{
"uniprot_canonical_ac": "P00414-1",
"uniprot_ac": "P00414",
"uniprot_id": "COX3_HUMAN",
"mass": {
"chemical_mass": 29951.0,
"monoisotopic_mass": 29951.0
},
"refseq": {
"ac": "YP_003024032",
"name": "cytochrome c oxidase subunit III",
"summary": "",
"url": "https://www.ncbi.nlm.nih.gov/protein/YP_003024032"
},
"gene_names": [
{
"name": "MT-CO3",
"resource": "UniProtKB",
"type": "recommended",
"url": "https://www.uniprot.org/uniprot/P00414",
"id": "P00414"
},
{
"name": "COIII; MTCO3",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/YP_003024032",
"id": "YP_003024032"
},
{
"name": "COIII",
"resource": "UniProtKB",
"type": "synonym",
"url": "https://www.uniprot.org/uniprot/P00414",
"id": "P00414"
},
{
"name": "COX3",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/YP_003024032",
"id": "YP_003024032"
},
{
"name": "COXIII",
"resource": "UniProtKB",
"type": "synonym",
"url": "https://www.uniprot.org/uniprot/P00414",
"id": "P00414"
},
{
"name": "MTCO3",
"resource": "UniProtKB",
"type": "synonym",
"url": "https://www.uniprot.org/uniprot/P00414",
"id": "P00414"
}
],
"protein_names": [
{
"name": "Cytochrome c oxidase subunit 3",
"resource": "UniProtKB",
"type": "recommended",
"url": "",
"id": "P00414"
},
{
"name": "7.1.1.9",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P00414"
},
{
"name": "Cytochrome c oxidase polypeptide III",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P00414"
},
{
"name": "cytochrome c oxidase subunit III",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/YP_003024032",
"id": "YP_003024032"
}
],
"function": [
{
"annotation": "Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.",
"evidence": [
{
"database": "UniProtKB",
"id": "P00414",
"url": "https://www.uniprot.org/uniprot/P00414#function"
},
{
"database": "UniProtKB",
"id": "P00420",
"url": "https://www.uniprot.org/uniprot/P00420#function"
}
]
}
],
"disease": [
{
"disease_id": "DOID:0070491",
"recommended_name": {
"id": "DOID:0070491",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0070491",
"name": "mitochondrial complex IV deficiency nuclear type 1",
"description": "A COX deficiency, benign infantile mitochondrial myopathy that has_material_basis_in homozygous or compound heterozygous mutation in the SURF1 gene on chromosome 9q34.2."
},
"synonyms": [
{
"id": "DOID:0070491",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0070491",
"name": "MC4DN1",
"description": ""
},
{
"id": "MONDO:0009068",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009068",
"name": "cytochrome-c oxidase deficiency disease",
"description": "A very rare inherited metabolic disorder characterized by deficiency of the enzyme cytochrome-C oxidase. It may be manifested as an isolated myopathy or a systemic disorder. Signs and symptoms include myotonia, dysfunction of the heart, kidney, and brain, and lactic acidosis."
},
{
"id": "MONDO:0009068",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009068",
"name": "cytochrome-C oxidase deficiency",
"description": ""
},
{
"id": "MONDO:0009068",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009068",
"name": "cytochrome-c oxidase deficiency disease",
"description": ""
},
{
"id": "MONDO:0009068",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009068",
"name": "isolated COX deficiency",
"description": ""
},
{
"id": "MONDO:0009068",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009068",
"name": "isolated mitochondrial respiratory chain complex IV deficiency",
"description": ""
},
{
"id": "MONDO:0009068",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009068",
"name": "mitochondrial complex IV deficiency",
"description": ""
},
{
"id": "MONDO:0009068",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009068",
"name": "mitochondrial complex IV deficiency, nuclear type 1",
"description": ""
},
{
"id": "MONDO:0009068",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009068",
"name": "COX deficiency",
"description": ""
},
{
"id": "MONDO:0009068",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009068",
"name": "Complex 4 mitochondrial respiratory chain deficiency",
"description": ""
},
{
"id": "MONDO:0009068",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009068",
"name": "Complex IV deficiency",
"description": ""
},
{
"id": "MONDO:0009068",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009068",
"name": "Cox deficiency",
"description": ""
},
{
"id": "MONDO:0009068",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009068",
"name": "cytochrome C oxidase deficiency",
"description": ""
},
{
"id": "MONDO:0009068",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009068",
"name": "deficiency of mitochondrial respiratory chain complex4",
"description": ""
},
{
"id": "MONDO:0009068",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009068",
"name": "isolated cytochrome C oxidase deficiency",
"description": ""
},
{
"id": "MONDO:0009068",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009068",
"name": "mitochondrial Complex 4 deficiency",
"description": ""
},
{
"id": "MIM:220110",
"resource": "MIM",
"url": "https://www.omim.org/entry/220110",
"name": "Mitochondrial complex IV deficiency",
"description": "Mitochondrial complex IV deficiency"
}
],
"evidence": [
{
"id": "220110",
"database": "MIM",
"url": "https://www.omim.org/entry/220110"
}
]
},
{
"disease_id": "DOID:0080108",
"recommended_name": {
"id": "DOID:0080108",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0080108",
"name": "myoglobinuria",
"description": "A myopathy that is characterized by an increased urinary excretion of myoglobin."
},
"synonyms": [
{
"id": "MONDO:0009992",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009992",
"name": "myoglobinuria, acute recurrent, autosomal recessive",
"description": ""
},
{
"id": "MONDO:0009992",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009992",
"name": "myoglobinuria, acute recurrent, autosomal recessive",
"description": ""
},
{
"id": "MONDO:0009992",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009992",
"name": "myoglobinuria, familial paroxysmal paralytic",
"description": ""
},
{
"id": "MONDO:0009992",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009992",
"name": "rhabdomyolysis, acute recurrent",
"description": ""
},
{
"id": "MONDO:0008046",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008046",
"name": "autosomal dominant myoglobinuria",
"description": "Autosomal dominant myoglobinuria is a rare metabolic myopathy characterized by episodic myalgia with myoglobinuria which is induced by fever, viral or bacterial infection, prolonged exercise or alcohol abuse, and could, on occasion, lead to acute renal failure. Between episodes, patients may be asymptomatic or could present elevated creatine kinase levels and mild muscle weakness. There have been no further descriptions in the literature since 1997."
},
{
"id": "MONDO:0008046",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008046",
"name": "myoglobinuria, autosomal dominant",
"description": ""
},
{
"id": "MONDO:0010791",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010791",
"name": "myoglobinuria, recurrent",
"description": "An inborn error of metabolism characterized by abnormal urinary excretion of myoglobin due to acute destruction of skeletal muscle fibers. The exact prevalence remains unknown. In the majority of cases, the disease manifests in childhood and is often triggered by exertion or infection (febrile illness). Hypertonia, muscle stiffness and muscle pain, impaired kidney function and elevated levels of serum creatine kinase are common clinical features. Mutations in the mitochondrial DNA-encoded cytochrome C oxidase genes (MT-CO1 and MT-CO2) should be considered in patients with recurrent myoglobinuria. Recently, mutations in the LPIN1 gene (chromosome 2p21) have been reported to have a causative role in three patients with recurrent episodes of myoglobinuria, originating from consanguineous families. The disorder may occur sporadically, or be inherited in either a recessive or dominant manner."
},
{
"id": "MONDO:0010791",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010791",
"name": "myoglobinuria, recurrent",
"description": ""
},
{
"id": "MONDO:0010791",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010791",
"name": "myoglobinuria recurrent",
"description": ""
},
{
"id": "MIM:268200",
"resource": "MIM",
"url": "https://www.omim.org/entry/268200",
"name": "Myoglobinuria, acute recurrent, autosomal recessive",
"description": "Myoglobinuria, acute recurrent, autosomal recessive"
},
{
"id": "MIM:550500",
"resource": "MIM",
"url": "https://www.omim.org/entry/550500",
"name": "Recurrent myoglobinuria mitochondrial",
"description": "Recurrent myoglobinuria mitochondrial"
}
],
"evidence": [
{
"id": "550500",
"database": "MIM",
"url": "https://www.omim.org/entry/550500"
}
]
},
{
"disease_id": "DOID:3762",
"recommended_name": {
"id": "DOID:3762",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3762",
"name": "cytochrome-c oxidase deficiency disease",
"description": "A mitochondrial metabolism disease that is characterized by deficiency of cytochrome c oxidase, myopathy, hepatomegaly, hypertrophic cardiomyopathy, lactic acidosis, and Leigh syndrome, and is caused by mutations related to oxidative phosphorylation."
},
"synonyms": [
{
"id": "DOID:3762",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3762",
"name": "MITOCHONDRIAL COMPLEX IV DEFICIENCY",
"description": ""
},
{
"id": "MONDO:0009068",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009068",
"name": "cytochrome-c oxidase deficiency disease",
"description": "A very rare inherited metabolic disorder characterized by deficiency of the enzyme cytochrome-C oxidase. It may be manifested as an isolated myopathy or a systemic disorder. Signs and symptoms include myotonia, dysfunction of the heart, kidney, and brain, and lactic acidosis."
},
{
"id": "MONDO:0009068",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009068",
"name": "cytochrome-C oxidase deficiency",
"description": ""
},
{
"id": "MONDO:0009068",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009068",
"name": "cytochrome-c oxidase deficiency disease",
"description": ""
},
{
"id": "MONDO:0009068",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009068",
"name": "isolated COX deficiency",
"description": ""
},
{
"id": "MONDO:0009068",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009068",
"name": "isolated mitochondrial respiratory chain complex IV deficiency",
"description": ""
},
{
"id": "MONDO:0009068",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009068",
"name": "mitochondrial complex IV deficiency",
"description": ""
},
{
"id": "MONDO:0009068",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009068",
"name": "mitochondrial complex IV deficiency, nuclear type 1",
"description": ""
},
{
"id": "MONDO:0009068",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009068",
"name": "COX deficiency",
"description": ""
},
{
"id": "MONDO:0009068",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009068",
"name": "Complex 4 mitochondrial respiratory chain deficiency",
"description": ""
},
{
"id": "MONDO:0009068",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009068",
"name": "Complex IV deficiency",
"description": ""
},
{
"id": "MONDO:0009068",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009068",
"name": "Cox deficiency",
"description": ""
},
{
"id": "MONDO:0009068",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009068",
"name": "cytochrome C oxidase deficiency",
"description": ""
},
{
"id": "MONDO:0009068",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009068",
"name": "deficiency of mitochondrial respiratory chain complex4",
"description": ""
},
{
"id": "MONDO:0009068",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009068",
"name": "isolated cytochrome C oxidase deficiency",
"description": ""
},
{
"id": "MONDO:0009068",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0009068",
"name": "mitochondrial Complex 4 deficiency",
"description": ""
},
{
"id": "MIM:220110",
"resource": "MIM",
"url": "https://www.omim.org/entry/220110",
"name": "Mitochondrial complex IV deficiency",
"description": "Mitochondrial complex IV deficiency"
}
],
"evidence": [
{
"id": "220110",
"database": "MIM",
"url": "https://www.omim.org/entry/220110"
}
]
},
{
"disease_id": "DOID:705",
"recommended_name": {
"id": "DOID:705",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:705",
"name": "Leber hereditary optic neuropathy",
"description": ""
},
"synonyms": [
{
"id": "DOID:705",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:705",
"name": "Leber's hereditary optic neuropathy",
"description": ""
},
{
"id": "DOID:705",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:705",
"name": "Leber's optic atrophy",
"description": ""
},
{
"id": "MONDO:0010788",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010788",
"name": "Leber hereditary optic neuropathy",
"description": "Leber's hereditary optic neuropathy (LHON) is a mitochondrial neurodegenerative disease affecting the optic nerve and often characterized by sudden vision loss in young adult carriers."
