{ "uniprot_canonical_ac": "P00326-1", "uniprot_ac": "P00326", "uniprot_id": "ADH1G_HUMAN", "mass": { "chemical_mass": 39868.0, "monoisotopic_mass": 39868.0 }, "refseq": { "ac": "NP_000660", "name": "alcohol dehydrogenase 1C", "summary": "This gene encodes class I alcohol dehydrogenase, gamma subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class I alcohol dehydrogenase, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation to acetaldehyde, thus playing a major role in ethanol catabolism. Three genes encoding alpha, beta and gamma subunits are tandemly organized in a genomic segment as a gene cluster. An association between ADH1C polymorphism and alcohol dependence has not been established. [provided by RefSeq, Sep 2019].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000660" }, "gene_names": [ { "name": "ADH1C", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P00326", "id": "P00326" }, { "name": "ADH1C", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000660", "id": "NP_000660" }, { "name": "ADH3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000660", "id": "NP_000660" }, { "name": "ADH3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P00326", "id": "P00326" } ], "protein_names": [ { "name": "Alcohol dehydrogenase 1C", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P00326" }, { "name": "1.1.1.1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P00326" }, { "name": "ADH, gamma subunit; alcohol dehydrogenase 3 (class I), gamma polypeptide; aldehyde reductase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000660", "id": "NP_000660" }, { "name": "Alcohol dehydrogenase subunit gamma", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P00326" }, { "name": "alcohol dehydrogenase 1C", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000660", "id": "NP_000660" } ], "function": [ { "annotation": "ADH1B, ADH1B/C and CYP2E1 Gene Polymorphism and the Risk of Fetal Alcohol Spectrum Disorder. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000660", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000660" }, { "database": "PubMed", "id": "37510297", "url": "https://glygen.org/publication/PubMed/37510297" } ] }, { "annotation": "Alcohol dehydrogenase. Exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism.", "evidence": [ { "database": "UniProtKB", "id": "P00326", "url": "https://www.uniprot.org/uniprot/P00326#function" }, { "database": "PubMed", "id": "6391957", "url": "https://glygen.org/publication/PubMed/6391957" } ] }, { "annotation": "Association of ADH1B rs1229984, ADH1C rs698, and ALDH2 rs671 with Alcohol abuse and Alcoholic Cirrhosis in People Living in Northeast Vietnam. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000660", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000660" }, { "database": "PubMed", "id": "37378938", "url": "https://glygen.org/publication/PubMed/37378938" } ] }, { "annotation": "INVESTIGATION OF ALCOHOL DEHYDROGENASE (ADH3) GENE POLYMOPHISM IN PATIENTS WITH CHRONIC ALCOHOLIC PANCRATITIS IN AZERBAIJAN POPULATION.", "evidence": [ { "database": "RefSeq", "id": "NP_000660", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000660" }, { "database": "PubMed", "id": "36701787", "url": "https://glygen.org/publication/PubMed/36701787" } ] }, { "annotation": "Single Nucleotide Polymorphisms of ADH1B, ADH1C and ALDH2 Genes in 235 People Living in Thai Nguyen Province of Vietnam. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000660", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000660" }, { "database": "PubMed", "id": "36580007", "url": "https://glygen.org/publication/PubMed/36580007" } ] }, { "annotation": "This gene encodes class I alcohol dehydrogenase, gamma subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class I alcohol dehydrogenase, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation to acetaldehyde, thus playing a major role in ethanol catabolism. Three genes encoding alpha, beta and gamma subunits are tandemly organized in a genomic segment as a gene cluster. An association between ADH1C polymorphism and alcohol dependence has not been established. [provided by RefSeq, Sep 2019].", "evidence": [ { "database": "RefSeq", "id": "NP_000660", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000660" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "69.3", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000248144", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000248144" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "98.97", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000248144", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000248144" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "97.98", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000248144", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000248144" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "98.19", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000248144", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000248144" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "76.16", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000248144", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000248144" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "68.57", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000248144", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000248144" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "96.22", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000248144", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000248144" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "77.08", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000248144", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000248144" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "87.58", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000248144", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000248144" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P00326", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00326" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P00326", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00326" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P00326", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00326" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P00326", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00326" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P00326", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00326" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P00326", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00326" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P00326", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00326" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P00326", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00326" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P00326", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00326" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P00326", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00326" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P00326", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00326" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P00326", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00326" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00326", "url": "https://www.uniprot.org/uniprot/P00326" } ], "common_name": "Human" } ], "gene": [ { "name": "ADH1C", "url": "https://www.uniprot.org/uniprot/P00326", "locus": { "chromosome": "4", "start_pos": 99336497, "end_pos": 99352746, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000248144", "url": "https://www.ensembl.org/id/ENSG00000248144" } ] } } ], "crossref": [ { "id": "ENSG00000248144", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000248144", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "1.1.1.1", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=1.1.1.1&UniProtAcc=P00326", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd08299", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd08299", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL3285", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3285", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "ADH1C", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=ADH1C", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "126", "url": "https://www.ncbi.nlm.nih.gov/gene/126", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "251", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=251", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P00326", "url": "https://www.ebi.ac.uk/intact/interactors/id:P00326*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002328", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002328", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011032", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011032", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013149", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013149", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013154", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013154", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020843", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020843", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036291", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036291", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:126", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:126", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "103730", "url": "http://www.omim.org/entry/103730", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P00326", "url": "https://www.nextprot.org/entry/NX_P00326", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P00326", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P00326", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "RVKMIAT", "url": "https://omabrowser.org/oma/group/RVKMIAT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1077476at2759", "url": "http://www.orthodb.org/?query=1077476at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR43880", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43880", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR43880:SF57", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43880:SF57", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1HT0", "url": "https://www.rcsb.org/structure/1HT0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1U3W", "url": "https://www.rcsb.org/structure/1U3W", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00107", "url": "http://pfam.xfam.org/family/PF00107", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF08240", "url": "http://pfam.xfam.org/family/PF08240", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P00326", "url": "https://pharos.nih.gov/targets/P00326", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P00326", "url": "http://purl.obolibrary.org/obo/PR_P00326", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-5365859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-71384", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71384", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_000660", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000660", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "10736", "url": "https://www.rhea-db.org/rhea/10736", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "25290", "url": "https://www.rhea-db.org/rhea/25290", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A087WU81", "url": "https://www.uniprot.org/uniprot/A0A087WU81", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WU81-1", "url": "https://www.uniprot.org/uniprot/A0A087WU81-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WUC4", "url": "https://www.uniprot.org/uniprot/A0A087WUC4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WUC4-1", "url": "https://www.uniprot.org/uniprot/A0A087WUC4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P00326", "url": "https://www.uniprot.org/uniprot/P00326", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P00326-1", "url": "https://www.uniprot.org/uniprot/P00326-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDEHVVSGNLVTPLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRICKNPESNYCLKNDLGNPRGTLQDGTRRFTCSGKPIHHFVGVSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTPGSTCAVFGLGGVGLSVVMGCKAAGAARIIAVDINKDKFAKAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQNLSINPMLLLTGRTWKGAIFGGFKSKESVPKLVADFMAKKFSLDALITNILPFEKINEGFDLLRSGKSIRTVLTF", "length": 375, "header": "sp|P00326-1|ADH1G_HUMAN Isoform 1 of Alcohol dehydrogenase 1C OS=Homo sapiens OX=9606 GN=ADH1C PE=1 SV=2 CANONICAL=P00326-1" }, "isoforms": [ { "isoform_ac": "A0A087WU81-1", "url": "", "sequence": { "sequence": "MVAAGICRSDEHVVSGNLVTPLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRICKNPESNYCLKNDLGNPRGTLQDGTRRFTCSGKPIHHFVGVSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTPGSTCAVFGLGGVGLSVVMGCKAAGAARIIAVDINKDKFAK", "length": 192, "header": "tr|A0A087WU81-1|ADH1G_HUMAN Computationally mapped isoform of Alcohol dehydrogenase 1C OS=Homo sapiens OX=9606 GN=ADH1C PE=1 SV=1 CANONICAL=P00326-1" }, "locus": { "chromosome": "4", "start_pos": 99347144, "end_pos": 99342927, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000510055.5", "url": "https://www.ensembl.org/id/ENST00000510055.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000478439.1", "url": "https://www.ensembl.org/id/ENSP00000478439.1" } ] } }, { "isoform_ac": "A0A087WUC4-1", "url": "", "sequence": { "sequence": "MSTAGKMVAAGICRSDEHVVSGNLVTPLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRICKNPESNYCLKNDLGNPRGTLQDGTRRFTCSGKPIHHFVGVSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTPGSTCAVFGLGGV", "length": 170, "header": "tr|A0A087WUC4-1|ADH1G_HUMAN Computationally mapped isoform of Alcohol dehydrogenase 1C OS=Homo sapiens OX=9606 GN=ADH1C PE=1 SV=1 CANONICAL=P00326-1" }, "locus": { "chromosome": "4", "start_pos": 99352675, "end_pos": 99343011, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000511397.3", "url": "https://www.ensembl.org/id/ENST00000511397.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000478545.1", "url": "https://www.ensembl.org/id/ENSP00000478545.1" } ] } }, { "isoform_ac": "P00326-1", "url": "", "sequence": { "sequence": "MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDEHVVSGNLVTPLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRICKNPESNYCLKNDLGNPRGTLQDGTRRFTCSGKPIHHFVGVSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTPGSTCAVFGLGGVGLSVVMGCKAAGAARIIAVDINKDKFAKAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQNLSINPMLLLTGRTWKGAIFGGFKSKESVPKLVADFMAKKFSLDALITNILPFEKINEGFDLLRSGKSIRTVLTF", "length": 375, "header": "sp|P00326-1|ADH1G_HUMAN Isoform 1 of Alcohol dehydrogenase 1C OS=Homo sapiens OX=9606 GN=ADH1C PE=1 SV=2 CANONICAL=P00326-1" }, "locus": { "chromosome": "4", "start_pos": 99352675, "end_pos": 99336755, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000515683.6", "url": "https://www.ensembl.org/id/ENST00000515683.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000426083.1", "url": "https://www.ensembl.org/id/ENSP00000426083.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P00326", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P00326" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" } ] } ], "phosphorylation": [ { "start_pos": 23, "end_pos": 23, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P00326", "url": "https://www.uniprot.org/uniprot/P00326" } ], "site_lbl": "Ser23" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Cloning and characterization of retinol dehydrogenase transcripts expressed in human epidermal keratinocytes.", "journal": "Molecular genetics and metabolism", "date": "1999", "authors": "Jurukovski V, Markova NG, Karaman-Jurukovska N, Randolph RK, Su J, Napoli JL, Simon M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5365859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859" } ], "reference": [ { "type": "PubMed", "id": "10329026", "url": "https://glygen.org/publication/PubMed/10329026" } ] }, { "title": "Mutations in the gene encoding 11-cis retinol dehydrogenase cause delayed dark adaptation and fundus albipunctatus.", "journal": "Nature genetics", "date": "1999", "authors": "Yamamoto H, Simon A, Eriksson U, Harris E, Berson EL, Dryja TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5365859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859" } ], "reference": [ { "type": "PubMed", "id": "10369264", "url": "https://glygen.org/publication/PubMed/10369264" } ] }, { "title": "Interaction between the functional polymorphisms of the alcohol-metabolism genes in protection against alcoholism.", "journal": "American journal of human genetics", "date": "1999", "authors": "Chen CC, Lu RB, Chen YC, Wang MF, Chang YC, Li TK, Yin SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-71384", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71384" } ], "reference": [ { "type": "PubMed", "id": "10441588", "url": "https://glygen.org/publication/PubMed/10441588" } ] }, { "title": "Human liver