drawn into the matrix by ATP-dependent interaction with mtHSP70 (HSPA9, homolog of yeast SSC1) of the PAM complex.",
"cellular_location": "mitochondrial inner membrane, mitochondrial matrix",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00480-1",
"Q16595-1",
"P10809-1",
"O75439-1"
],
"evidence": [
{
"id": "R-HSA-1299478",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1299478"
}
]
},
{
"id": "R-HSA-1299480",
"name": "Precursor proteins enter TIMM23 PAM",
"equation": "",
"summary": "As inferred from the yeast TIM23 complex, the human TIMM23 complex resides in the inner membrane of the mitochondrion and transfers precursor proteins to the matrix. The TIMM23 complex appears to adopt different configurations (and perhaps different subunit compositions) depending on whether the substrate is destined for the inner membrane or the matrix. Here we refer to the TIMM23 PAM complex as the configuration that delivers inner membrane proteins. The PAM17 subcomplex is required for this activity. The N-terminal presequence of precursors first interacts with TIMM50 and TIMM23 (Zhang et al. 2013). The TIMM17 and TIMM23 subunits form a channel and are required to initiate translocation of precursors.
In yeast experimentally verified substrates of TIM23:PAM include Hsp60 (HSP60 in human) and Yfh1 (Frataxin, FXN in human). Many other matrix proteins are believed to be substrates of the TIMM23 complex.",
"cellular_location": "mitochondrial inner membrane, mitochondrial intermembrane space",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00480-1",
"Q16595-1",
"P10809-1"
],
"evidence": [
{
"id": "R-HSA-1299480",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1299480"
}
]
},
{
"id": "R-HSA-70560",
"name": "carbamoyl phosphate + ornithine => citrulline + orthophosphate",
"equation": "",
"summary": "Mitochondrial ornithine transcarbamoylase (OTC) catalyzes the reaction of ornithine and carbamoyl phosphate to form citrulline (Horwich et al. 1984). The enzyme is a homotrimer (Shi et al. 2001).",
"cellular_location": "mitochondrial matrix",
"input_participant_list": [
"R-ALL-29676"
],
"output_participant_list": [],
"enzyme_list": [
"P00480-1"
],
"evidence": [
{
"id": "R-HSA-70560",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70560"
}
]
},
{
"id": "R-HSA-8986181",
"name": "PITRM1 proteolyzes mitochondrial targeting peptides (presequences)",
"equation": "",
"summary": "After MPP cleaves off targeting peptides (also called presequences) of proteins imported into the mitochondrial matrix, PITRM1 (also called PreP) proteolyzes the cleaved targeting peptides (Pinho et al. 2010, Alikhani et al. 2011, Teixeira et al. 2012). PITRM1 also cleaves amyloid beta peptide that is imported into the matrix (Falkevall et al. 2006). Missense mutations in PITRM1 are associated with a neurological syndrome comprising mental retardation, spinocerebellar ataxia, cognitive decline, psychosis and possible epilepsy (Brunetti et al. 2016).",
"cellular_location": "mitochondrial matrix",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00480-1",
"P06576-1",
"Q96H96-1",
"Q16595-1",
"P10809-1",
"Q86WU2-1",
"Q5JRX3-1"
],
"evidence": [
{
"id": "R-HSA-8986181",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8986181"
}
]
}
],
"reaction_participants": [
{
"participant_id": "R-ALL-29676",
"participant_name": "CAP [mitochondrial matrix]",
"crossref": [
{
"id": "C00169",
"database": "COMPOUND",
"url": ""
},
{
"id": "58228",
"database": "ChEBI",
"url": ""
},
{
"id": "000008383183",
"database": "ZINC",
"url": ""
},
{
"id": "C00169",
"database": "COMPOUND",
"url": ""
},
{
"id": "58228",
"database": "ChEBI",
"url": ""
},
{
"id": "000008383183",
"database": "ZINC",
"url": ""
},
{
"id": "C00169",
"database": "COMPOUND",
"url": ""
},
{
"id": "58228",
"database": "ChEBI",
"url": ""
},
{
"id": "000008383183",
"database": "ZINC",
"url": ""
},
{
"id": "C00169",
"database": "COMPOUND",
"url": ""
},
{
"id": "58228",
"database": "ChEBI",
"url": ""
},
{
"id": "000008383183",
"database": "ZINC",
"url": ""
},
{
"id": "C00169",
"database": "COMPOUND",
"url": ""
},
{
"id": "58228",
"database": "ChEBI",
"url": ""
},
{
"id": "000008383183",
"database": "ZINC",
"url": ""
}
]
}
],
"reaction_enzymes": [
{
"uniprot_ac": "O75439",
"gene_name": "PMPCB",
"activity": [
{
"ec_number": "3.4.24.64",
"activity": "Release of N-terminal transit peptides from precursor proteins imported into the mitochondrion, typically with Arg in position P2.",
"evidence": [
{
"id": "O75439",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O75439"
}
]
},
{
"ec_number": "3.4.24.64",
"activity": "",
"evidence": [
{
"id": "O75439",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O75439"
}
]
}
]
},
{
"uniprot_ac": "P00480",
"gene_name": "OTC",
"activity": [
{
"ec_number": "2.1.3.3",
"activity": "carbamoyl phosphate + L-ornithine = H(+) + L-citrulline + phosphate.",
"evidence": [