},
{
"id": "MONDO:0010788",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010788",
"name": "LHON",
"description": ""
},
{
"id": "MONDO:0010788",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010788",
"name": "Leber Hereditary optic atrophy",
"description": ""
},
{
"id": "MONDO:0010788",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010788",
"name": "Leber hereditary optic neuropathy",
"description": ""
},
{
"id": "MONDO:0010788",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010788",
"name": "Leber optic atrophy",
"description": ""
},
{
"id": "MONDO:0010788",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010788",
"name": "Leber's hereditary optic neuropathy",
"description": ""
},
{
"id": "MONDO:0010788",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010788",
"name": "Leber's optic atrophy",
"description": ""
},
{
"id": "MONDO:0010788",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010788",
"name": "Lebers disease",
"description": ""
},
{
"id": "MONDO:0010788",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010788",
"name": "optic atrophy, Leber type",
"description": ""
},
{
"id": "MIM:535000",
"resource": "MIM",
"url": "https://www.omim.org/entry/535000",
"name": "Leber hereditary optic neuropathy",
"description": "Leber hereditary optic neuropathy"
}
],
"evidence": [
{
"id": "535000",
"database": "MIM",
"url": "https://www.omim.org/entry/535000"
}
]
}
],
"snv": [],
"mutagenesis": [],
"expression_tissue": [
{
"tissue": {
"name": "Adult mammalian kidney",
"namespace": "UBERON",
"id": "0000082",
"url": "http://purl.obolibrary.org/obo/UBERON_0000082"
},
"score": "100",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000198938",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000198938"
}
]
},
{
"tissue": {
"name": "Stomach",
"namespace": "UBERON",
"id": "0000945",
"url": "http://purl.obolibrary.org/obo/UBERON_0000945"
},
"score": "99.88",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000198938",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000198938"
}
]
},
{
"tissue": {
"name": "Esophagus",
"namespace": "UBERON",
"id": "0001043",
"url": "http://purl.obolibrary.org/obo/UBERON_0001043"
},
"score": "99.99",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000198938",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000198938"
}
]
},
{
"tissue": {
"name": "Rectum",
"namespace": "UBERON",
"id": "0001052",
"url": "http://purl.obolibrary.org/obo/UBERON_0001052"
},
"score": "100",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000198938",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000198938"
}
]
},
{
"tissue": {
"name": "Urinary bladder",
"namespace": "UBERON",
"id": "0001255",
"url": "http://purl.obolibrary.org/obo/UBERON_0001255"
},
"score": "99.99",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000198938",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000198938"
}
]
},
{
"tissue": {
"name": "Thyroid gland",
"namespace": "UBERON",
"id": "0002046",
"url": "http://purl.obolibrary.org/obo/UBERON_0002046"
},
"score": "100",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000198938",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000198938"
}
]
},
{
"tissue": {
"name": "Liver",
"namespace": "UBERON",
"id": "0002107",
"url": "http://purl.obolibrary.org/obo/UBERON_0002107"
},
"score": "99.91",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000198938",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000198938"
}
]
},
{
"tissue": {
"name": "Prostate gland",
"namespace": "UBERON",
"id": "0002367",
"url": "http://purl.obolibrary.org/obo/UBERON_0002367"
},
"score": "99.99",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000198938",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000198938"
}
]
},
{
"tissue": {
"name": "Thoracic mammary gland",
"namespace": "UBERON",
"id": "0005200",
"url": "http://purl.obolibrary.org/obo/UBERON_0005200"
},
"score": "100",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000198938",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000198938"
}
]
}
],
"expression_disease": [
{
"significant": "No",
"trend": "up",
"name": "Prostate cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10283",
"evidence": [
{
"database": "BioXpress",
"id": "P00414",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00414"
}
],
"disease": [
{
"disease_id": "DOID:10283",
"recommended_name": {
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer",
"description": "A male reproductive organ cancer that is located_in the prostate."
},
"synonyms": [
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "NGP - new growth of prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "malignant tumor of the prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "tumor of the prostate",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, type 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "HPC9",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene."
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "EHBP1 familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "familial prostate cancer caused by mutation in EHBP1",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, type 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "HPC12",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, type 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "HPC5",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, type 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, susceptibility to, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "HPC3",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, type 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, susceptibility to, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "HPC4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, on chromosome 7",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene."
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "MSMB familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "familial prostate cancer caused by mutation in MSMB",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, type 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "HPC13",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, type 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "HPC8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "predisposing for prostate cancer",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, type 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "HPC6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "HPC10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate carcinoma",
"description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma."
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate carcinoma",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, somatic",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, hereditary",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "HPC7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer aggressiveness",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene."
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "RNASEL familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "familial prostate cancer caused by mutation in RNASEL",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, type 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "HPC1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "Prca1",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "HPC11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "HPC14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "HPC15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "HPCX1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer susceptibility, X-linked",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "HPCX2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MIM:611868",
"resource": "MIM",
"url": "https://www.omim.org/entry/611868",
"name": "Prostate cancer, hereditary, 12",
"description": "Prostate cancer, hereditary, 12"
},
{
"id": "MIM:611928",
"resource": "MIM",
"url": "https://www.omim.org/entry/611928",
"name": "Prostate cancer, hereditary, 13",
"description": "Prostate cancer, hereditary, 13"
},
{
"id": "MIM:176807",
"resource": "MIM",
"url": "https://www.omim.org/entry/176807",
"name": "Prostate cancer",
"description": "Prostate cancer"
},
{
"id": "MIM:601518",
"resource": "MIM",
"url": "https://www.omim.org/entry/601518",
"name": "Prostate cancer, hereditary, 1",
"description": "Prostate cancer, hereditary, 1"
},
{
"id": "MIM:611955",
"resource": "MIM",
"url": "https://www.omim.org/entry/611955",
"name": "Prostate cancer, hereditary, 11",
"description": "Prostate cancer, hereditary, 11"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Stomach cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10534",
"evidence": [
{
"database": "BioXpress",
"id": "P00414",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00414"
}
],
"disease": [
{
"disease_id": "DOID:10534",
"recommended_name": {
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "stomach cancer",
"description": "A gastrointestinal system cancer that is located_in the stomach."
},
"synonyms": [
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric cancer",
"description": ""
},
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": "A primary or metastatic malignant neoplasm involving the stomach."
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca lesser curvature - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "cancer of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer risk after h. pylori infection",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumor",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumour",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant stomach neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "stomach cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca body - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "ca greater curvature of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, intestinal",
"description": ""
},
{
"id": "MIM:613659",
"resource": "MIM",
"url": "https://www.omim.org/entry/613659",
"name": "Gastric cancer",
"description": "Gastric cancer"
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Urinary bladder cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11054",
"evidence": [
{
"database": "BioXpress",
"id": "P00414",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00414"
}
],
"disease": [
{
"disease_id": "DOID:11054",
"recommended_name": {
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "urinary bladder cancer",
"description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder."
},
"synonyms": [
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "bladder cancer",
"description": ""
},
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": "A primary or metastatic malignant neoplasm involving the bladder."
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "bladder cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "cancer of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumour",
"description": ""
},
{
"id": "MIM:109800",
"resource": "MIM",
"url": "https://www.omim.org/entry/109800",
"name": "Bladder cancer",
"description": "Bladder cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Head and neck cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11934",
"evidence": [
{
"database": "BioXpress",
"id": "P00414",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00414"
}
],
"disease": [
{
"disease_id": "DOID:11934",
"recommended_name": {
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck cancer",
"description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx."
},
"synonyms": [
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck tumours",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head/neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "tumor of head and neck",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Lung cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1324",
"evidence": [
{
"database": "BioXpress",
"id": "P00414",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00414"
}
],
"disease": [
{
"disease_id": "DOID:1324",
"recommended_name": {
"id": "DOID:1324",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1324",
"name": "lung cancer",
"description": "A respiratory system cancer that is located_in the lung."
},
"synonyms": [
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "LNCR1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "LNCR3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "adenocarcinoma of lung, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "LNCR4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "LNCR5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": "A malignant neoplasm involving the lung."
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "cancer of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung neoplasm",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumor",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumour",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "Nonsmall cell lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "alveolar cell carcinoma",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung neoplasm",
"description": ""
},
{
"id": "MIM:211980",
"resource": "MIM",
"url": "https://www.omim.org/entry/211980",
"name": "Lung cancer",
"description": "Lung cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Breast cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1612",
"evidence": [
{
"database": "BioXpress",
"id": "P00414",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00414"
}
],
"disease": [
{
"disease_id": "DOID:1612",
"recommended_name": {
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast cancer",
"description": "A thoracic cancer that originates in the mammary gland."
},
"synonyms": [
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant neoplasm of breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant tumor of the breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary cancer",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "primary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma."
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer susceptibility, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, lobular, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of the breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial Male",
"description": ""
},
{
"id": "MIM:114480",
"resource": "MIM",
"url": "https://www.omim.org/entry/114480",
"name": "Breast cancer",
"description": "Breast cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Thyroid cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1781",
"evidence": [
{
"database": "BioXpress",
"id": "P00414",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00414"
}
],
"disease": [
{
"disease_id": "DOID:1781",
"recommended_name": {
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid cancer",
"description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage."
},
"synonyms": [
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid gland cancer",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "Thyroid gland neoplasm",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant tumour of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Kidney cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:263",
"evidence": [
{
"database": "BioXpress",
"id": "P00414",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00414"
}
],
"disease": [
{
"disease_id": "DOID:263",
"recommended_name": {
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "kidney cancer",
"description": "A urinary system cancer that is located_in the kidney."
},
"synonyms": [
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant neoplasm of kidney except pelvis",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant tumour of kidney",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "renal cancer",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Liver cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:3571",
"evidence": [
{
"database": "BioXpress",
"id": "P00414",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00414"
}
],
"disease": [
{
"disease_id": "DOID:3571",
"recommended_name": {
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "liver cancer",
"description": "A hepatobiliary system cancer that is located_in the liver."
},
"synonyms": [
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Ca liver - primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Resectable malignant neoplasm of Liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant hepato-biliary neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant tumor of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "non-resectable primary hepatic malignant neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary liver cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "resectable malignant neoplasm of the liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, not specified as primary or secondary",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Uterine cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:363",
"evidence": [
{
"database": "BioXpress",
"id": "P00414",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00414"
}
],
"disease": [
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Esophageal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:5041",
"evidence": [
{
"database": "BioXpress",
"id": "P00414",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00414"
}
],
"disease": [
{
"disease_id": "DOID:5041",
"recommended_name": {
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophageal cancer",
"description": "A gastrointestinal system cancer that is located_in the esophagus."