mitochondrial aldehyde dehydrogenase: three-dimensional structure and the restoration of solubility and activity of chimeric forms.", "journal": "Protein science : a publication of the Protein Society", "date": "1999", "authors": "Ni L, Zhou J, Hurley TD, Weiner H", "evidence": [ { "database": "Reactome", "id": "R-HSA-71384", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71384" } ], "reference": [ { "type": "PubMed", "id": "10631996", "url": "https://glygen.org/publication/PubMed/10631996" } ] }, { "title": "Regulation of the mammalian alcohol dehydrogenase genes.", "journal": "Progress in nucleic acid research and molecular biology", "date": "2000", "authors": "Edenberg HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-71384", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71384" } ], "reference": [ { "type": "PubMed", "id": "10697413", "url": "https://glygen.org/publication/PubMed/10697413" } ] }, { "title": "Retinoid-binding proteins: mediators of retinoid action.", "journal": "The Biochemical journal", "date": "2000", "authors": "Noy N", "evidence": [ { "database": "Reactome", "id": "R-HSA-5365859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859" } ], "reference": [ { "type": "PubMed", "id": "10839978", "url": "https://glygen.org/publication/PubMed/10839978" } ] }, { "title": "Molecular characterization of human acetyl-CoA synthetase, an enzyme regulated by sterol regulatory element-binding proteins.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Luong A, Hannah VC, Brown MS, Goldstein JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-71384", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71384" } ], "reference": [ { "type": "PubMed", "id": "10843999", "url": "https://glygen.org/publication/PubMed/10843999" } ] }, { "title": "cDNA cloning and expression of a human aldehyde dehydrogenase (ALDH) active with 9-cis-retinal and identification of a rat ortholog, ALDH12.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Lin M, Napoli JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5365859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859" } ], "reference": [ { "type": "PubMed", "id": "11007799", "url": "https://glygen.org/publication/PubMed/11007799" } ] }, { "title": "Prostate short-chain dehydrogenase reductase 1 (PSDR1): a new member of the short-chain steroid dehydrogenase/reductase family highly expressed in normal and neoplastic prostate epithelium.", "journal": "Cancer research", "date": "2001", "authors": "Lin B, White JT, Ferguson C, Wang S, Vessella R, Bumgarner R, True LD, Hood L, Nelson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5365859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859" } ], "reference": [ { "type": "PubMed", "id": "11245473", "url": "https://glygen.org/publication/PubMed/11245473" } ] }, { "title": "Three-dimensional structures of the three human class I alcohol dehydrogenases.", "journal": "Protein Sci.", "date": "2001", "authors": "Niederhut MS, Gibbons BJ, Perez-Miller S, Hurley TD", "evidence": [ { "database": "UniProtKB", "id": "P00326", "url": "https://www.uniprot.org/uniprot/P00326" } ], "reference": [ { "type": "PubMed", "id": "11274460", "url": "https://glygen.org/publication/PubMed/11274460" } ] }, { "title": "Evidence that the human gene for prostate short-chain dehydrogenase/reductase (PSDR1) encodes a novel retinal reductase (RalR1).", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Kedishvili NY, Chumakova OV, Chetyrkin SV, Belyaeva OV, Lapshina EA, Lin DW, Matsumura M, Nelson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5365859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859" } ], "reference": [ { "type": "PubMed", "id": "12036956", "url": "https://glygen.org/publication/PubMed/12036956" } ] }, { "title": "Dual-substrate specificity short chain retinol dehydrogenases from the vertebrate retina.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Haeseleer F, Jang GF, Imanishi Y, Driessen CAGG, Matsumura M, Nelson PS, Palczewski K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5365859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859" } ], "reference": [ { "type": "PubMed", "id": "12226107", "url": "https://glygen.org/publication/PubMed/12226107" } ] }, { "title": "Reduction of all-trans-retinal in the mouse liver peroxisome fraction by the short-chain dehydrogenase/reductase RRD: induction by the PPAR alpha ligand clofibrate.", "journal": "Biochemistry", "date": "2003", "authors": "Lei Z, Chen W, Zhang M, Napoli JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5365859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859" } ], "reference": [ { "type": "PubMed", "id": "12680773", "url": "https://glygen.org/publication/PubMed/12680773" } ] }, { "title": "A novel human cytochrome P450, CYP26C1, involved in metabolism of 9-cis and all-trans isomers of retinoic acid.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Taimi M, Helvig C, Wisniewski J, Ramshaw H, White J, Amad M, Korczak B, Petkovich M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5365859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859" } ], "reference": [ { "type": "PubMed", "id": "14532297", "url": "https://glygen.org/publication/PubMed/14532297" } ] }, { "title": "Genomic organization and transcription of the human retinol dehydrogenase 10 (RDH10) gene.", "journal": "FEBS letters", "date": "2003", "authors": "Picozzi P, Marozzi A, Fornasari D, Benfante R, Barisani D, Meneveri R, Ginelli E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5365859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859" } ], "reference": [ { "type": "PubMed", "id": "14596915", "url": "https://glygen.org/publication/PubMed/14596915" } ] }, { "title": "Molecular structure of the human alcohol dehydrogenase 3 gene.", "journal": "Jpn. J. Genet.", "date": "1992", "authors": "Yokoyama S, Matsuo Y, Rajasekharan S, Yokoyama R", "evidence": [ { "database": "UniProtKB", "id": "P00326", "url": "https://www.uniprot.org/uniprot/P00326" } ], "reference": [ { "type": "PubMed", "id": "1524834", "url": "https://glygen.org/publication/PubMed/1524834" } ] }, { "title": "Structure of three class I human alcohol dehydrogenases complexed with isoenzyme specific formamide inhibitors.", "journal": "Biochemistry", "date": "2004", "authors": "Gibbons BJ, Hurley TD", "evidence": [ { "database": "UniProtKB", "id": "P00326", "url": "https://www.uniprot.org/uniprot/P00326" } ], "reference": [ { "type": "PubMed", "id": "15449945", "url": "https://glygen.org/publication/PubMed/15449945" } ] }, { "title": "Reversible lysine acetylation controls the activity of the mitochondrial enzyme acetyl-CoA synthetase 2.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Schwer B, Bunkenborg J, Verdin RO, Andersen JS, Verdin E", "evidence": [ { "database": "Reactome", "id": "R-HSA-71384", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71384" } ], "reference": [ { "type": "PubMed", "id": "16788062", "url": "https://glygen.org/publication/PubMed/16788062" } ] }, { "title": "Enzymatic properties of the protein encoded by newly cloned human alcohol dehydrogenase ADH6 gene.", "journal": "Biochemical and biophysical research communications", "date": "1991", "authors": "Chen CS, Yoshida A", "evidence": [ { "database": "Reactome", "id": "R-HSA-71384", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71384" } ], "reference": [ { "type": "PubMed", "id": "1755855", "url": "https://glygen.org/publication/PubMed/1755855" } ] }, { "title": "Human retinol dehydrogenase 13 (RDH13) is a mitochondrial short-chain dehydrogenase/reductase with a retinaldehyde reductase activity.", "journal": "The FEBS journal", "date": "2008", "authors": "Belyaeva OV, Korkina OV, Stetsenko AV, Kedishvili NY", "evidence": [ { "database": "Reactome", "id": "R-HSA-5365859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859" } ], "reference": [ { "type": "PubMed", "id": "18039331", "url": "https://glygen.org/publication/PubMed/18039331" } ] }, { "title": "Two aldehyde dehydrogenases from human liver. Isolation via affinity chromatography and characterization of the isozymes.", "journal": "Biochimica et biophysica acta", "date": "1977", "authors": "Greenfield NJ, Pietruszko R", "evidence": [ { "database": "Reactome", "id": "R-HSA-71384", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71384" } ], "reference": [ { "type": "PubMed", "id": "18196", "url": "https://glygen.org/publication/PubMed/18196" } ] }, { "title": "Retinoic acid synthesis and signaling during early organogenesis.", "journal": "Cell", "date": "2008", "authors": "Duester G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5365859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859" } ], "reference": [ { "type": "PubMed", "id": "18805086", "url": "https://glygen.org/publication/PubMed/18805086" } ] }, { "title": "Cloning and characterization of the human ADH4 gene.", "journal": "Gene", "date": "1991", "authors": "von Bahr-Lindstrom H, Jornvall H, Hoog JO", "evidence": [ { "database": "Reactome", "id": "R-HSA-5365859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859" } ], "reference": [ { "type": "PubMed", "id": "1889753", "url": "https://glygen.org/publication/PubMed/1889753" } ] }, { "title": "Impact of alcohol consumption with polymorphisms in alcohol-metabolizing enzymes on pancreatic cancer risk in Japanese.", "journal": "Cancer science", "date": "2009", "authors": "Kanda J, Matsuo K, Suzuki T, Kawase T, Hiraki A, Watanabe M, Mizuno N, Sawaki A, Yamao K, Tajima K, Tanaka H", "evidence": [ { "database": "Entrez", "id": "126", "url": "https://www.ncbi.nlm.nih.gov/gene/126" } ], "reference": [ { "type": "PubMed", "id": "19068087", "url": "https://glygen.org/publication/PubMed/19068087" } ] }, { "title": "Purification and characterization of a new alcohol dehydrogenase from human stomach.