{
"id": "P00480",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00480"
}
]
},
{
"ec_number": "2.1.3.3",
"activity": "",
"evidence": [
{
"id": "P00480",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00480"
}
]
}
]
},
{
"uniprot_ac": "P00481",
"gene_name": "Otc",
"activity": [
{
"ec_number": "2.1.3.3",
"activity": "carbamoyl phosphate + L-ornithine = H(+) + L-citrulline + phosphate.",
"evidence": [
{
"id": "P00481",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00481"
}
]
},
{
"ec_number": "2.1.3.3",
"activity": "",
"evidence": [
{
"id": "P00481",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00481"
}
]
}
]
},
{
"uniprot_ac": "P05150",
"gene_name": "ARG3",
"activity": [
{
"ec_number": "2.1.3.3",
"activity": "carbamoyl phosphate + L-ornithine = H(+) + L-citrulline + phosphate.",
"evidence": [
{
"id": "P05150",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P05150"
}
]
},
{
"ec_number": "2.1.3.3",
"activity": "",
"evidence": [
{
"id": "P05150",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P05150"
}
]
}
]
},
{
"uniprot_ac": "P06576",
"gene_name": "ATP5F1B",
"activity": [
{
"ec_number": "7.1.2.2",
"activity": "ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate.",
"evidence": [
{
"id": "P06576",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P06576"
}
]
},
{
"ec_number": "7.1.2.2",
"activity": "",
"evidence": [
{
"id": "P06576",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P06576"
}
]
}
]
},
{
"uniprot_ac": "P10809",
"gene_name": "HSPD1",
"activity": [
{
"ec_number": "5.6.1.7",
"activity": "ATP + H2O + a folded polypeptide = ADP + phosphate + an unfolded polypeptide.",
"evidence": [
{
"id": "P10809",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10809"
}
]
},
{
"ec_number": "5.6.1.7",
"activity": "",
"evidence": [
{
"id": "P10809",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10809"
}
]
}
]
},
{
"uniprot_ac": "P11725",
"gene_name": "Otc",
"activity": [
{
"ec_number": "2.1.3.3",
"activity": "carbamoyl phosphate + L-ornithine = H(+) + L-citrulline + phosphate.",
"evidence": [
{
"id": "P11725",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11725"
}
]
},
{
"ec_number": "2.1.3.3",
"activity": "",
"evidence": [
{
"id": "P11725",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11725"
}
]
}
]
},
{
"uniprot_ac": "Q16595",
"gene_name": "FXN",
"activity": [
{
"ec_number": "1.16.3.1",
"activity": "4 Fe(2+) + 4 H(+) + O2 = 4 Fe(3+) + 2 H2O.",
"evidence": [
{
"id": "Q16595",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16595"
}
]
},
{
"ec_number": "1.16.3.1",
"activity": "",
"evidence": [
{
"id": "Q16595",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16595"
}
]
}
]
},
{
"uniprot_ac": "Q5JRX3",
"gene_name": "PITRM1",
"activity": [
{
"ec_number": "3.4.24.-",
"activity": "",
"evidence": [
{
"id": "Q5JRX3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5JRX3"
}
]
}
]
},
{
"uniprot_ac": "Q86WU2",
"gene_name": "LDHD",
"activity": [
{
"ec_number": "1.1.2.4",
"activity": "(R)-lactate + 2 Fe(III)-[cytochrome c] = 2 Fe(II)-[cytochrome c] + 2 H(+) + pyruvate.",
"evidence": [
{
"id": "Q86WU2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q86WU2"
}
]
},
{
"ec_number": "1.1.2.4",
"activity": "",
"evidence": [
{
"id": "Q86WU2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q86WU2"
}
]
}
]
},
{
"uniprot_ac": "Q96H96",
"gene_name": "COQ2",
"activity": [
{
"ec_number": "2.5.1.39",
"activity": "4-hydroxybenzoate + all-trans-nonaprenyl diphosphate = 4-hydroxy-3-all-trans-nonaprenylbenzoate + diphosphate.",
"evidence": [
{
"id": "Q96H96",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96H96"
}
]
},
{
"ec_number": "2.5.1.39",
"activity": "",
"evidence": [
{
"id": "Q96H96",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96H96"
}
]
}
]
}
],
"biomarkers": [],
"synthesized_glycans": [],
"cluster_types": [
{
"name": "isoformset.uniprotkb",
"label": "Isoforms"
},
{
"name": "homologset.mgi",
"label": "MGI Homologs"
},
{
"name": "homologset.oma",
"label": "OMA Homologs"
}
],
"sequence_features": {
"n_linked_sites": [],
"o_linked_sites": [],
"snv_sites": [],
"glycation_sites": [],
"phosphorylation_sites": [
133
],
"sequon_annotation_sites": [
{
"start_pos": 121,
"end_pos": 123
},
{
"start_pos": 240,
"end_pos": 242
},
{
"start_pos": 47,
"end_pos": 49
}
]
},
"section_stats": [
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 1
},
{
"field": "total_sites",
"count": 1
}
],
"sort_fields": [
"start_pos",
"end_pos",
"kinase_uniprot_canonical_ac",
"kinase_gene_name",
"residue",
"comment",
"site_lbl"
]
},
{
"table_id": "snv",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv_disease",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv_non_disease",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "publication",
"table_stats": [
{
"field": "total",
"count": 85
}
],
"sort_fields": [
"title",
"journal",
"date",
"authors"
]
}
]
}