},
"synonyms": [
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophagus cancer",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Distal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Proximal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of the middle Third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": "A primary or metastatic malignant neoplasm involving the esophagus."
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "oesophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the middle third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of abdominal oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the middle third of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Aerodigestive tract cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Escc, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "gastric cardia adenocarcinoma, susceptibility to",
"description": ""
},
{
"id": "MIM:133239",
"resource": "MIM",
"url": "https://www.omim.org/entry/133239",
"name": "Esophageal cancer",
"description": "Esophageal cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Colorectal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:9256",
"evidence": [
{
"database": "BioXpress",
"id": "P00414",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00414"
}
],
"disease": [
{
"disease_id": "DOID:9256",
"recommended_name": {
"id": "DOID:9256",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9256",
"name": "colorectal cancer",
"description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
},
"synonyms": [
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, advanced, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer with chromosomal instability, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectum cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectum neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "CRC",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "large intestine cancer",
"description": ""
},
{
"id": "MIM:114500",
"resource": "MIM",
"url": "https://www.omim.org/entry/114500",
"name": "Colorectal cancer",
"description": "Colorectal cancer"
}
]
}
]
}
],
"species": [
{
"name": "Homo sapiens",
"taxid": 9606,
"evidence": [
{
"database": "UniProtKB",
"id": "P00414",
"url": "https://www.uniprot.org/uniprot/P00414"
}
],
"common_name": "Human"
}
],
"gene": [
{
"name": "MT-CO3",
"url": "https://www.uniprot.org/uniprot/P00414",
"locus": {
"chromosome": "Mitochondrion",
"start_pos": 9990,
"end_pos": 9207,
"strand": "-",
"evidence": [
{
"database": "Ensembl Gene",
"id": "ENSG00000198938",
"url": "https://www.ensembl.org/id/ENSG00000198938"
}
]
}
}
],
"crossref": [
{
"id": "ENSG00000198938",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000198938",
"database": "Bgee",
"categories": [
"Gene Expression"
]
},
{
"id": "cd01665",
"url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01665",
"database": "CDD",
"categories": [
"Protein Classification"
]
},
{
"id": "MT-CO3",
"url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=MT-CO3",
"database": "GeneCards",
"categories": [
"Gene Annotation",
"Organism-specific"
]
},
{
"id": "4514",
"url": "https://www.ncbi.nlm.nih.gov/gene/4514",
"database": "GeneID",
"categories": [
"Genome Annotation"
]
},
{
"id": "7422",
"url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=7422",
"database": "HGNC",
"categories": [
"Organism-specific"
]
},
{
"id": "P00414",
"url": "https://www.ebi.ac.uk/intact/interactors/id:P00414*",
"database": "IntAct",
"categories": [
"Other"
]
},
{
"id": "IPR000298",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR000298",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR013833",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR013833",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR024791",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR024791",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR033945",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR033945",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR035973",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR035973",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "hsa:4514",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:4514",
"database": "KEGG Pathway",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "220110",
"url": "http://www.omim.org/entry/220110",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "516050",
"url": "http://www.omim.org/entry/516050",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "535000",
"url": "http://www.omim.org/entry/535000",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "550500",
"url": "http://www.omim.org/entry/550500",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "NX_P00414",
"url": "https://www.nextprot.org/entry/NX_P00414",
"database": "neXtProt",
"categories": [
"Protein",
"Organism-specific"
]
},
{
"id": "SIYWWGS",
"url": "https://omabrowser.org/oma/group/SIYWWGS/",
"database": "OMA",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR11403",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11403",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR11403:SF7",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11403:SF7",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "5Z62",
"url": "https://www.rcsb.org/structure/5Z62",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "PF00510",
"url": "http://pfam.xfam.org/family/PF00510",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "P00414",
"url": "https://pharos.nih.gov/targets/P00414",
"database": "PHAROS",
"categories": [
"Organism-specific"
]
},
{
"id": "PR_P00414",
"url": "http://purl.obolibrary.org/obo/PR_P00414",
"database": "PRO",
"categories": [
"Protein"
]
},
{
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-611105",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "YP_003024032",
"url": "https://www.ncbi.nlm.nih.gov/protein/YP_003024032",
"database": "RefSeq",
"categories": [
"Protein"
]
},
{
"id": "11436",
"url": "https://www.rhea-db.org/rhea/11436",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "P00414",
"url": "https://www.uniprot.org/uniprot/P00414",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P00414-1",
"url": "https://www.uniprot.org/uniprot/P00414-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
}
],
"sequence": {
"sequence": "MTHQSHAYHMVKPSPWPLTGALSALLMTSGLAMWFHFHSMTLLMLGLLTNTLTMYQWWRDVTRESTYQGHHTPPVQKGLRYGMILFITSEVFFFAGFFWAFYHSSLAPTPQLGGHWPPTGITPLNPLEVPLLNTSVLLASGVSITWAHHSLMENNRNQMIQALLITILLGLYFTLLQASEYFESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSKHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS",
"length": 261,
"header": "sp|P00414-1|COX3_HUMAN Isoform 1 of Cytochrome c oxidase subunit 3 OS=Homo sapiens OX=9606 GN=MT-CO3 PE=1 SV=2 CANONICAL=P00414-1"
},
"isoforms": [
{
"isoform_ac": "P00414-1",
"url": "",
"sequence": {
"sequence": "MTHQSHAYHMVKPSPWPLTGALSALLMTSGLAMWFHFHSMTLLMLGLLTNTLTMYQWWRDVTRESTYQGHHTPPVQKGLRYGMILFITSEVFFFAGFFWAFYHSSLAPTPQLGGHWPPTGITPLNPLEVPLLNTSVLLASGVSITWAHHSLMENNRNQMIQALLITILLGLYFTLLQASEYFESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSKHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS",
"length": 261,
"header": "sp|P00414-1|COX3_HUMAN Isoform 1 of Cytochrome c oxidase subunit 3 OS=Homo sapiens OX=9606 GN=MT-CO3 PE=1 SV=2 CANONICAL=P00414-1"
},
"locus": {
"chromosome": "Mitochondrion",
"start_pos": 9989,
"end_pos": 9207,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000362079.2",
"url": "https://www.ensembl.org/id/ENST00000362079.2"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000354982.2",
"url": "https://www.ensembl.org/id/ENSP00000354982.2"
}
]
}
}
],
"glycosylation": [],
"phosphorylation": [],
"glycation": [],
"keywords": [
"enzyme"
],
"publication": [
{
"title": "Defects in mitochondrial beta-oxidation of fatty acids.",
"journal": "Current opinion in lipidology",
"date": "1999",
"authors": "Wood PA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-611105",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105"
}
],
"reference": [
{
"type": "PubMed",
"id": "10327278",
"url": "https://glygen.org/publication/PubMed/10327278"
}
]
},
{
"title": "Importance of glucose-6-phosphate dehydrogenase activity in cell death.",
"journal": "The American journal of physiology",
"date": "1999",
"authors": "Tian WN, Braunstein LD, Apse K, Pang J, Rose M, Tian X, Stanton RC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "10329961",
"url": "https://glygen.org/publication/PubMed/10329961"
}
]
},
{
"title": "A ribonucleotide reductase gene involved in a p53-dependent cell-cycle checkpoint for DNA damage.",
"journal": "Nature",
"date": "2000",
"authors": "Tanaka H, Arakawa H, Yamaguchi T, Shiraishi K, Fukuda S, Matsui K, Takei Y, Nakamura Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "10716435",
"url": "https://glygen.org/publication/PubMed/10716435"
}
]
},
{
"title": "Human glucose-6-phosphate dehydrogenase: the crystal structure reveals a structural NADP(+) molecule and provides insights into enzyme deficiency.",
"journal": "Structure (London, England : 1993)",
"date": "2000",
"authors": "Au SW, Gover S, Lam VM, Adams MJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "10745013",
"url": "https://glygen.org/publication/PubMed/10745013"
}
]
},
{
"title": "A ribonucleotide reductase gene is a transcriptional target of p53 and p73.",
"journal": "Oncogene",
"date": "2000",
"authors": "Nakano K, Balint E, Ashcroft M, Vousden KH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "10980602",
"url": "https://glygen.org/publication/PubMed/10980602"
}
]
},
{
"title": "Overexpression of fructose 2,6-bisphosphatase decreases glycolysis and delays cell cycle progression.",
"journal": "American journal of physiology. Cell physiology",
"date": "2000",
"authors": "Perez JX, Roig T, Manzano A, Dalmau M, Boada J, Ventura F, Rosa JL, Bermudez J, Bartrons R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "11029283",
"url": "https://glygen.org/publication/PubMed/11029283"
}
]
},
{
"title": "Cells overexpressing fructose-2,6-bisphosphatase showed enhanced pentose phosphate pathway flux and resistance to oxidative stress.",
"journal": "FEBS letters",
"date": "2000",
"authors": "Boada J, Roig T, Perez X, Gamez A, Bartrons R, Cascante M, Bermudez J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "11034341",
"url": "https://glygen.org/publication/PubMed/11034341"
}
]
},
{
"title": "Structures and proton-pumping strategies of mitochondrial respiratory enzymes.",
"journal": "Annual review of biophysics and biomolecular structure",
"date": "2001",
"authors": "Schultz BE, Chan SI",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "11340051",
"url": "https://glygen.org/publication/PubMed/11340051"
}
]
},
{
"title": "Growth factors can influence cell growth and survival through effects on glucose metabolism.",
"journal": "Molecular and cellular biology",
"date": "2001",
"authors": "Vander Heiden MG, Plas DR, Rathmell JC, Fox CJ, Harris MH, Thompson CB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "11486029",