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Moreno A, Pares X", "evidence": [ { "database": "Reactome", "id": "R-HSA-71384", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71384" } ], "reference": [ { "type": "PubMed", "id": "1985938", "url": "https://glygen.org/publication/PubMed/1985938" } ] }, { "title": "Aldehyde dehydrogenase 1B1: molecular cloning and characterization of a novel mitochondrial acetaldehyde-metabolizing enzyme.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2010", "authors": "Stagos D, Chen Y, Brocker C, Donald E, Jackson BC, Orlicky DJ, Thompson DC, Vasiliou V", "evidence": [ { "database": "Reactome", "id": "R-HSA-71384", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71384" } ], "reference": [ { "type": "PubMed", "id": "20616185", "url": "https://glygen.org/publication/PubMed/20616185" } ] }, { "title": "Retinol dehydrogenases (RDHs) in the visual cycle.", "journal": "Experimental eye research", "date": "2010", "authors": "Parker RO, Crouch RK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5365859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859" } ], "reference": [ { "type": "PubMed", "id": "20801113", "url": "https://glygen.org/publication/PubMed/20801113" } ] }, { "title": "Cytochrome P450s in the regulation of cellular retinoic acid metabolism.", "journal": "Annual review of nutrition", "date": "2011", "authors": "Ross AC, Zolfaghari R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5365859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859" } ], "reference": [ { "type": "PubMed", "id": "21529158", "url": "https://glygen.org/publication/PubMed/21529158" } ] }, { "title": "Physiological insights into all-trans-retinoic acid biosynthesis.", "journal": "Biochimica et biophysica acta", "date": "2012", "authors": "Napoli JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5365859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859" } ], "reference": [ { "type": "PubMed", "id": "21621639", "url": "https://glygen.org/publication/PubMed/21621639" } ] }, { "title": "Retinaldehyde is a substrate for human aldo-keto reductases of the 1C subfamily.", "journal": "The Biochemical journal", "date": "2011", "authors": "Ruiz FX, Porte S, Gallego O, Moro A, Ardevol A, Del Rio-Espinola A, Rovira C, Farres J, Pares X", "evidence": [ { "database": "Reactome", "id": "R-HSA-5365859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859" } ], "reference": [ { "type": "PubMed", "id": "21851338", "url": "https://glygen.org/publication/PubMed/21851338" } ] }, { "title": "Craniosynostosis and multiple skeletal anomalies in humans and zebrafish result from a defect in the localized degradation of retinoic acid.", "journal": "American journal of human genetics", "date": "2011", "authors": "Laue K, Pogoda HM, Daniel PB, van Haeringen A, Alanay Y, von Ameln S, Rachwalski M, Morgan T, Gray MJ, Breuning MH, Sawyer GM, Sutherland-Smith AJ, Nikkels PG, Kubisch C, Bloch W, Wollnik B, Hammerschmidt M, Robertson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5365859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859" } ], "reference": [ { "type": "PubMed", "id": "22019272", "url": "https://glygen.org/publication/PubMed/22019272" } ] }, { "title": "Purification and partial characterization of aldehyde dehydrogenase from human erythrocytes.", "journal": "Biochimica et biophysica acta", "date": "1979", "authors": "Inoue K, Nishimukai H, Yamasawa K", "evidence": [ { "database": "Reactome", "id": "R-HSA-71384", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71384" } ], "reference": [ { "type": "PubMed", "id": "224930", "url": "https://glygen.org/publication/PubMed/224930" } ] }, { "title": "Sequence Variants and the Risk of Head and Neck Cancer: Pooled Analysis in the INHANCE Consortium.", "journal": "Frontiers in oncology", "date": "2011", "authors": "Chuang SC, Agudo A, Ahrens W, Anantharaman D, Benhamou S, Boccia S, Chen C, Conway DI, Fabianova E, Hayes RB, Healy CM, Holcatova I, Kjaerheim K, Lagiou P, Lazarus P, Macfarlane TV, Mahimkar MB, Mates D, Matsuo K, Merletti F, Metspalu A, Morgenstern H, Muscat J, Cadoni G, Olshan AF, Purdue M, Ramroth H, Rudnai P, Schwartz SM, Simonato L, Smith EM, Sturgis EM, Szeszenia-Dabrowska N, Talamini R, Thomson P, Wei Q, Zaridze D, Zhang ZF, Znaor A, Brennan P, Boffetta P, Hashibe M", "evidence": [ { "database": "Entrez", "id": "126", "url": "https://www.ncbi.nlm.nih.gov/gene/126" } ], "reference": [ { "type": "PubMed", "id": "22655231", "url": "https://glygen.org/publication/PubMed/22655231" } ] }, { "title": "Retinoic acid biosynthesis catalyzed by retinal dehydrogenases relies on a rate-limiting conformational transition associated with substrate recognition.", "journal": "Chemico-biological interactions", "date": "2013", "authors": "Bchini R, Vasiliou V, Branlant G, Talfournier F, Rahuel-Clermont S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5365859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859" } ], "reference": [ { "type": "PubMed", "id": "23220587", "url": "https://glygen.org/publication/PubMed/23220587" } ] }, { "title": "Isolation of pi-alcohol dehydrogenase of human liver: is it a determinant of alcoholism?", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1977", "authors": "Li TK, Bosron WF, Dafeldecker WP, Lange LG, Vallee BL", "evidence": [ { "database": "Reactome", "id": "R-HSA-71384", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71384" } ], "reference": [ { "type": "PubMed", "id": "270680", "url": "https://glygen.org/publication/PubMed/270680" } ] }, { "title": "Three human alcohol dehydrogenase subunits: cDNA structure and molecular and evolutionary divergence.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1986", "authors": "Ikuta T, Szeto S, Yoshida A", "evidence": [ { "database": "UniProtKB", "id": "P00326", "url": "https://www.uniprot.org/uniprot/P00326" }, { "database": "Reactome", "id": "R-HSA-5365859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859" } ], "reference": [ { "type": "PubMed", "id": "2935875", "url": "https://glygen.org/publication/PubMed/2935875" } ] }, { "title": "cDNA and protein structure for the alpha subunit of human liver alcohol dehydrogenase.", "journal": "Biochemistry", "date": "1986", "authors": "von Bahr-Lindstrom H, Hoog JO, Heden LO, Kaiser R, Fleetwood L, Larsson K, Lake M, Holmquist B, Holmgren A, Hempel J, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-5365859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859" } ], "reference": [ { "type": "PubMed", "id": "3013304", "url": "https://glygen.org/publication/PubMed/3013304" } ] }, { "title": "Rat liver alcohol dehydrogenase of class III. Primary structure, functional consequences and relationships to other alcohol dehydrogenases.", "journal": "European journal of biochemistry", "date": "1988", "authors": "Julia P, Pares X, Jornvall H", "evidence": [ { "database": "Reactome", "id": "R-HSA-71384", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71384" } ], "reference": [ { "type": "PubMed", "id": "3278908", "url": "https://glygen.org/publication/PubMed/3278908" } ] }, { "title": "Class III human liver alcohol dehydrogenase: a novel structural type equidistantly related to the class I and class II enzymes.", "journal": "Biochemistry", "date": "1988", "authors": "Kaiser R, Holmquist B, Hempel J, Vallee BL, Jornvall H", "evidence": [ { "database": "Reactome", "id": "R-HSA-71384", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71384" } ], "reference": [ { "type": "PubMed", "id": "3365377", "url": "https://glygen.org/publication/PubMed/3365377" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P00326", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P00326" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "Single Nucleotide Polymorphisms of ADH1B, ADH1C and ALDH2 Genes in 235 People Living in Thai Nguyen Province of Vietnam.", "journal": "Asian Pacific journal of cancer prevention : APJCP", "date": "2022-12-01", "authors": "Hoang Yen Thi Thu, Nguyen Yen Thi, Nguyen Hai Dinh, Le Anh Thi Phuong, Bui Huong Thi Thu, Vu Nhung Phuong, Nguyen Ha Hai", "evidence": [ { "database": "RefSeq", "id": "NP_000660", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000660" } ], "reference": [ { "type": "PubMed", "id": "36580007", "url": "https://glygen.org/publication/PubMed/36580007" } ] }, { "title": "INVESTIGATION OF ALCOHOL DEHYDROGENASE (ADH3) GENE POLYMOPHISM IN PATIENTS WITH CHRONIC ALCOHOLIC PANCRATITIS IN AZERBAIJAN POPULATION.", "journal": "Georgian medical news", "date": "2022-11", "authors": "Aliyeva G, Muslumov G, Bayramov B, Zeynalov N, Behbudov V", "evidence": [ { "database": "RefSeq", "id": "NP_000660", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000660" } ], "reference": [ { "type": "PubMed", "id": "36701787", "url": "https://glygen.org/publication/PubMed/36701787" } ] }, { "title": "Association of ADH1B rs1229984, ADH1C rs698, and ALDH2 rs671 with Alcohol abuse and Alcoholic Cirrhosis in People Living in Northeast Vietnam.", "journal": "Asian Pacific journal of cancer prevention : APJCP", "date": "2023-06-01", "authors": "Hoang Yen Thi Thu, Nguyen Yen Thi, Vu Lan Thi, Bui Huong Thi Thu, Nguyen Quang Viet, Vu Nhung Phuong, Nguyen Ton Dang, Nguyen Ha Hai", "evidence": [ { "database": "RefSeq", "id": "NP_000660", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000660" } ], "reference": [ { "type": "PubMed", "id": "37378938", "url": "https://glygen.org/publication/PubMed/37378938" } ] }, { "title": "ADH1B, ADH1B/C and CYP2E1 Gene Polymorphism and the Risk of Fetal Alcohol Spectrum Disorder.", "journal": "Genes", "date": "2023-07-02", "authors": "Kukowka Arnold, Brzuchalski Bogus\u0142aw, Kurzawski Mateusz, Malinowski Damian, Bia\u0142ecka Monika Anna", "evidence": [ { "database": "RefSeq", "id": "NP_000660", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000660" } ], "reference": [ { "type": "PubMed", "id": "37510297", "url": "https://glygen.org/publication/PubMed/37510297" } ] }, { "title": "The gamma 1 and gamma 2 subunits of human liver alcohol dehydrogenase. cDNA structures, two amino acid replacements, and compatibility with changes in the enzymatic properties.", "journal": "European journal of biochemistry", "date": "1986", "authors": "Hoog JO, Heden LO, Larsson K, Jornvall H, von Bahr-Lindstrom H", "evidence": [ { "database": "UniProtKB", "id": "P00326", "url": "https://www.uniprot.org/uniprot/P00326" } ], "reference": [ { "type": "PubMed", "id": "3758060", "url": "https://glygen.org/publication/PubMed/3758060" } ] }, { "title": "Mitochondrial aldehyde dehydrogenase from human liver. Primary structure, differences in relation to the cytosolic enzyme, and functional correlations.", "journal": "European journal of biochemistry", "date": "1985", "authors": "Hempel J, Kaiser R, Jornvall H", "evidence": [ { "database": "Reactome", "id": "R-HSA-71384", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71384" } ], "reference": [ { "type": "PubMed", "id": "4065146", "url": "https://glygen.org/publication/PubMed/4065146" } ] }, { "title": "Human liver pi-alcohol dehydrogenase: kinetic and molecular properties.", "journal": "Biochemistry", "date": "1979", "authors": "Bosron WF, Li TK, Dafeldecker WP, Vallee BL", "evidence": [ { "database": "Reactome", "id": "R-HSA-71384", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71384" } ], "reference": [ { "type": "PubMed", "id": "427099", "url": "https://glygen.org/publication/PubMed/427099" } ] }, { "title": "Ontogenetic, polymorphic, and interethnic variation in the isoenzymes of human alcohol dehydrogenase.", "journal": "Annals of the New York Academy of Sciences", "date": "1972", "authors": "Murray RF Jr, Price PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-71384", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71384" } ], "reference": [ { "type": "PubMed", "id": "4504607", "url": "https://glygen.org/publication/PubMed/4504607" } ] }, { "title": "Studies on the subunit structure and molecular size of the human alcohol dehydrogenase isozymes determined by the different loci, ADH1, ADH2, and ADH3.", "journal": "Annals of human genetics", "date": "1973", "authors": "Smith M, Hopkinson DA, Harris H", "evidence": [ { "database": "Reactome", "id": "R-HSA-71384", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71384" } ], "reference": [ { "type": "PubMed", "id": "4748759", "url": "https://glygen.org/publication/PubMed/4748759" } ] }, { "title": "Human liver alcohol dehydrogenase. 2. The primary structure of the gamma 1 protein chain.", "journal": "European journal of biochemistry", "date": "1984", "authors": "Buhler R, Hempel J, Kaiser R, de Zalenski C, von Wartburg JP, Jornvall H", "evidence": [ { "database": "UniProtKB", "id": "P00326", "url": "https://www.uniprot.org/uniprot/P00326" } ], "reference": [ { "type": "PubMed", "id": "6391921", "url": "https://glygen.org/publication/PubMed/6391921" } ] }, { "title": "Differential susceptibility of human alcohol dehydrogenase isoenzymes to anions.", "journal": "FEBS letters", "date": "1984-12-10", "authors": "B\u00fchler R, Von Wartburg J P", "evidence": [ { "database": "UniProtKB", "id": "P00326", "url": "https://www.uniprot.org/uniprot/P00326" } ], "reference": [ { "type": "PubMed", "id": "6391957", "url": "https://glygen.org/publication/PubMed/6391957" } ] }, { "title": "Human liver alcohol dehydrogenase: purification and kinetic characterization of the beta 2 beta 2, beta 2 beta 1, alpha beta 2, and beta 2 gamma 1 `Oriental` isoenzymes.", "journal": "Biochemistry", "date": "1984", "authors": "Yin SJ, Bosron WF, Magnes LJ, Li TK", "evidence": [ { "database": "Reactome", "id": "R-HSA-71384", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71384" } ], "reference": [ { "type": "PubMed", "id": "6395883", "url": "https://glygen.org/publication/PubMed/6395883" } ] }, { "title": "Molecular cloning of human class IV alcohol dehydrogenase cDNA.", "journal": "Biochemical and biophysical research communications", "date": "1994", "authors": "Yokoyama H, Baraona E, Lieber CS", "evidence": [ { "database": "Reactome", "id": "R-HSA-71384", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71384" } ], "reference": [ { "type": "PubMed", "id": "8074657", "url": "https://glygen.org/publication/PubMed/8074657" } ] }, { "title": "Biological role of human cytosolic aldehyde dehydrogenase 1: hormonal response, retinal oxidation and implication in testicular feminization.", "journal": "Advances in experimental medicine and biology", "date": "1993", "authors": "Yoshida A, Hsu LC, Yanagawa Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5365859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859" } ], "reference": [ { "type": "PubMed", "id": "8493914", "url": "https://glygen.org/publication/PubMed/8493914" } ] }, { "title": "X-ray structure of human class IV sigmasigma alcohol dehydrogenase. Structural basis for substrate specificity.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Xie P, Parsons SH, Speckhard DC, Bosron WF, Hurley TD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5365859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859" } ], "reference": [ { "type": "PubMed", "id": "9228021", "url": "https://glygen.org/publication/PubMed/9228021" } ] }, { "title": "cDNA cloning and characterization of a new human microsomal NAD+-dependent dehydrogenase that oxidizes all-trans-retinol and 3alpha-hydroxysteroids.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Gough WH, VanOoteghem S, Sint T, Kedishvili NY", "evidence": [ { "database": "Reactome", "id": "R-HSA-5365859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859" } ], "reference": [ { "type": "PubMed", "id": "9677409", "url": "https://glygen.org/publication/PubMed/9677409" } ] }, { "title": "Molecular characterization of a novel short-chain dehydrogenase/reductase that reduces all-trans-retinal.