"url": "https://glygen.org/publication/PubMed/11486029"
}
]
},
{
"title": "Regulation of PTEN transcription by p53.",
"journal": "Molecular cell",
"date": "2001",
"authors": "Stambolic V, MacPherson D, Sas D, Lin Y, Snow B, Jang Y, Benchimol S, Mak TW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "11545734",
"url": "https://glygen.org/publication/PubMed/11545734"
}
]
},
{
"title": "Human NADH:ubiquinone oxidoreductase.",
"journal": "Journal of bioenergetics and biomembranes",
"date": "2001",
"authors": "Smeitink J, Sengers R, Trijbels F, van den Heuvel L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-611105",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105"
}
],
"reference": [
{
"type": "PubMed",
"id": "11695836",
"url": "https://glygen.org/publication/PubMed/11695836"
}
]
},
{
"title": "p53 regulates cell survival by inhibiting PIK3CA in squamous cell carcinomas.",
"journal": "Genes & development",
"date": "2002",
"authors": "Singh B, Reddy PG, Goberdhan A, Walsh C, Dao S, Ngai I, Chou TC, O-Charoenrat P, Levine AJ, Rao PH, Stoffel A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "11959846",
"url": "https://glygen.org/publication/PubMed/11959846"
}
]
},
{
"title": "Inactivation of human peroxiredoxin I during catalysis as the result of the oxidation of the catalytic site cysteine to cysteine-sulfinic acid.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Yang KS, Kang SW, Woo HA, Hwang SC, Chae HZ, Kim K, Rhee SG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "12161445",
"url": "https://glygen.org/publication/PubMed/12161445"
}
]
},
{
"title": "Identification of a novel stress-responsive gene Hi95 involved in regulation of cell viability.",
"journal": "Oncogene",
"date": "2002",
"authors": "Budanov AV, Shoshani T, Faerman A, Zelin E, Kamer I, Kalinski H, Gorodin S, Fishman A, Chajut A, Einat P, Skaliter R, Gudkov AV, Chumakov PM, Feinstein E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "12203114",
"url": "https://glygen.org/publication/PubMed/12203114"
}
]
},
{
"title": "The energy-transducing NADH: quinone oxidoreductase, complex I.",
"journal": "Molecular aspects of medicine",
"date": "2002",
"authors": "Yano T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-611105",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105"
}
],
"reference": [
{
"type": "PubMed",
"id": "12231006",
"url": "https://glygen.org/publication/PubMed/12231006"
}
]
},
{
"title": "14-3-3 interacts with the tumor suppressor tuberin at Akt phosphorylation site(s).",
"journal": "Cancer research",
"date": "2002",
"authors": "Liu MY, Cai S, Espejo A, Bedford MT, Walker CL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "12438239",
"url": "https://glygen.org/publication/PubMed/12438239"
}
]
},
{
"title": "REDD1, a developmentally regulated transcriptional target of p63 and p53, links p63 to regulation of reactive oxygen species.",
"journal": "Molecular cell",
"date": "2002",
"authors": "Ellisen LW, Ramsayer KD, Johannessen CM, Yang A, Beppu H, Minda K, Oliner JD, McKeon F, Haber DA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "12453409",
"url": "https://glygen.org/publication/PubMed/12453409"
}
]
},
{
"title": "Peroxiredoxin evolution and the regulation of hydrogen peroxide signaling.",
"journal": "Science (New York, N.Y.)",
"date": "2003",
"authors": "Wood ZA, Poole LB, Karplus PA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "12714747",
"url": "https://glygen.org/publication/PubMed/12714747"
}
]
},
{
"title": "The nuclear encoded subunits of complex I from bovine heart mitochondria.",
"journal": "Biochimica et biophysica acta",
"date": "2003",
"authors": "Hirst J, Carroll J, Fearnley IM, Shannon RJ, Walker JE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-611105",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105"
}
],
"reference": [
{
"type": "PubMed",
"id": "12837546",
"url": "https://glygen.org/publication/PubMed/12837546"
}
]
},
{
"title": "Rheb GTPase is a direct target of TSC2 GAP activity and regulates mTOR signaling.",
"journal": "Genes & development",
"date": "2003",
"authors": "Inoki K, Li Y, Xu T, Guan KL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "12869586",
"url": "https://glygen.org/publication/PubMed/12869586"
}
]
},
{
"title": "Tuberous sclerosis complex gene products, Tuberin and Hamartin, control mTOR signaling by acting as a GTPase-activating protein complex toward Rheb.",
"journal": "Current biology : CB",
"date": "2003",
"authors": "Tee AR, Manning BD, Roux PP, Cantley LC, Blenis J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "12906785",
"url": "https://glygen.org/publication/PubMed/12906785"
}
]
},
{
"title": "Carbon monoxide specifically inhibits cytochrome c oxidase of human mitochondrial respiratory chain.",
"journal": "Pharmacology & toxicology",
"date": "2003",
"authors": "Alonso JR, Cardellach F, Lopez S, Casademont J, Miro O",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564"
}
],
"reference": [
{
"type": "PubMed",
"id": "12969439",
"url": "https://glygen.org/publication/PubMed/12969439"
}
]
},
{
"title": "Saturation kinetics of coenzyme Q in NADH and succinate oxidation in beef heart mitochondria.",
"journal": "FEBS letters",
"date": "1992",
"authors": "Estornell E, Fato R, Castelluccio C, Cavazzoni M, Parenti Castelli G, Lenaz G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-611105",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105"
}
],
"reference": [
{
"type": "PubMed",
"id": "1327877",
"url": "https://glygen.org/publication/PubMed/1327877"
}
]
},
{
"title": "On the origin of cancer cells.",
"journal": "Science (New York, N.Y.)",
"date": "1956",
"authors": "WARBURG O",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "13298683",
"url": "https://glygen.org/publication/PubMed/13298683"
}
]
},
{
"title": "Enzymes of the human erythrocyte. IV. Phosphoglucose isomerase, purification and properties.",
"journal": "The Journal of biological chemistry",
"date": "1958",
"authors": "TSUBOI KK, ESTRADA J, HUDSON PB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "13538944",
"url": "https://glygen.org/publication/PubMed/13538944"
}
]
},
{
"title": "TSC2 mediates cellular energy response to control cell growth and survival.",
"journal": "Cell",
"date": "2003",
"authors": "Inoki K, Zhu T, Guan KL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "14651849",
"url": "https://glygen.org/publication/PubMed/14651849"
}
]
},
{
"title": "The gross structure of the respiratory complex I: a Lego System.",
"journal": "Biochimica et biophysica acta",
"date": "2004",
"authors": "Friedrich T, Bottcher B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-611105",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105"
}
],
"reference": [
{
"type": "PubMed",
"id": "14741580",
"url": "https://glygen.org/publication/PubMed/14741580"
}
]
},
{
"title": "Glucose-6-phosphate dehydrogenase plays a crucial role in protection from redox-stress-induced apoptosis.",
"journal": "Cell death and differentiation",
"date": "2004",
"authors": "Fico A, Paglialunga F, Cigliano L, Abrescia P, Verde P, Martini G, Iaccarino I, Filosa S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "15044966",
"url": "https://glygen.org/publication/PubMed/15044966"
}
]
},
{
"title": "Regeneration of peroxiredoxins by p53-regulated sestrins, homologs of bacterial AhpD.",
"journal": "Science (New York, N.Y.)",
"date": "2004",
"authors": "Budanov AV, Sablina AA, Feinstein E, Koonin EV, Chumakov PM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "15105503",
"url": "https://glygen.org/publication/PubMed/15105503"
}
]
},
{
"title": "Proton pump coupled to cytochrome c oxidase in mitochondria.",
"journal": "Nature",
"date": "1977",
"authors": "Wikstrom MK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "15223",
"url": "https://glygen.org/publication/PubMed/15223"
}
]
},
{
"title": "Structural organization of mitochondrial human complex I: role of the ND4 and ND5 mitochondria-encoded subunits and interaction with prohibitin.",
"journal": "The Biochemical journal",
"date": "2004",
"authors": "Bourges I, Ramus C, Mousson de Camaret B, Beugnot R, Remacle C, Cardol P, Hofhaus G, Issartel JP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-611105",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105"
}
],
"reference": [
{
"type": "PubMed",
"id": "15250827",
"url": "https://glygen.org/publication/PubMed/15250827"
}
]
},
{
"title": "Signaling pathways: the benefits of good communication.",
"journal": "Current biology : CB",
"date": "2004",
"authors": "Fisher TL, White MF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "15589136",
"url": "https://glygen.org/publication/PubMed/15589136"
}
]
},
{
"title": "Identification of novel p53 target genes in ionizing radiation response.",
"journal": "Cancer research",
"date": "2005",
"authors": "Jen KY, Cheung VG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "16140933",
"url": "https://glygen.org/publication/PubMed/16140933"
}
]
},
{
"title": "The Saccharomyces cerevisiae COQ10 gene encodes a START domain protein required for function of coenzyme Q in respiration.",
"journal": "The Journal of biological chemistry",
"date": "2005",
"authors": "Barros MH, Johnson A, Gin P, Marbois BN, Clarke CF, Tzagoloff A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-611105",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105"
}
],
"reference": [
{
"type": "PubMed",
"id": "16230336",
"url": "https://glygen.org/publication/PubMed/16230336"
}
]
},
{
"title": "A global map of p53 transcription-factor binding sites in the human genome.",
"journal": "Cell",
"date": "2006",
"authors": "Wei CL, Wu Q, Vega VB, Chiu KP, Ng P, Zhang T, Shahab A, Yong HC, Fu Y, Weng Z, Liu J, Zhao XD, Chew JL, Lee YL, Kuznetsov VA, Sung WK, Miller LD, Lim B, Liu ET, Yu Q, Ng HH, Ruan Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "16413492",
"url": "https://glygen.org/publication/PubMed/16413492"
}
]
},
{
"title": "Identification of STAT3 as a specific substrate of breast tumor kinase.",
"journal": "Oncogene",
"date": "2006",
"authors": "Liu L, Gao Y, Qiu H, Miller WT, Poli V, Reich NC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564"
}
],
"reference": [
{
"type": "PubMed",
"id": "16568091",
"url": "https://glygen.org/publication/PubMed/16568091"
}
]
},
{
"title": "Activity of TSC2 is inhibited by AKT-mediated phosphorylation and membrane partitioning.",
"journal": "The Journal of cell biology",
"date": "2006",
"authors": "Cai SL, Tee AR, Short JD, Bergeron JM, Kim J, Shen J, Guo R, Johnson CL, Kiguchi K, Walker CL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "16636147",
"url": "https://glygen.org/publication/PubMed/16636147"
}
]
},
{
"title": "p53 regulates mitochondrial respiration.",
"journal": "Science (New York, N.Y.)",
"date": "2006",
"authors": "Matoba S, Kang JG, Patino WD, Wragg A, Boehm M, Gavrilova O, Hurley PJ, Bunz F, Hwang PM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "16728594",
"url": "https://glygen.org/publication/PubMed/16728594"
}
]
},
{
"title": "Assembly of mitochondrial cytochrome c-oxidase, a complicated and highly regulated cellular process.",
"journal": "American journal of physiology. Cell physiology",
"date": "2006",
"authors": "Fontanesi F, Soto IC, Horn D, Barrientos A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "16760263",
"url": "https://glygen.org/publication/PubMed/16760263"
}
]
},
{
"title": "In situ origin of deep rooting lineages of mitochondrial Macrohaplogroup 'M' in India.",
"journal": "BMC Genomics",
"date": "2006",
"authors": "Thangaraj Kumarasamy, Chaubey Gyaneshwer, Singh Vijay Kumar, Vanniarajan Ayyasamy, Thanseem Ismail, Reddy Alla G, Singh Lalji",
"evidence": [
{
"database": "UniProtKB",
"id": "P00414",
"url": "https://www.uniprot.org/uniprot/P00414"
}
],
"reference": [
{
"type": "PubMed",
"id": "16776823",
"url": "https://glygen.org/publication/PubMed/16776823"
}
]
},
{
"title": "TIGAR, a p53-inducible regulator of glycolysis and apoptosis.",
"journal": "Cell",
"date": "2006",
"authors": "Bensaad K, Tsuruta A, Selak MA, Vidal MN, Nakano K, Bartrons R, Gottlieb E, Vousden KH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "16839880",
"url": "https://glygen.org/publication/PubMed/16839880"
}
]
},
{
"title": "Carbon monoxide signals via inhibition of cytochrome c oxidase and generation of mitochondrial reactive oxygen species.",
"journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology",
"date": "2007",
"authors": "Zuckerbraun BS, Chin BY, Bilban M, d'Avila JC, Rao J, Billiar TR, Otterbein LE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564"
}
],
"reference": [
{
"type": "PubMed",
"id": "17264172",
"url": "https://glygen.org/publication/PubMed/17264172"
}
]
},
{
"title": "Biogenesis of eukaryotic cytochrome c oxidase.",
"journal": "Physiological research",
"date": "2006",
"authors": "Stiburek L, Hansikova H, Tesarova M, Cerna L, Zeman J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "17298220",
"url": "https://glygen.org/publication/PubMed/17298220"
}
]
},
{
"title": "Mutation of RRM2B, encoding p53-controlled ribonucleotide reductase (p53R2), causes severe mitochondrial DNA depletion.",
"journal": "Nature genetics",
"date": "2007",
"authors": "Bourdon A, Minai L, Serre V, Jais JP, Sarzi E, Aubert S, Chretien D, de Lonlay P, Paquis-Flucklinger V, Arakawa H, Nakamura Y, Munnich A, Rotig A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "17486094",
"url": "https://glygen.org/publication/PubMed/17486094"
}
]
},
{
"title": "NGF-mediated transcriptional targets of p53 in PC12 neuronal differentiation.",
"journal": "BMC genomics",
"date": "2007",
"authors": "Brynczka C, Labhart P, Merrick BA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "17540029",
"url": "https://glygen.org/publication/PubMed/17540029"
}
]
},
{
"title": "Normal variants of human mitochondrial DNA and translation products: the building of a reference data base.",
"journal": "Hum. Genet.",
"date": "1991",
"authors": "Marzuki S, Noer A S, Lertrit P, Thyagarajan D, Kapsa R, Utthanaphol P, Byrne E",
"evidence": [
{
"database": "UniProtKB",
"id": "P00414",
"url": "https://www.uniprot.org/uniprot/P00414"
}
],
"reference": [
{
"type": "PubMed",
"id": "1757091",
"url": "https://glygen.org/publication/PubMed/1757091"
}
]
},
{
"title": "Hypoxia regulates TSC1/2-mTOR signaling and tumor suppression through REDD1-mediated 14-3-3 shuttling.",
"journal": "Genes & development",
"date": "2008",
"authors": "DeYoung MP, Horak P, Sofer A, Sgroi D, Ellisen LW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "18198340",
"url": "https://glygen.org/publication/PubMed/18198340"
}
]
},
{
"title": "Synaptic NMDA receptor activity boosts intrinsic antioxidant defenses.",
"journal": "Nature neuroscience",
"date": "2008",
"authors": "Papadia S, Soriano FX, Leveille F, Martel MA, Dakin KA, Hansen HH, Kaindl A, Sifringer M, Fowler J, Stefovska V, McKenzie G, Craigon M, Corriveau R, Ghazal P, Horsburgh K, Yankner BA, Wyllie DJ, Ikonomidou C, Hardingham GE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "18344994",
"url": "https://glygen.org/publication/PubMed/18344994"
}
]
},
{
"title": "A MELAS syndrome family harboring two mutations in mitochondrial genome.",
"journal": "Experimental & molecular medicine",
"date": "2008",
"authors": "Choi BO, Hwang JH, Kim J, Cho EM, Cho SY, Hwang SJ, Lee HW, Kim SJ, Chung KW",
"evidence": [
{
"database": "UniProtKB",
"id": "P00414",
"url": "https://www.uniprot.org/uniprot/P00414"
}
],
"reference": [
{
"type": "PubMed",
"id": "18587274",
"url": "https://glygen.org/publication/PubMed/18587274"
}
]
},
{
"title": "Possible molecular mechanisms of the protonmotive function of cytochrome systems.",
"journal": "Journal of theoretical biology",
"date": "1976",
"authors": "Mitchell P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-611105",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105"
}
],
"reference": [
{
"type": "PubMed",
"id": "186667",
"url": "https://glygen.org/publication/PubMed/186667"
}
]
},
{
"title": "p53 target genes sestrin1 and sestrin2 connect genotoxic stress and mTOR signaling.",
"journal": "Cell",
"date": "2008",
"authors": "Budanov AV, Karin M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "18692468",
"url": "https://glygen.org/publication/PubMed/18692468"
}
]
},
{
"title": "Sestrin 2 is not a reductase for cysteine sulfinic acid of peroxiredoxins.",
"journal": "Antioxidants & redox signaling",
"date": "2009",
"authors": "Woo HA, Bae SH, Park S, Rhee SG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "19113821",
"url": "https://glygen.org/publication/PubMed/19113821"
}
]
},
{
"title": "p53 regulates mtDNA copy number and mitocheckpoint pathway.",
"journal": "Journal of carcinogenesis",
"date": "2009",
"authors": "Kulawiec M, Ayyasamy V, Singh KK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "19439913",
"url": "https://glygen.org/publication/PubMed/19439913"
}
]
},
{
"title": "The PTEN-regulating microRNA miR-26a is amplified in high-grade glioma and facilitates gliomagenesis in vivo.",
"journal": "Genes & development",
"date": "2009",
"authors": "Huse JT, Brennan C, Hambardzumyan D, Wee B, Pena J, Rouhanifard SH, Sohn-Lee C, le Sage C, Agami R, Tuschl T, Holland EC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "19487573",
"url": "https://glygen.org/publication/PubMed/19487573"
}
]
},
{
"title": "Limited role for the bilirubin-biliverdin redox amplification cycle in the cellular antioxidant protection by biliverdin reductase.",
"journal": "The Journal of biological chemistry",
"date": "2009",
"authors": "Maghzal GJ, Leck MC, Collinson E, Li C, Stocker R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564"
}
],
"reference": [
{
"type": "PubMed",
"id": "19690164",
"url": "https://glygen.org/publication/PubMed/19690164"
}
]
},
{
"title": "Role of sestrin2 in peroxide signaling in macrophages.",
"journal": "FEBS letters",
"date": "2009",
"authors": "Essler S, Dehne N, Brune B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "19822145",
"url": "https://glygen.org/publication/PubMed/19822145"
}
]
},
{
"title": "Biopreservation of red blood cells--the struggle with hemoglobin oxidation.",
"journal": "The FEBS journal",
"date": "2010",
"authors": "Kanias T, Acker JP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564"
}
],
"reference": [
{
"type": "PubMed",
"id": "19968714",
"url": "https://glygen.org/publication/PubMed/19968714"
}
]
},
{
"title": "Integrative genome analysis reveals an oncomir/oncogene cluster regulating glioblastoma survivorship.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2010",
"authors": "Kim H, Huang W, Jiang X, Pennicooke B, Park PJ, Johnson MD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "20080666",
"url": "https://glygen.org/publication/PubMed/20080666"
}
]
},
{
"title": "p53 regulation of the IGF-1/AKT/mTOR pathways and the endosomal compartment.",
"journal": "Cold Spring Harbor perspectives in biology",
"date": "2010",
"authors": "Feng Z",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "20182617",
"url": "https://glygen.org/publication/PubMed/20182617"
}
]
},
{
"title": "Phosphate-activated glutaminase (GLS2), a p53-inducible regulator of glutamine metabolism and reactive oxygen species.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2010",
"authors": "Suzuki S, Tanaka T, Poyurovsky MV, Nagano H, Mayama T, Ohkubo S, Lokshin M, Hosokawa H, Nakayama T, Suzuki Y, Sugano S, Sato E, Nagao T, Yokote K, Tatsuno I, Prives C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "20351271",
"url": "https://glygen.org/publication/PubMed/20351271"
}
]
},
{
"title": "Glutaminase 2, a novel p53 target gene regulating energy metabolism and antioxidant function.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2010",
"authors": "Hu W, Zhang C, Wu R, Sun Y, Levine A, Feng Z",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "20378837",
"url": "https://glygen.org/publication/PubMed/20378837"
}
]
},
{
"title": "Interactions of STAP-2 with Brk and STAT3 participate in cell growth of human breast cancer cells.",
"journal": "The Journal of biological chemistry",
"date": "2010",
"authors": "Ikeda O, Sekine Y, Mizushima A, Nakasuji M, Miyasaka Y, Yamamoto C, Muromoto R, Nanbo A, Oritani K, Yoshimura A, Matsuda T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564"
}
],
"reference": [
{
"type": "PubMed",
"id": "20929863",
"url": "https://glygen.org/publication/PubMed/20929863"
}
]
},
{
"title": "Physical exercise regulates p53 activity targeting SCO2 and increases mitochondrial COX biogenesis in cardiac muscle with age.",
"journal": "PloS one",
"date": "2011",
"authors": "Qi Z, He J, Su Y, He Q, Liu J, Yu L, Al-Attas O, Hussain T, Ding S, Ji L, Qian M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "21750704",
"url": "https://glygen.org/publication/PubMed/21750704"
}
]
},
{
"title": "Biogenesis and assembly of eukaryotic cytochrome c oxidase catalytic core.",
"journal": "Biochimica et biophysica acta",
"date": "2012",
"authors": "Soto IC, Fontanesi F, Liu J, Barrientos A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "21958598",
"url": "https://glygen.org/publication/PubMed/21958598"
}
]
},
{
"title": "Sestrin2 modulates AMPK subunit expression and its response to ionizing radiation in breast cancer cells.",
"journal": "PloS one",
"date": "2012",
"authors": "Sanli T, Linher-Melville K, Tsakiridis T, Singh G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "22363791",
"url": "https://glygen.org/publication/PubMed/22363791"
}
]
},
{
"title": "Carbon monoxide promotes respiratory hemoproteins iron reduction using peroxides as electron donors.",
"journal": "PloS one",
"date": "2012",
"authors": "Sher EA, Shaklai M, Shaklai N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564"
}
],
"reference": [
{
"type": "PubMed",
"id": "22427940",
"url": "https://glygen.org/publication/PubMed/22427940"