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Haeseleer F, Huang J, Lebioda L, Saari JC, Palczewski K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5365859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859" } ], "reference": [ { "type": "PubMed", "id": "9705317", "url": "https://glygen.org/publication/PubMed/9705317" } ] }, { "title": "Human liver alcohol dehydrogenase: purification, composition, and catalytic features.", "journal": "Biochemistry", "date": "1976", "authors": "Lange LG, Sytkowski AJ, Vallee BL", "evidence": [ { "database": "Reactome", "id": "R-HSA-71384", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71384" } ], "reference": [ { "type": "PubMed", "id": "9982", "url": "https://glygen.org/publication/PubMed/9982" } ] } ], "pathway": [ { "id": "hsa:126", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:126", "resource": "KEGG Pathway" }, { "id": "R-HSA-5365859", "name": "RA biosynthesis pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859", "resource": "Reactome", "description": "RA biosynthesis pathway" }, { "id": "R-HSA-71384", "name": "Ethanol oxidation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71384", "resource": "Reactome", "description": "Ethanol oxidation" } ], "orthologs": [ { "uniprot_canonical_ac": "P00325-1", "protein_name": "All-trans-retinol dehydrogenase [NAD(+)] ADH1B", "gene_name": "ADH1B", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSTAGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICHTDDHVVSGNLVTPLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRVCKNPESNYCLKNDLGNPRGTLQDGTRRFTCRGKPIHHFLGTSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVNVAKVTPGSTCAVFGLGGVGLSAVMGCKAAGAARIIAVDINKDKFAKAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPASQNLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHVLPFEKINEGFDLLHSGKSIRTVLTF", "length": 375 }, "evidence": [ { "id": "45918184", "url": "http://www.informatics.jax.org/homology/45918184", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P00329-1", "protein_name": "Alcohol dehydrogenase 1", "gene_name": "Adh1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSTAGKVIKCKAAVLWELHKPFTIEDIEVAPPKAHEVRIKMVATGVCRSDDHVVSGTLVTPLPAVLGHEGAGIVESVGEGVTCVKPGDKVIPLFSPQCGECRICKHPESNFCSRSDLLMPRGTLREGTSRFSCKGKQIHNFISTSTFSQYTVVDDIAVAKIDGASPLDKVCLIGCGFSTGYGSAVKVAKVTPGSTCAVFGLGGVGLSVIIGCKAAGAARIIAVDINKDKFAKAKELGATECINPQDYSKPIQEVLQEMTDGGVDFSFEVIGRLDTMTSALLSCHAACGVSVVVGVPPNAQNLSMNPMLLLLGRTWKGAIFGGFKSKDSVPKLVADFMAKKFPLDPLITHVLPFEKINEAFDLLRSGKSIRTVLTF", "length": 375 }, "evidence": [ { "id": "45918184", "url": "http://www.informatics.jax.org/homology/45918184", "database": "MGI" }, { "id": "P00326", "url": "https://omabrowser.org/oma/group/P00326/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P06757-1", "protein_name": "Alcohol dehydrogenase 1", "gene_name": "Adh1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSTAGKVIKCKAAVLWEPHKPFTIEDIEVAPPKAHEVRIKMVATGVCRSDDHAVSGSLFTPLPAVLGHEGAGIVESIGEGVTCVKPGDKVIPLFSPQCGKCRICKHPESNLCCQTKNLTQPKGALLDGTSRFSCRGKPIHHFISTSTFSQYTVVDDIAVAKIDAAAPLDKVCLIGCGFSTGYGSAVQVAKVTPGSTCAVFGLGGVGLSVVIGCKTAGAAKIIAVDINKDKFAKAKELGATDCINPQDYTKPIQEVLQEMTDGGVDFSFEVIGRLDTMTSALLSCHSACGVSVIVGVPPSAQSLSVNPMSLLLGRTWKGAIFGGFKSKDAVPKLVADFMAKKFPLEPLITHVLPFEKINEAFDLLRAGKSIRTVLTF", "length": 376 }, "evidence": [ { "id": "45918184", "url": "http://www.informatics.jax.org/homology/45918184", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P07327-1", "protein_name": "Alcohol dehydrogenase 1A", "gene_name": "ADH1A", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAVGICGTDDHVVSGTMVTPLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLAIPQCGKCRICKNPESNYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVNVAKVTPGSTCAVFGLGGVGLSAIMGCKAAGAARIIAVDINKDKFAKAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQNLSMNPMLLLTGRTWKGAILGGFKSKECVPKLVADFMAKKFSLDALITHVLPFEKINEGFDLLHSGKSIRTILMF", "length": 375 }, "evidence": [ { "id": "45918184", "url": "http://www.informatics.jax.org/homology/45918184", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "P00326", "url": "https://www.uniprot.org/uniprot/P00326" } ], "pmid": "" }, { "name": "oxidoreductase activity", "id": "GO:0016491", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016491", "evidence": [ { "database": "UniProtKB", "id": "P00326", "url": "https://www.uniprot.org/uniprot/P00326" } ], "pmid": "" }, { "name": "alcohol dehydrogenase (NAD+) activity", "id": "GO:0004022", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004022", "evidence": [ { "database": "UniProtKB", "id": "P00326", "url": "https://www.uniprot.org/uniprot/P00326" } ], "pmid": "" }, { "name": "alcohol dehydrogenase activity, zinc-dependent", "id": "GO:0004024", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004024", "evidence": [ { "database": "UniProtKB", "id": "P00326", "url": "https://www.uniprot.org/uniprot/P00326" } ], "pmid": "" }, { "name": "NAD-retinol dehydrogenase activity", "id": "GO:0004745", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004745", "evidence": [ { "database": "UniProtKB", "id": "P00326", "url": "https://www.uniprot.org/uniprot/P00326" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "small molecule metabolic process", "id": "GO:0044281", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044281", "evidence": [ { "database": "UniProtKB", "id": "P00326", "url": "https://www.uniprot.org/uniprot/P00326" } ], "pmid": "" }, { "name": "ethanol oxidation", "id": "GO:0006069", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006069", "evidence": [ { "database": "UniProtKB", "id": "P00326", "url": "https://www.uniprot.org/uniprot/P00326" } ], "pmid": "" }, { "name": "retinol metabolic process", "id": "GO:0042572", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042572", "evidence": [ { "database": "UniProtKB", "id": "P00326", "url": "https://www.uniprot.org/uniprot/P00326" } ], "pmid": "" }, { "name": "retinoic acid metabolic process", "id": "GO:0042573", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042573", "evidence": [ { "database": "UniProtKB", "id": "P00326", "url": "https://www.uniprot.org/uniprot/P00326" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "P00326", "url": "https://www.uniprot.org/uniprot/P00326" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P00326", "url": "https://www.uniprot.org/uniprot/P00326" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P00326", "url": "https://www.uniprot.org/uniprot/P00326" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 301, "end_pos": 303, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "10736", "name": "", "equation": "a primary alcohol + NAD(+) = an aldehyde + H(+) + NADH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P06757-1", "P12711-1", "P41682-1", "Q5XI95-1", "P00326-1", "P11766-1", "P40394-1", "P07327-1", "P28332-1", "P28474-1", "Q64437-1", "P00329-1", "P10127-1", "P32771-1", "P00330-1", "P00331-1", "P07246-1", "P38113-1", "Q54TC2-1", "P46415-1", "Q9I7R3-1", "P00334-1" ], "evidence": [ { "id": "10736", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/10736" } ] }, { "id": "25290", "name": "", "equation": "ethanol + NAD(+) = acetaldehyde + H(+) + NADH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P00326-1", "P10127-1", "P00330-1", "P00331-1", "P07246-1" ], "evidence": [ { "id": "25290", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/25290" } ] }, { "id": "R-HSA-5362564", "name": "ADH1A,1C,4 oxidise atROL to atRAL in vitro", "equation": "", "summary": "Some alcohol dehydrogenases (ADHs) utilise NAD+ as cofactor to reversibly oxidise all-trans-retinol (atROL) to all-trans-retinal (atRAL), a retinoid aldehyde, in vitro (von Bahr-Lindstrom et al. 1986, Ikuta et al. 1986, von Bahr-Lindstrom et al. 1991, Xie et al. 1997). ADH1A (ADH1) and ADH4 have high activity and ADH1C (ADH3) has low activity with non-physiological amounts of retinol in vitro. ADH1A and ADH1C metabolize toxic amounts of retinol in vivo, but ADH4 does not. Physiological contributions of ADHs to retinol metabolism have not been demonstrated, in contrast to RDHs.;", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P08319-1", "P00326-1", "P07327-1" ], "evidence": [ { "id": "R-HSA-5362564", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5362564" } ] }, { "id": "R-HSA-71707", "name": "ethanol + NAD+ => acetaldehyde + NADH + H+", "equation": "", "summary": "Cytosolic alcohol dehydrogenase catalyzes the reaction of ethanol and NAD+ to form acetaldehyde and NADH + H+. The active form of the enzyme is a dimer with one zinc ion bound to each protein subunit. In the body, alcohol dehydrogenase is present in the liver, kidney, lung and gastric mucosa.