}
]
},
{
"title": "NDUFA4 is a subunit of complex IV of the mammalian electron transport chain.",
"journal": "Cell metabolism",
"date": "2012",
"authors": "Balsa E, Marco R, Perales-Clemente E, Szklarczyk R, Calvo E, Landazuri MO, Enriquez JA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "22902835",
"url": "https://glygen.org/publication/PubMed/22902835"
}
]
},
{
"title": "A conserved START domain coenzyme Q-binding polypeptide is required for efficient Q biosynthesis, respiratory electron transport, and antioxidant function in Saccharomyces cerevisiae.",
"journal": "Biochimica et biophysica acta",
"date": "2013",
"authors": "Allan CM, Hill S, Morvaridi S, Saiki R, Johnson JS, Liau WS, Hirano K, Kawashima T, Ji Z, Loo JA, Shepherd JN, Clarke CF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-611105",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105"
}
],
"reference": [
{
"type": "PubMed",
"id": "23270816",
"url": "https://glygen.org/publication/PubMed/23270816"
}
]
},
{
"title": "Molecular chaperone TRAP1 regulates a metabolic switch between mitochondrial respiration and aerobic glycolysis.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2013",
"authors": "Yoshida S, Tsutsumi S, Muhlebach G, Sourbier C, Lee MJ, Lee S, Vartholomaiou E, Tatokoro M, Beebe K, Miyajima N, Mohney RP, Chen Y, Hasumi H, Xu W, Fukushima H, Nakamura K, Koga F, Kihara K, Trepel J, Picard D, Neckers L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-611105",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105"
}
],
"reference": [
{
"type": "PubMed",
"id": "23564345",
"url": "https://glygen.org/publication/PubMed/23564345"
}
]
},
{
"title": "NDUFA4 mutations underlie dysfunction of a cytochrome c oxidase subunit linked to human neurological disease.",
"journal": "Cell reports",
"date": "2013",
"authors": "Pitceathly RD, Rahman S, Wedatilake Y, Polke JM, Cirak S, Foley AR, Sailer A, Hurles ME, Stalker J, Hargreaves I, Woodward CE, Sweeney MG, Muntoni F, Houlden H, Taanman JW, Hanna MG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "23746447",
"url": "https://glygen.org/publication/PubMed/23746447"
}
]
},
{
"title": "The mitochondrial chaperone TRAP1 promotes neoplastic growth by inhibiting succinate dehydrogenase.",
"journal": "Cell metabolism",
"date": "2013",
"authors": "Sciacovelli M, Guzzo G, Morello V, Frezza C, Zheng L, Nannini N, Calabrese F, Laudiero G, Esposito F, Landriscina M, Defilippi P, Bernardi P, Rasola A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-611105",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105"
}
],
"reference": [
{
"type": "PubMed",
"id": "23747254",
"url": "https://glygen.org/publication/PubMed/23747254"
}
]
},
{
"title": "Diverse stresses dramatically alter genome-wide p53 binding and transactivation landscape in human cancer cells.",
"journal": "Nucleic acids research",
"date": "2013",
"authors": "Menendez D, Nguyen TA, Freudenberg JM, Mathew VJ, Anderson CW, Jothi R, Resnick MA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "23775793",
"url": "https://glygen.org/publication/PubMed/23775793"
}
]
},
{
"title": "Protonmotive redox mechanism of the cytochrome b-c1 complex in the respiratory chain: protonmotive ubiquinone cycle.",
"journal": "FEBS letters",
"date": "1975",
"authors": "Mitchell P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-611105",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105"
}
],
"reference": [
{
"type": "PubMed",
"id": "239860",
"url": "https://glygen.org/publication/PubMed/239860"
}
]
},
{
"title": "Glucose-6-phosphate dehydrogenase: a biomarker and potential therapeutic target for cancer.",
"journal": "Anti-cancer agents in medicinal chemistry",
"date": "2014",
"authors": "Zhang C, Zhang Z, Zhu Y, Qin S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "24066844",
"url": "https://glygen.org/publication/PubMed/24066844"
}
]
},
{
"title": "p53/TAp63 and AKT regulate mammalian target of rapamycin complex 1 (mTORC1) signaling through two independent parallel pathways in the presence of DNA damage.",
"journal": "The Journal of biological chemistry",
"date": "2014",
"authors": "Cam M, Bid HK, Xiao L, Zambetti GP, Houghton PJ, Cam H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "24366874",
"url": "https://glygen.org/publication/PubMed/24366874"
}
]
},
{
"title": "TIGAR, TIGAR, burning bright.",
"journal": "Cancer & metabolism",
"date": "2014",
"authors": "Lee P, Vousden KH, Cheung EC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "24383451",
"url": "https://glygen.org/publication/PubMed/24383451"
}
]
},
{
"title": "The tumor suppressor PTEN interacts with p53 in hereditary cancer (Review).",
"journal": "International journal of oncology",
"date": "2014",
"authors": "Nakanishi A, Kitagishi Y, Ogura Y, Matsuda S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "24718924",
"url": "https://glygen.org/publication/PubMed/24718924"
}
]
},
{
"title": "Inhibition of succinate dehydrogenase by the mitochondrial chaperone TRAP1 has anti-oxidant and anti-apoptotic effects on tumor cells.",
"journal": "Oncotarget",
"date": "2014",
"authors": "Guzzo G, Sciacovelli M, Bernardi P, Rasola A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-611105",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105"
}
],
"reference": [
{
"type": "PubMed",
"id": "25564869",
"url": "https://glygen.org/publication/PubMed/25564869"
}
]
},
{
"title": "Peroxiredoxin 1 promotes tumorigenesis through regulating the activity of mTOR/p70S6K pathway in esophageal squamous cell carcinoma.",
"journal": "Medical oncology (Northwood, London, England)",
"date": "2015",
"authors": "Gong F, Hou G, Liu H, Zhang M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "25579166",
"url": "https://glygen.org/publication/PubMed/25579166"
}
]
},
{
"title": "Novel therapeutic interventions for p53-altered tumors through manipulation of its family members, p63 and p73.",
"journal": "Cell cycle (Georgetown, Tex.)",
"date": "2016",
"authors": "Venkatanarayan A, Raulji P, Norton W, Flores ER",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "26652033",
"url": "https://glygen.org/publication/PubMed/26652033"
}
]
},
{
"title": "Crystal structure of CO-bound cytochrome c oxidase determined by serial femtosecond X-ray crystallography at room temperature.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2017",
"authors": "Ishigami I, Zatsepin NA, Hikita M, Conrad CE, Nelson G, Coe JD, Basu S, Grant TD, Seaberg MH, Sierra RG, Hunter MS, Fromme P, Fromme R, Yeh SR, Rousseau DL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564"
}
],
"reference": [
{
"type": "PubMed",
"id": "28698372",
"url": "https://glygen.org/publication/PubMed/28698372"
}
]
},
{
"title": "Architecture of human mitochondrial respiratory megacomplex I2III2IV2.",
"journal": "Cell",
"date": "2017",
"authors": "Guo R, Zong S, Wu M, Gu J, Yang M",
"evidence": [
{
"database": "UniProtKB",
"id": "P00414",
"url": "https://www.uniprot.org/uniprot/P00414"
}
],
"reference": [
{
"type": "PubMed",
"id": "28844695",
"url": "https://glygen.org/publication/PubMed/28844695"
}
]
},
{
"title": "Structure of the intact 14-subunit human cytochrome c oxidase.",
"journal": "Cell Res.",
"date": "2018",
"authors": "Zong S, Wu M, Gu J, Liu T, Guo R, Yang M",
"evidence": [
{
"database": "UniProtKB",
"id": "P00414",
"url": "https://www.uniprot.org/uniprot/P00414"
}
],
"reference": [
{
"type": "PubMed",
"id": "30030519",
"url": "https://glygen.org/publication/PubMed/30030519"
}
]
},
{
"title": "Carbon monoxide binding to human hemoglobin A0.",
"journal": "Biochemistry",
"date": "1987",
"authors": "Di Cera E, Doyle ML, Connelly PR, Gill SJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564"
}
],
"reference": [
{
"type": "PubMed",
"id": "3427020",
"url": "https://glygen.org/publication/PubMed/3427020"
}
]
},
{
"title": "Antioxidant activity of albumin-bound bilirubin.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1987",
"authors": "Stocker R, Glazer AN, Ames BN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564"
}
],
"reference": [
{
"type": "PubMed",
"id": "3475708",
"url": "https://glygen.org/publication/PubMed/3475708"
}
]
},
{
"title": "Studies on the mechanims of oxidative phosphorylation. IX. Effect of cytochrome c on energy-linked processes.",
"journal": "The Journal of biological chemistry",
"date": "1966",
"authors": "MacLennan DH, Lenaz G, Szarkowska L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-611105",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105"
}
],
"reference": [
{
"type": "PubMed",
"id": "4288886",
"url": "https://glygen.org/publication/PubMed/4288886"
}
]
},
{
"title": "Enzymic properties of different types of human erythrocyte glucose-6-phosphate dehydrogenase, with characterization of two new genetic variants.",
"journal": "The Journal of clinical investigation",
"date": "1968",
"authors": "Luzzatto L, Afolayan A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "5666113",
"url": "https://glygen.org/publication/PubMed/5666113"
}
]
},
{
"title": "Hemoglobin. A biologic fenton reagent.",
"journal": "The Journal of biological chemistry",
"date": "1984",
"authors": "Sadrzadeh SM, Graf E, Panter SS, Hallaway PE, Eaton JW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564"
}
],
"reference": [
{
"type": "PubMed",
"id": "6094553",
"url": "https://glygen.org/publication/PubMed/6094553"
}
]
},
{
"title": "Sequence and organization of the human mitochondrial genome.",
"journal": "Nature",
"date": "1981",
"authors": "Anderson S, Bankier AT, Barrell BG, de Bruijn MH, Coulson AR, Drouin J, Eperon IC, Nierlich DP, Roe BA, Sanger F, Schreier PH, Smith AJ, Staden R, Young IG",
"evidence": [
{
"database": "UniProtKB",
"id": "P00414",
"url": "https://www.uniprot.org/uniprot/P00414"
}
],
"reference": [
{
"type": "PubMed",
"id": "7219534",
"url": "https://glygen.org/publication/PubMed/7219534"
}
]
},
{
"title": "A new mutation associated with MELAS is located in a mitochondrial DNA polypeptide-coding gene.",
"journal": "Neuromuscular disorders : NMD",
"date": "1995",
"authors": "Manfredi G, Schon EA, Moraes CT, Bonilla E, Berry GT, Sladky JT, DiMauro S",
"evidence": [
{
"database": "UniProtKB",
"id": "P00414",
"url": "https://www.uniprot.org/uniprot/P00414"
}
],
"reference": [
{
"type": "PubMed",
"id": "7496173",
"url": "https://glygen.org/publication/PubMed/7496173"
}
]
},
{
"title": "Energy transduction by cytochrome complexes in mitochondrial and bacterial respiration: the enzymology of coupling electron transfer reactions to transmembrane proton translocation.",
"journal": "Annual review of biochemistry",
"date": "1994",
"authors": "Trumpower BL, Gennis RB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "7979252",
"url": "https://glygen.org/publication/PubMed/7979252"
}
]
},
{
"title": "The characterization of gene mutations for human glucose phosphate isomerase deficiency associated with chronic hemolytic anemia.",
"journal": "The Journal of clinical investigation",
"date": "1994",
"authors": "Xu W, Beutler E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "7989588",
"url": "https://glygen.org/publication/PubMed/7989588"
}
]
},
{
"title": "Glucose-6-phosphate dehydrogenase: a `housekeeping` enzyme subject to tissue-specific regulation by hormones, nutrients, and oxidant stress.",
"journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology",
"date": "1994",
"authors": "Kletzien RF, Harris PK, Foellmi LA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "8119488",
"url": "https://glygen.org/publication/PubMed/8119488"
}
]
},
{
"title": "Cytochrome c oxidase mutations in Leber hereditary optic neuropathy.",
"journal": "Biochemical and biophysical research communications",
"date": "1993",
"authors": "Johns DR, Neufeld MJ",
"evidence": [
{
"database": "UniProtKB",
"id": "P00414",
"url": "https://www.uniprot.org/uniprot/P00414"
}
],
"reference": [
{
"type": "PubMed",
"id": "8240356",
"url": "https://glygen.org/publication/PubMed/8240356"
}
]
},
{
"title": "A microdeletion in cytochrome c oxidase (COX) subunit III associated with COX deficiency and recurrent myoglobinuria.",
"journal": "Nature genetics",
"date": "1996",
"authors": "Keightley JA, Hoffbuhr KC, Burton MD, Salas VM, Johnston WS, Penn AM, Buist NR, Kennaway NG",
"evidence": [
{
"database": "UniProtKB",
"id": "P00414",
"url": "https://www.uniprot.org/uniprot/P00414"
}
],
"reference": [
{
"type": "PubMed",
"id": "8630495",
"url": "https://glygen.org/publication/PubMed/8630495"
}
]
},
{
"title": "Automating the identification of DNA variations using quality-based fluorescence re-sequencing: analysis of the human mitochondrial genome.",
"journal": "Nucleic Acids Res.",
"date": "1998",
"authors": "Rieder M J, Taylor S L, Tobe V O, Nickerson D A",
"evidence": [
{
"database": "UniProtKB",
"id": "P00414",
"url": "https://www.uniprot.org/uniprot/P00414"
}
],
"reference": [
{
"type": "PubMed",
"id": "9461455",
"url": "https://glygen.org/publication/PubMed/9461455"
}
]
},
{
"title": "cDNA of eight nuclear encoded subunits of NADH:ubiquinone oxidoreductase: human complex I cDNA characterization completed.",
"journal": "Biochemical and biophysical research communications",
"date": "1998",
"authors": "Loeffen JL, Triepels RH, van den Heuvel LP, Schuelke M, Buskens CA, Smeets RJ, Trijbels JM, Smeitink JA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-611105",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105"
}
],
"reference": [
{
"type": "PubMed",
"id": "9878551",
"url": "https://glygen.org/publication/PubMed/9878551"
}
]
},
{
"title": "PA26, a novel target of the p53 tumor suppressor and member of the GADD family of DNA damage and growth arrest inducible genes.",
"journal": "Oncogene",
"date": "1999",
"authors": "Velasco-Miguel S, Buckbinder L, Jean P, Gelbert L, Talbott R, Laidlaw J, Seizinger B, Kley N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5628897",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897"
}
],
"reference": [
{
"type": "PubMed",
"id": "9926927",
"url": "https://glygen.org/publication/PubMed/9926927"
}
]
}
],
"pathway": [
{
"id": "hsa:4514",
"name": "",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:4514",
"resource": "KEGG Pathway"
},
{
"id": "R-HSA-5628897",
"name": "TP53 Regulates Metabolic Genes",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897",
"resource": "Reactome",
"description": "TP53 Regulates Metabolic Genes"
},
{
"id": "R-HSA-611105",
"name": "Respiratory electron transport",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105",
"resource": "Reactome",
"description": "Respiratory electron transport"
},
{
"id": "R-HSA-9707564",
"name": "Cytoprotection by HMOX1",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564",
"resource": "Reactome",
"description": "Cytoprotection by HMOX1"
}
],
"orthologs": [
{
"uniprot_canonical_ac": "P00416-1",
"protein_name": "Cytochrome c oxidase subunit 3",
"gene_name": "mt-Co3",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MTHQTHAYHMVNPSPWPLTGAFSALLLTSGLVMWFHYNSITLLTLGLLTNILTMYQWWRDVIREGTYQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWAFYHSSLVPTHDLGGCWPPTGISPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGKRNHMNQALLITIMLGLYFTILQASEYFETSFSISDGIYGSTFFMATGFHGLHVIIGSTFLIVCLLRQLKFHFTSKHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS",
"length": 261
},
"evidence": [
{
"id": "45917784",
"url": "http://www.informatics.jax.org/homology/45917784",
"database": "MGI"
},
{
"id": "P00414",
"url": "https://omabrowser.org/oma/group/P00414/",
"database": "OMA"
}
],
"common_name": "Mouse"
},
{
"uniprot_canonical_ac": "P00417-1",
"protein_name": "Cytochrome c oxidase subunit 3",
"gene_name": "mt:CoIII",
"tax_id": 7227,
"organism": "Drosophila melanogaster",
"sequence": {
"sequence": "MSTHSNHPFHLVDYSPWPLTGAIGAMTTVSGMVKWFHQYDISLFVLGNIITILTVYQWWRDVSREGTYQGLHTYAVTIGLRWGMILFILSEVLFFVSFFWAFFHSSLSPAIELGASWPPMGIISFNPFQIPLLNTAILLASGVTVTWAHHSLMENNHSQTTQGLFFTVLLGIYFTILQAYEYIEAPFTIADSIYGSTFFMATGFHGIHVLIGTTFLLVCLLRHLNNHFSKNHHFGFEAAAWYWHFVDVVWLFLYITIYWWGG",
"length": 262
},
"evidence": [
{
"id": "P00414",
"url": "https://omabrowser.org/oma/group/P00414/",
"database": "OMA"
}
],
"common_name": "Fruit fly"
},
{
"uniprot_canonical_ac": "P00420-1",
"protein_name": "Cytochrome c oxidase subunit 3",
"gene_name": "COX3",
"tax_id": 559292,
"organism": "Saccharomyces cerevisiae S288C",
"sequence": {
"sequence": "MTHLERSRHQQHPFHMVMPSPWPIVVSFALLSLALSTALTMHGYIGNMNMVYLALFVLLTSSILWFRDIVAEATYLGDHTMAVRKGINLGFLMFVLSEVLIFAGLFWAYFHSAMSPDVTLGACWPPVGIEAVQPTELPLLNTIILLSSGATVTYSHHALIAGNRNKALSGLLITFWLIVIFVTCQYIEYTNAAFTISDGVYGSVFYAGTGLHFLHMVMLAAMLGVNYWRMRNYHLTAGHHVGYETTIIYTHVLDVIWLFLYVVFYWWGV",
"length": 269
},
"evidence": [
{
"id": "P00414",
"url": "https://omabrowser.org/oma/group/P00414/",
"database": "OMA"
}
],
"common_name": "Yeast"
},
{
"uniprot_canonical_ac": "P05505-1",
"protein_name": "Cytochrome c oxidase subunit 3",
"gene_name": "Mtco3",
"tax_id": 10116,
"organism": "Rattus norvegicus",
"sequence": {
"sequence": "MTHQTHAYHMVNPSPWPLTGALSALLLTSGLVMWFHYNSTILLSLGLLTNILTMYQWWRDIIREGTYQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWAFYHSSLVPTHDLGGCWPPTGITPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGNRNHMNQALLITILLGLYFTILQASEYFETSFSISDGIYGSTFFMATGFHGLHVIIGSTFLIVCLLRQLKFHFTSKHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS",
"length": 261
},
"evidence": [
{
"id": "45917784",
"url": "http://www.informatics.jax.org/homology/45917784",
"database": "MGI"
},
{
"id": "P00414",
"url": "https://omabrowser.org/oma/group/P00414/",
"database": "OMA"
}
],
"common_name": "Rat"
},
{
"uniprot_canonical_ac": "Q35916-1",
"protein_name": "Cytochrome c oxidase subunit 3",
"gene_name": "MT-CO3",
"tax_id": 9823,
"organism": "Sus scrofa",
"sequence": {
"sequence": "MTHQTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMLLLSLGLLTNTLTMYQWWRDIIRESTFQGHHTSVVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSILLASGVSITWAHHSLMEGDRKHMIQALSITIALGVYFTLLQASEYYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLAVCLLRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS",
"length": 261
},
"evidence": [
{
"id": "P00414",
"url": "https://omabrowser.org/oma/group/P00414/",
"database": "OMA"
}
],
"common_name": "Pig"
}
],
"go_annotation": {
"categories": [
{
"name": "Cellular Component",
"total": 4,
"go_terms": [
{
"name": "mitochondrial inner membrane",
"id": "GO:0005743",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005743",
"evidence": [
{
"database": "UniProtKB",
"id": "P00414",
"url": "https://www.uniprot.org/uniprot/P00414"
}
],
"pmid": ""
},
{
"name": "mitochondrial membrane",
"id": "GO:0031966",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031966",
"evidence": [
{
"database": "UniProtKB",
"id": "P00414",
"url": "https://www.uniprot.org/uniprot/P00414"
}
],
"pmid": ""
},
{
"name": "respiratory chain complex IV",
"id": "GO:0045277",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045277",
"evidence": [
{
"database": "UniProtKB",
"id": "P00414",
"url": "https://www.uniprot.org/uniprot/P00414"
}
],
"pmid": ""
},
{
"name": "mitochondrial respiratory chain complex IV",
"id": "GO:0005751",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005751",
"evidence": [
{
"database": "UniProtKB",
"id": "P00414",
"url": "https://www.uniprot.org/uniprot/P00414"
}
],
"pmid": ""
}
]
},
{
"name": "Biological Process",
"total": 3,
"go_terms": [
{
"name": "mitochondrial electron transport, cytochrome c to oxygen",
"id": "GO:0006123",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006123",
"evidence": [
{
"database": "UniProtKB",
"id": "P00414",
"url": "https://www.uniprot.org/uniprot/P00414"
}
],
"pmid": ""
},
{
"name": "respiratory chain complex IV assembly",
"id": "GO:0008535",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008535",
"evidence": [
{
"database": "UniProtKB",
"id": "P00414",
"url": "https://www.uniprot.org/uniprot/P00414"
}
],
"pmid": ""
},
{
"name": "cellular respiration",
"id": "GO:0045333",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045333",
"evidence": [
{
"database": "UniProtKB",
"id": "P00414",
"url": "https://www.uniprot.org/uniprot/P00414"
}
],
"pmid": ""
}
]
},
{
"name": "Molecular Function",
"total": 1,
"go_terms": [
{
"name": "cytochrome-c oxidase activity",
"id": "GO:0004129",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004129",
"evidence": [
{
"database": "UniProtKB",
"id": "P00414",
"url": "https://www.uniprot.org/uniprot/P00414"
}
],
"pmid": ""
}
]
}
]
},
"pro_annotation": [],
"site_annotation": [
{
"start_pos": 133,
"end_pos": 135,
"annotation": "n_glycosylation_sequon"
}
],
"ptm_annotation": [],
"interactions": [],
"reactions": [
{
"id": "11436",
"name": "",
"equation": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P05505-1",
"P00406-1",
"P05503-1",
"P00395-1",
"P00414-1",
"P00403-1",
"P00416-1",
"P00397-1",
"P00405-1",
"P00401-1",
"P00410-1",
"P00420-1",
"O21049-1",
"O21042-1",
"P20609-1",
"P20610-1",
"P30815-1",
"P00417-1",
"P00408-1",
"P00399-1"
],
"evidence": [
{
"id": "11436",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/11436"
}
]
},
{
"id": "R-HSA-163214",
"name": "Electron transfer from reduced cytochrome c to molecular oxygen",
"equation": "",
"summary": "Complex IV (COX, cytochrome c oxidase) contains the hemeprotein cytochrome a and a3. It also contains copper atoms which undergo a transition from Cu+ to Cu2+ during the transfer of electrons through the complex to molecular oxygen. A bimetallic centre containing a copper atom and a heme-linked iron protein binds oxygen after 4 electrons have been picked up. Water, the final product of oxygen reduction, is then released. Oxygen is the final electron acceptor in the respiratory chain. The overall reaction can be summed as
4Cyt c (red.) + 12H+ (in) + O2 = 4Cyt c (ox.) + 2H2O + 8H+ (out)
Four protons are taken up from the matrix side of the membrane to form the water (scalar protons). Wikstrom (1977) suggests 4 protons are additionally transferred out from the matrix to the intermembrane space.