Six genes encode proteins active in ethanol oxidation: ADH1A, ADH1B, ADH1C, ADH4, ADH6, and ADH7 (Lange et al. 1976; Yin et al. 1985; Li et al. 1978; Bosron et al. 1979; Moreno and Pares 1991; Yokoyama et al. 1994; Chen and Yoshida 1991). ADH1A, B and C proteins can associate to form homodimers or heterodimers; ADH4, 6, and 7 proteins each form homodimers. Expression of ADH1A, B and C is developmentally regulated: ADH1A protein is abundant in the fetus, but expressed only at low levels in adulthood, when ADH1B and C proteins are abundant (Edenberg 2000). The various dimers differ substantially in the efficiency with which they oxidize ethanol. The ADH1B homodimer and heterodimers containing at least one 1B monomer are the most active towards ethanol (Yin et al. 1985). In addition, common polymorphic variants of ADH1B and C proteins differ substantially in this respect (Murray and Price 1972).", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-30203" ], "output_participant_list": [], "enzyme_list": [ "P08319-1", "P40394-1", "P00325-1", "P00326-1", "P07327-1", "P28332-1" ], "evidence": [ { "id": "R-HSA-71707", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71707" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-30203", "participant_name": "EtOH [cytosol]", "crossref": [ { "id": "C00469", "database": "COMPOUND", "url": "" }, { "id": "16236", "database": "ChEBI", "url": "" }, { "id": "8145680", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0000108", "database": "HMDB Metabolite", "url": "" }, { "id": "2299", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C00469", "database": "COMPOUND", "url": "" }, { "id": "16236", "database": "ChEBI", "url": "" }, { "id": "8145680", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0000108", "database": "HMDB Metabolite", "url": "" }, { "id": "2299", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C00469", "database": "COMPOUND", "url": "" }, { "id": "16236", "database": "ChEBI", "url": "" }, { "id": "8145680", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0000108", "database": "HMDB Metabolite", "url": "" }, { "id": "2299", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "16236", "database": "ChEBI", "url": "" }, { "id": "HMDB0000108", "database": "HMDB Metabolite", "url": "" }, { "id": "2299", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "8145680", "database": "PubChem Substance", "url": "" }, { "id": "C00469", "database": "COMPOUND", "url": "" }, { "id": "C00469", "database": "COMPOUND", "url": "" }, { "id": "16236", "database": "ChEBI", "url": "" }, { "id": "8145680", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0000108", "database": "HMDB Metabolite", "url": "" }, { "id": "2299", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C00469", "database": "COMPOUND", "url": "" }, { "id": "16236", "database": "ChEBI", "url": "" }, { "id": "8145680", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0000108", "database": "HMDB Metabolite", "url": "" }, { "id": "2299", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "16236", "database": "ChEBI", "url": "" }, { "id": "HMDB0000108", "database": "HMDB Metabolite", "url": "" }, { "id": "2299", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "8145680", "database": "PubChem Substance", "url": "" }, { "id": "C00469", "database": "COMPOUND", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "P00325", "gene_name": "ADH1B", "activity": [ { "ec_number": "1.1.1.105", "activity": "all-trans-retinol + NAD(+) = all-trans-retinal + H(+) + NADH.", "evidence": [ { "id": "P00325", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00325" } ] }, { "ec_number": "1.1.1.105", "activity": "", "evidence": [ { "id": "P00325", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00325" } ] } ] }, { "uniprot_ac": "P00326", "gene_name": "ADH1C", "activity": [ { "ec_number": "1.1.1.1", "activity": "ethanol + NAD(+) = acetaldehyde + H(+) + NADH.", "evidence": [ { "id": "P00326", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00326" } ] }, { "ec_number": "1.1.1.1", "activity": "", "evidence": [ { "id": "P00326", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00326" } ] } ] }, { "uniprot_ac": "P00329", "gene_name": "Adh1", "activity": [ { "ec_number": "1.1.1.1", "activity": "ethanol + NAD(+) = acetaldehyde + H(+) + NADH.", "evidence": [ { "id": "P00329", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00329" } ] }, { "ec_number": "1.1.1.1", "activity": "", "evidence": [ { "id": "P00329", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00329" } ] } ] }, { "uniprot_ac": "P00330", "gene_name": "ADH1", "activity": [ { "ec_number": "1.1.1.1", "activity": "ethanol + NAD(+) = acetaldehyde + H(+) + NADH.", "evidence": [ { "id": "P00330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00330" } ] }, { "ec_number": "1.1.1.54", "activity": "allyl alcohol + NADP(+) = acrolein + H(+) + NADPH.", "evidence": [ { "id": "P00330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00330" } ] }, { "ec_number": "1.1.1.78", "activity": "(R)-lactaldehyde + NAD(+) = H(+) + methylglyoxal + NADH.", "evidence": [ { "id": "P00330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00330" } ] }, { "ec_number": "1.1.1.54", "activity": "", "evidence": [ { "id": "P00330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00330" } ] }, { "ec_number": "1.1.1.1", "activity": "", "evidence": [ { "id": "P00330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00330" } ] }, { "ec_number": "1.1.1.78", "activity": "", "evidence": [ { "id": "P00330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00330" } ] } ] }, { "uniprot_ac": "P00331", "gene_name": "ADH2", "activity": [ { "ec_number": "1.1.1.1", "activity": "ethanol + NAD(+) = acetaldehyde + H(+) + NADH.", "evidence": [ { "id": "P00331", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00331" } ] }, { "ec_number": "1.1.1.1", "activity": "", "evidence": [ { "id": "P00331", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00331" } ] } ] }, { "uniprot_ac": "P00334", "gene_name": "Adh", "activity": [ { "ec_number": "1.1.1.1", "activity": "ethanol + NAD(+) = acetaldehyde + H(+) + NADH.", "evidence": [ { "id": "P00334", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00334" } ] }, { "ec_number": "1.1.1.1", "activity": "", "evidence": [ { "id": "P00334", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00334" } ] } ] }, { "uniprot_ac": "P06757", "gene_name": "Adh1", "activity": [ { "ec_number": "1.1.1.1", "activity": "ethanol + NAD(+) = acetaldehyde + H(+) + NADH.", "evidence": [ { "id": "P06757", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06757" } ] }, { "ec_number": "1.1.1.1", "activity": "", "evidence": [ { "id": "P06757", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06757" } ] } ] }, { "uniprot_ac": "P07246", "gene_name": "ADH3", "activity": [ { "ec_number": "1.1.1.1", "activity": "ethanol + NAD(+) = acetaldehyde + H(+) + NADH.", "evidence": [ { "id": "P07246", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07246" } ] }, { "ec_number": "1.1.1.1", "activity": "", "evidence": [ { "id": "P07246", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07246" } ] } ] }, { "uniprot_ac": "P07327", "gene_name": "ADH1A", "activity": [ { "ec_number": "1.1.1.1", "activity": "ethanol + NAD(+) = acetaldehyde + H(+) + NADH.", "evidence": [ { "id": "P07327", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07327" } ] }, { "ec_number": "1.1.1.1", "activity": "", "evidence": [ { "id": "P07327", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07327" } ] } ] }, { "uniprot_ac": "P08319", "gene_name": "ADH4", "activity": [ { "ec_number": "1.1.1.105", "activity": "all-trans-retinol + NAD(+) = all-trans-retinal + H(+) + NADH.", "evidence": [ { "id": "P08319", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08319" } ] }, { "ec_number": "1.1.1.105", "activity": "", "evidence": [ { "id": "P08319", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08319" } ] } ] }, { "uniprot_ac": "P10127", "gene_name": "ADH4", "activity": [ { "ec_number": "1.1.1.1", "activity": "ethanol + NAD(+) = acetaldehyde + H(+) + NADH.", "evidence": [ { "id": "P10127", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10127" } ] }, { "ec_number": "1.1.1.1", "activity": "", "evidence": [ { "id": "P10127", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10127" } ] } ] }, { "uniprot_ac": "P11766", "gene_name": "ADH5", "activity": [ { "ec_number": "1.1.1.