COX ancillary proteins mediate membrane insertion, catalytic core processing, copper transport and insertion into core subunits and heme A biosynthesis (Stilburek et al. 2006, Fontanesi et al. 2006, Soto et al. 2012). To date, all Mendelian disorders presenting COX deficiency have been assigned to mutations in ancillary factors, with the exception of an infantile encephalomyopathy caused by a defective COX6B1 and an exocrine pancreatic insufficiency caused by a defective COX4I2 gene (Soto et al. 2012). Balsa et al have shown that NDUFA4, formerly considered to be a constituent of NADH dehydrogenase (Complex I), is instead a component of the cytochrome c oxidase (CIV) (Balsa et al. 2012). Patients with NDUFA4 mutations display COX deficiencies (Pitceathly et al. 2013).
Carbon monoxide (CO) readily inhibits oxygen consumption by mitochondrial cytochrome oxidase. This inhibition is responsible for much of its toxicity when it is applied externally to the body. However, CO has been implicated in normal cellular signalling, especially in anti-inflammatory effects. The addition of antioxidants or inhibition of complex III of the electron transport chain by antimycin A attenuates the inhibitory effects of CO on lipopolysaccharide (LPS)-induced NLRP3 formation and TNF-alpha secretion, and blocked CO-induced p38 MAPK phosphorylation. These effects may be mediated via inhibition of cytochrome c oxidase and its generation of mitochondrial reactive oxygen species (Alonso et al, 2003; Zuckerbraun et al, 2007; Cooper and Brown, 2008; Jung et al, 2014; Ishigami et al, 2017).",
"cellular_location": "mitochondrial inner membrane, mitochondrial intermembrane space, mitochondrial matrix",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00395-1",
"P00414-1",
"P00403-1"
],
"evidence": [
{
"id": "R-HSA-163214",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-163214"
}
]
},
{
"id": "R-HSA-9709406",
"name": "CO binds to Cytochrome c oxidase",
"equation": "",
"summary": "Carbon monoxide (CO) toxicity is the result of a combination of tissue hypoxia and direct CO-mediated damage at a cellular level, since not all the signs and symptoms presented can be explained only by the formation of carboxyhaemoglobin. CO binds to cytochrome c oxidase, the terminal enzyme in the electron transfer chain, reducing its activity. Regulation of reactive oxygen species (ROS) generation is possibly one of the key components in CO signaling and its interaction with mitochondria but also other heme proteins that generate ROS, such as NADPH oxidase (Alonso et al, 2003; Zuckerbraun et al, 2007; Ishigami et al, 2017; Motterlini and Foresti, 2017).",
"cellular_location": "mitochondrial inner membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00395-1",
"P00414-1",
"P00403-1"
],
"evidence": [
{
"id": "R-HSA-9709406",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9709406"
}
]
}
],
"reaction_participants": [],
"reaction_enzymes": [
{
"uniprot_ac": "O21042",
"gene_name": "2",
"activity": [
{
"ec_number": "7.1.1.9",
"activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.",
"evidence": [
{
"id": "O21042",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O21042"
}
]
},
{
"ec_number": "7.1.1.9",
"activity": "",
"evidence": [
{
"id": "O21042",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O21042"
}
]
}
]
},
{
"uniprot_ac": "O21049",
"gene_name": "cox3",
"activity": [
{
"ec_number": "7.1.1.9",
"activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.",
"evidence": [
{
"id": "O21049",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O21049"
}
]
},
{
"ec_number": "7.1.1.9",
"activity": "",
"evidence": [
{
"id": "O21049",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O21049"
}
]
}
]
},
{
"uniprot_ac": "P00395",
"gene_name": "MT-CO1",
"activity": [
{
"ec_number": "7.1.1.9",
"activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.",
"evidence": [
{
"id": "P00395",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00395"
}
]
},
{
"ec_number": "7.1.1.9",
"activity": "",
"evidence": [
{
"id": "P00395",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00395"
}
]
}
]
},
{
"uniprot_ac": "P00397",
"gene_name": "Mtco1",
"activity": [
{
"ec_number": "7.1.1.9",
"activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.",
"evidence": [
{
"id": "P00397",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00397"
}
]
},
{
"ec_number": "7.1.1.9",
"activity": "",
"evidence": [
{
"id": "P00397",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00397"
}
]
}
]
},
{
"uniprot_ac": "P00399",
"gene_name": "mt:CoI",
"activity": [
{
"ec_number": "7.1.1.9",
"activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.",
"evidence": [
{
"id": "P00399",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00399"
}
]
},
{
"ec_number": "7.1.1.9",
"activity": "",
"evidence": [
{
"id": "P00399",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00399"
}
]
}
]
},
{
"uniprot_ac": "P00401",
"gene_name": "COX1",
"activity": [
{
"ec_number": "7.1.1.9",
"activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.",
"evidence": [
{
"id": "P00401",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00401"
}
]
},
{
"ec_number": "7.1.1.9",
"activity": "",
"evidence": [
{
"id": "P00401",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00401"
}
]
}
]
},
{
"uniprot_ac": "P00403",
"gene_name": "MT-CO2",
"activity": [
{
"ec_number": "7.1.1.9",
"activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.",
"evidence": [
{
"id": "P00403",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00403"
}
]
},
{
"ec_number": "7.1.1.9",
"activity": "",
"evidence": [
{
"id": "P00403",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00403"
}
]
}
]
},
{
"uniprot_ac": "P00405",
"gene_name": "Mtco2",
"activity": [
{
"ec_number": "7.1.1.9",
"activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.",
"evidence": [
{
"id": "P00405",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00405"
}
]
},
{
"ec_number": "7.1.1.9",
"activity": "",
"evidence": [
{
"id": "P00405",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00405"
}
]
}
]
},
{
"uniprot_ac": "P00406",
"gene_name": "Mtco2",
"activity": [
{
"ec_number": "7.1.1.9",
"activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.",
"evidence": [
{
"id": "P00406",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00406"
}
]
},
{
"ec_number": "7.1.1.9",
"activity": "",
"evidence": [
{
"id": "P00406",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00406"
}
]
}
]
},
{
"uniprot_ac": "P00408",
"gene_name": "mt:CoII",
"activity": [
{
"ec_number": "7.1.1.9",
"activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.",
"evidence": [
{
"id": "P00408",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00408"
}
]
},
{
"ec_number": "7.1.1.9",
"activity": "",
"evidence": [
{
"id": "P00408",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00408"
}
]
}
]
},
{
"uniprot_ac": "P00410",
"gene_name": "COX2",
"activity": [
{
"ec_number": "7.1.1.9",
"activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.",
"evidence": [
{
"id": "P00410",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00410"
}
]
},
{
"ec_number": "7.1.1.9",
"activity": "",
"evidence": [
{
"id": "P00410",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00410"
}
]
}
]
},
{
"uniprot_ac": "P00414",
"gene_name": "MT-CO3",
"activity": [
{
"ec_number": "7.1.1.9",
"activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.",
"evidence": [
{
"id": "P00414",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00414"
}
]
},
{
"ec_number": "7.1.1.9",
"activity": "",
"evidence": [
{
"id": "P00414",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00414"
}
]
}
]
},
{
"uniprot_ac": "P00416",
"gene_name": "mt-Co3",
"activity": [
{
"ec_number": "7.1.1.9",
"activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.",
"evidence": [
{
"id": "P00416",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00416"
}
]
},
{
"ec_number": "7.1.1.9",
"activity": "",
"evidence": [
{
"id": "P00416",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00416"
}
]
}
]
},
{
"uniprot_ac": "P00417",
"gene_name": "mt:CoIII",
"activity": [
{
"ec_number": "7.1.1.9",
"activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.",
"evidence": [
{
"id": "P00417",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00417"
}
]
},
{
"ec_number": "7.1.1.9",
"activity": "",
"evidence": [
{
"id": "P00417",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00417"
}
]
}
]
},
{
"uniprot_ac": "P00420",
"gene_name": "COX3",
"activity": [
{
"ec_number": "7.1.1.9",
"activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.",
"evidence": [
{
"id": "P00420",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00420"
}
]
},
{
"ec_number": "7.1.1.9",
"activity": "",
"evidence": [
{
"id": "P00420",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00420"
}
]
}
]
},
{
"uniprot_ac": "P05503",
"gene_name": "Mtco1",
"activity": [
{
"ec_number": "7.1.1.9",
"activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.",
"evidence": [
{
"id": "P05503",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P05503"
}
]
},
{
"ec_number": "7.1.1.9",
"activity": "",
"evidence": [
{
"id": "P05503",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P05503"
}
]
}
]
},
{
"uniprot_ac": "P05505",
"gene_name": "Mtco3",
"activity": [
{
"ec_number": "7.1.1.9",
"activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.",
"evidence": [
{
"id": "P05505",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P05505"
}
]
},
{
"ec_number": "7.1.1.9",
"activity": "",
"evidence": [
{
"id": "P05505",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P05505"
}
]
}
]
},
{
"uniprot_ac": "P20609",
"gene_name": "cxgE",
"activity": [
{
"ec_number": "7.1.1.9",
"activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.",
"evidence": [
{
"id": "P20609",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20609"
}
]
},
{
"ec_number": "7.1.1.9",
"activity": "",
"evidence": [
{
"id": "P20609",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20609"
}
]
}
]
},
{
"uniprot_ac": "P20610",
"gene_name": "cxgS",
"activity": [
{
"ec_number": "7.1.1.9",
"activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.",
"evidence": [
{
"id": "P20610",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20610"
}
]
},
{
"ec_number": "7.1.1.9",
"activity": "",
"evidence": [
{
"id": "P20610",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20610"
}
]
}
]
},
{
"uniprot_ac": "P30815",
"gene_name": "cxdA",
"activity": [
{
"ec_number": "7.1.1.9",
"activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.",
"evidence": [
{
"id": "P30815",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P30815"
}
]
},
{
"ec_number": "7.1.1.9",
"activity": "",
"evidence": [
{
"id": "P30815",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P30815"
}
]
}
]
}
],
"biomarkers": [],
"synthesized_glycans": [],
"cluster_types": [
{
"name": "homologset.mgi",
"label": "MGI Homologs"
},
{
"name": "homologset.oma",
"label": "OMA Homologs"
}
],
"sequence_features": {
"n_linked_sites": [],
"o_linked_sites": [],
"snv_sites": [],
"glycation_sites": [],
"phosphorylation_sites": [],
"sequon_annotation_sites": [
{
"start_pos": 133,
"end_pos": 135
}
]
},
"section_stats": [
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv_disease",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv_non_disease",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "publication",
"table_stats": [
{
"field": "total",
"count": 98
}
],
"sort_fields": [
"title",
"journal",
"date",
"authors"
]
}
]
}