-", "activity": "", "evidence": [ { "id": "P11766", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11766" } ] }, { "ec_number": "1.1.1.1", "activity": "ethanol + NAD(+) = acetaldehyde + H(+) + NADH.", "evidence": [ { "id": "P11766", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11766" } ] }, { "ec_number": "1.1.1.284", "activity": "NADP(+) + S-(hydroxymethyl)glutathione = H(+) + NADPH + S-formylglutathione.", "evidence": [ { "id": "P11766", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11766" } ] }, { "ec_number": "1.1.1.1", "activity": "", "evidence": [ { "id": "P11766", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11766" } ] } ] }, { "uniprot_ac": "P12711", "gene_name": "Adh5", "activity": [ { "ec_number": "1.1.1.-", "activity": "", "evidence": [ { "id": "P12711", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12711" } ] }, { "ec_number": "1.1.1.1", "activity": "ethanol + NAD(+) = acetaldehyde + H(+) + NADH.", "evidence": [ { "id": "P12711", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12711" } ] }, { "ec_number": "1.1.1.284", "activity": "NADP(+) + S-(hydroxymethyl)glutathione = H(+) + NADPH + S-formylglutathione.", "evidence": [ { "id": "P12711", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12711" } ] }, { "ec_number": "1.1.1.1", "activity": "", "evidence": [ { "id": "P12711", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12711" } ] }, { "ec_number": "1.1.1.284", "activity": "", "evidence": [ { "id": "P12711", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12711" } ] } ] }, { "uniprot_ac": "P28332", "gene_name": "ADH6", "activity": [ { "ec_number": "1.1.1.1", "activity": "ethanol + NAD(+) = acetaldehyde + H(+) + NADH.", "evidence": [ { "id": "P28332", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28332" } ] }, { "ec_number": "1.1.1.1", "activity": "", "evidence": [ { "id": "P28332", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28332" } ] } ] }, { "uniprot_ac": "P28474", "gene_name": "Adh5", "activity": [ { "ec_number": "1.1.1.1", "activity": "ethanol + NAD(+) = acetaldehyde + H(+) + NADH.", "evidence": [ { "id": "P28474", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28474" } ] }, { "ec_number": "1.1.1.1", "activity": "", "evidence": [ { "id": "P28474", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28474" } ] }, { "ec_number": "1.1.1.-", "activity": "", "evidence": [ { "id": "P28474", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28474" } ] }, { "ec_number": "1.1.1.284", "activity": "NADP(+) + S-(hydroxymethyl)glutathione = H(+) + NADPH + S-formylglutathione.", "evidence": [ { "id": "P28474", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28474" } ] } ] }, { "uniprot_ac": "P32771", "gene_name": "SFA1", "activity": [ { "ec_number": "1.1.1.-", "activity": "", "evidence": [ { "id": "P32771", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32771" } ] }, { "ec_number": "1.1.1.1", "activity": "ethanol + NAD(+) = acetaldehyde + H(+) + NADH.", "evidence": [ { "id": "P32771", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32771" } ] }, { "ec_number": "1.1.1.284", "activity": "NADP(+) + S-(hydroxymethyl)glutathione = H(+) + NADPH + S-formylglutathione.", "evidence": [ { "id": "P32771", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32771" } ] }, { "ec_number": "1.1.1.284", "activity": "", "evidence": [ { "id": "P32771", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32771" } ] } ] }, { "uniprot_ac": "P38113", "gene_name": "ADH5", "activity": [ { "ec_number": "1.1.1.1", "activity": "ethanol + NAD(+) = acetaldehyde + H(+) + NADH.", "evidence": [ { "id": "P38113", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38113" } ] }, { "ec_number": "1.1.1.1", "activity": "", "evidence": [ { "id": "P38113", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38113" } ] } ] }, { "uniprot_ac": "P40394", "gene_name": "ADH7", "activity": [ { "ec_number": "1.1.1.1", "activity": "ethanol + NAD(+) = acetaldehyde + H(+) + NADH.", "evidence": [ { "id": "P40394", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40394" } ] }, { "ec_number": "1.1.1.105", "activity": "all-trans-retinol + NAD(+) = all-trans-retinal + H(+) + NADH.", "evidence": [ { "id": "P40394", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40394" } ] }, { "ec_number": "1.1.1.66", "activity": "10-hydroxydecanoate + NAD(+) = 10-oxodecanoate + H(+) + NADH.", "evidence": [ { "id": "P40394", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40394" } ] }, { "ec_number": "1.1.1.105", "activity": "", "evidence": [ { "id": "P40394", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40394" } ] } ] }, { "uniprot_ac": "P41682", "gene_name": "Adh7", "activity": [ { "ec_number": "1.1.1.1", "activity": "ethanol + NAD(+) = acetaldehyde + H(+) + NADH.", "evidence": [ { "id": "P41682", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41682" } ] }, { "ec_number": "1.1.1.105", "activity": "all-trans-retinol + NAD(+) = all-trans-retinal + H(+) + NADH.", "evidence": [ { "id": "P41682", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41682" } ] }, { "ec_number": "1.1.1.66", "activity": "10-hydroxydecanoate + NAD(+) = 10-oxodecanoate + H(+) + NADH.", "evidence": [ { "id": "P41682", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41682" } ] }, { "ec_number": "1.1.1.105", "activity": "", "evidence": [ { "id": "P41682", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41682" } ] } ] }, { "uniprot_ac": "P46415", "gene_name": "Fdh", "activity": [ { "ec_number": "1.1.1.-", "activity": "", "evidence": [ { "id": "P46415", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46415" } ] }, { "ec_number": "1.1.1.1", "activity": "ethanol + NAD(+) = acetaldehyde + H(+) + NADH.", "evidence": [ { "id": "P46415", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46415" } ] }, { "ec_number": "1.1.1.284", "activity": "NADP(+) + S-(hydroxymethyl)glutathione = H(+) + NADPH + S-formylglutathione.", "evidence": [ { "id": "P46415", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46415" } ] }, { "ec_number": "1.1.1.73", "activity": "NAD(+) + octan-1-ol = H(+) + NADH + octanal.", "evidence": [ { "id": "P46415", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46415" } ] }, { "ec_number": "1.1.1.1", "activity": "", "evidence": [ { "id": "P46415", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46415" } ] } ] }, { "uniprot_ac": "Q54TC2", "gene_name": "adh5", "activity": [ { "ec_number": "1.1.1.-", "activity": "", "evidence": [ { "id": "Q54TC2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54TC2" } ] }, { "ec_number": "1.1.1.1", "activity": "ethanol + NAD(+) = acetaldehyde + H(+) + NADH.", "evidence": [ { "id": "Q54TC2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54TC2" } ] }, { "ec_number": "1.1.1.284", "activity": "NADP(+) + S-(hydroxymethyl)glutathione = H(+) + NADPH + S-formylglutathione.", "evidence": [ { "id": "Q54TC2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54TC2" } ] }, { "ec_number": "1.1.1.1", "activity": "", "evidence": [ { "id": "Q54TC2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54TC2" } ] } ] }, { "uniprot_ac": "Q5XI95", "gene_name": "Adh6", "activity": [ { "ec_number": "1.1.1.1", "activity": "ethanol + NAD(+) = acetaldehyde + H(+) + NADH.", "evidence": [ { "id": "Q5XI95", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XI95" } ] }, { "ec_number": "1.1.1.1", "activity": "", "evidence": [ { "id": "Q5XI95", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XI95" } ] } ] }, { "uniprot_ac": "Q64437", "gene_name": "Adh7", "activity": [ { "ec_number": "1.1.1.1", "activity": "ethanol + NAD(+) = acetaldehyde + H(+) + NADH.", "evidence": [ { "id": "Q64437", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64437" } ] }, { "ec_number": "1.1.1.105", "activity": "all-trans-retinol + NAD(+) = all-trans-retinal + H(+) + NADH.", "evidence": [ { "id": "Q64437", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64437" } ] }, { "ec_number": "1.1.1.66", "activity": "10-hydroxydecanoate + NAD(+) = 10-oxodecanoate + H(+) + NADH.", "evidence": [ { "id": "Q64437", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64437" } ] }, { "ec_number": "1.1.1.105", "activity": "", "evidence": [ { "id": "Q64437", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64437" } ] } ] }, { "uniprot_ac": "Q9I7R3", "gene_name": "Dmel\\CG18814", "activity": [ { "ec_number": "1.1.1.1", "activity": "ethanol + NAD(+) = acetaldehyde + H(+) + NADH.", "evidence": [ { "id": "Q9I7R3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9I7R3" } ] }, { "ec_number": "1.1.1.1", "activity": "", "evidence": [ { "id": "Q9I7R3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9I7R3" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 23 ], "sequon_annotation_sites": [ { "start_pos": 301, "end_pos": 303 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 58 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }