{ "uniprot_canonical_ac": "O96622-1", "uniprot_ac": "O96622", "uniprot_id": "ARPC1_DICDI", "mass": { "chemical_mass": 41066.0, "monoisotopic_mass": 41066.0 }, "refseq": { "ac": "XP_642137", "name": "actin related protein 2/3 complex, 41 kDa subunit", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_642137" }, "gene_names": [ { "name": "arcA", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O96622", "id": "O96622" }, { "name": "Arc40", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O96622", "id": "O96622" }, { "name": "DDB_G0277825", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O96622", "id": "O96622" }, { "name": "arcA", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_642137", "id": "XP_642137" }, { "name": "arpD", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O96622", "id": "O96622" } ], "protein_names": [ { "name": "Actin-related protein 2/3 complex subunit 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O96622" }, { "name": "Arp2/3 complex 41 kDa subunit", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O96622" }, { "name": "actin related protein 2/3 complex, 41 kDa subunit", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_642137", "id": "XP_642137" }, { "name": "actin related protein 2/3 complex, subunit 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_642137", "id": "XP_642137" }, { "name": "p41-Arc", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O96622" } ], "function": [ { "annotation": "Functions as a component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Seems to contact the pointed end of the daughter actin filament. The Arp2/3 complex is involved in organizing the actin system in cell motility and chemotaxis, in phagocytosis and macropinocytosis, at late steps of endosome processing, and in mitosis. In concert with a group of other proteins, the Arp2/3 complex plays a general role in the rapid activation and adaptation of the actin system to its multiple functions.", "evidence": [ { "database": "UniProtKB", "id": "O96622", "url": "https://www.uniprot.org/uniprot/O96622#function" }, { "database": "PubMed", "id": "11807934", "url": "https://glygen.org/publication/PubMed/11807934" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Dictyostelium discoideum", "taxid": 44689, "evidence": [ { "database": "UniProtKB", "id": "O96622", "url": "https://www.uniprot.org/uniprot/O96622" } ], "common_name": "Cellular slime molds" } ], "gene": [ { "name": "arcA", "url": "https://www.uniprot.org/uniprot/O96622", "locus": {} } ], "crossref": [ { "id": "DDB_G0277825", "url": "http://dictybase.org/gene/DDB_G0277825", "database": "dictyBase", "categories": [ "Organism-specific" ] }, { "id": "8621345", "url": "https://www.ncbi.nlm.nih.gov/gene/8621345", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001680", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001680", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015943", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015943", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017383", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017383", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036322", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036322", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ddi:DDB_G0277825", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0277825", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "YVWEPSP", "url": "https://omabrowser.org/oma/group/YVWEPSP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR10709", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10709", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10709:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10709:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00400", "url": "http://pfam.xfam.org/family/PF00400", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_O96622", "url": "http://purl.obolibrary.org/obo/PR_O96622", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-DDI-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-2029482", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-5663213", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-5663213", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_642137", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_642137", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "O96622", "url": "https://www.uniprot.org/uniprot/O96622", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O96622-1", "url": "https://www.uniprot.org/uniprot/O96622-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSAFEIEHLASCITAHAWNADRSRVALCPNNNEVHIYAKQGTSWVVEHVLAEHDQLVTSIDWAPKTNRILTSSQDRNAYVWTFKDGQWKPVLVLLRINRAATHVKWSPQENKFAVATGAKLVCICFFEEEHDWWASNHIKKHKSTVLKVDWHPNNLLLATSSSDYKVRVFDAYIKKADGRSVTRPYGEVAFGEPVFEFDQCASWVHALKWSPSGSTLAYSSHDGVFAVANFSTNPPTIEKLRVRNLPLRDLLYITENSIAGVGYDCAPLLITNQNGWKYSGEMDKASEGGAAAGSETSARKLFQNKVDLGESKSADKKLTTVHQNCITSIVPFKSVGGVVSDFSTSGLDGNIVVWHVKALEAKNKFKVI", "length": 369, "header": "sp|O96622-1|ARPC1_DICDI Isoform 1 of Actin-related protein 2/3 complex subunit 1 OS=Dictyostelium discoideum OX=44689 GN=arcA PE=1 SV=1 CANONICAL=O96622-1" }, "isoforms": [ { "isoform_ac": "O96622-1", "url": "", "sequence": { "sequence": "MSAFEIEHLASCITAHAWNADRSRVALCPNNNEVHIYAKQGTSWVVEHVLAEHDQLVTSIDWAPKTNRILTSSQDRNAYVWTFKDGQWKPVLVLLRINRAATHVKWSPQENKFAVATGAKLVCICFFEEEHDWWASNHIKKHKSTVLKVDWHPNNLLLATSSSDYKVRVFDAYIKKADGRSVTRPYGEVAFGEPVFEFDQCASWVHALKWSPSGSTLAYSSHDGVFAVANFSTNPPTIEKLRVRNLPLRDLLYITENSIAGVGYDCAPLLITNQNGWKYSGEMDKASEGGAAAGSETSARKLFQNKVDLGESKSADKKLTTVHQNCITSIVPFKSVGGVVSDFSTSGLDGNIVVWHVKALEAKNKFKVI", "length": 369, "header": "sp|O96622-1|ARPC1_DICDI Isoform 1 of Actin-related protein 2/3 complex subunit 1 OS=Dictyostelium discoideum OX=44689 GN=arcA PE=1 SV=1 CANONICAL=O96622-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The Dictyostelium CARMIL protein links capping protein and the Arp2/3 complex to type I myosins through their SH3 domains.", "journal": "J. Cell Biol.", "date": "2001", "authors": "Jung G, Remmert K, Wu X, Volosky J M, Hammer J A", "evidence": [ { "database": "UniProtKB", "id": "O96622", "url": "https://www.uniprot.org/uniprot/O96622" } ], "reference": [ { "type": "PubMed", "id": "11425877", "url": "https://glygen.org/publication/PubMed/11425877" } ] }, { "title": "Dynamics of the Dictyostelium Arp2/3 complex in endocytosis, cytokinesis, and chemotaxis.", "journal": "Cell motility and the cytoskeleton", "date": "2001-11", "authors": "Insall R, M\u00fcller-Taubenberger A, Machesky L, K\u00f6hler J, Simmeth E, Atkinson S J, Weber I, Gerisch G", "evidence": [ { "database": "UniProtKB", "id": "O96622", "url": "https://www.uniprot.org/uniprot/O96622" } ], "reference": [ { "type": "PubMed", "id": "11807934", "url": "https://glygen.org/publication/PubMed/11807934" } ] }, { "title": "The genome of the social amoeba Dictyostelium discoideum.", "journal": "Nature", "date": "2005", "authors": "Eichinger L, Pachebat J A, Gl\u00f6ckner G, Rajandream M-A, Sucgang R, Berriman M, Song J, Olsen R, Szafranski K, Xu Q, Tunggal B, Kummerfeld S, Madera M, Konfortov B A, Rivero F, Bankier A T, Lehmann R, Hamlin N, Davies R, Gaudet P, Fey P, Pilcher K, Chen G, Saunders D, Sodergren E, Davis P, Kerhornou A, Nie X, Hall N, Anjard C, Hemphill L, Bason N, Farbrother P, Desany B, Just E, Morio T, Rost R, Churcher C, Cooper J, Haydock S, van Driessche N, Cronin A, Goodhead I, Muzny D, Mourier T, Pain A, Lu M, Harper D, Lindsay R, Hauser H, James K, Quiles M, Madan Babu M, Saito T, Buchrieser C, Wardroper A, Felder M, Thangavelu M, Johnson D, Knights A, Loulseged H, Mungall K, Oliver K, Price C, Quail M A, Urushihara H, Hernandez J, Rabbinowitsch E, Steffen D, Sanders M, Ma J, Kohara Y, Sharp S, Simmonds M, Spiegler S, Tivey A, Sugano S, White B, Walker D, Woodward J, Winckler T, Tanaka Y, Shaulsky G, Schleicher M, Weinstock G, Rosenthal A, Cox E C, Chisholm R L, Gibbs R, Loomis W F, Platzer M, Kay R R, Williams J, Dear P H, Noegel A A, Barrell B, Kuspa A", "evidence": [ { "database": "UniProtKB", "id": "O96622", "url": "https://www.uniprot.org/uniprot/O96622" } ], "reference": [ { "type": "PubMed", "id": "15875012", "url": "https://glygen.org/publication/PubMed/15875012" } ] }, { "title": "Vectors for expression of proteins with single or combinatorial fluorescent protein and tandem affinity purification tags in Dictyostelium.", "journal": "Protein Expr. Purif.", "date": "2007", "authors": "Meima Marcel E, Weening Karin E, Schaap Pauline", "evidence": [ { "database": "UniProtKB", "id": "O96622", "url": "https://www.uniprot.org/uniprot/O96622" } ], "reference": [ { "type": "PubMed", "id": "17296313", "url": "https://glygen.org/publication/PubMed/17296313" } ] } ], "pathway": [ { "id": "ddi:DDB_G0277825", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0277825", "resource": "KEGG Pathway" }, { "id": "R-DDI-2029482", "name": "Regulation of actin dynamics for phagocytic cup formation", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-2029482", "resource": "Reactome", "description": "Regulation of actin dynamics for phagocytic cup formation" }, { "id": "R-DDI-5663213", "name": "RHO GTPases Activate WASPs and WAVEs", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-5663213", "resource": "Reactome", "description": "RHO GTPases Activate WASPs and WAVEs" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 13, "go_terms": [ { "name": "phagocytic cup", "id": "GO:0001891", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001891", "evidence": [ { "database": "UniProtKB", "id": "O96622", "url": "https://www.uniprot.org/uniprot/O96622" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O96622", "url": "https://www.uniprot.org/uniprot/O96622" } ], "pmid": "" }, { "name": "clathrin-coated pit", "id": "GO:0005905", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005905", "evidence": [ { "database": "UniProtKB", "id": "O96622", "url": "https://www.uniprot.org/uniprot/O96622" } ], "pmid": "" }, { "name": "cell cortex", "id": "GO:0005938", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005938", "evidence": [ { "database": "UniProtKB", "id": "O96622", "url": "https://www.uniprot.org/uniprot/O96622" } ], "pmid": "" }, { "name": "extracellular matrix", "id": "GO:0031012", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031012", "evidence": [ { "database": "UniProtKB", "id": "O96622", "url": "https://www.uniprot.org/uniprot/O96622" } ], "pmid": "" }, { "name": "cell leading edge", "id": "GO:0031252", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031252", "evidence": [ { "database": "UniProtKB", "id": "O96622", "url": "https://www.uniprot.org/uniprot/O96622" } ], "pmid": "" }, { "name": "phagocytic vesicle membrane", "id": "GO:0030670", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030670", "evidence": [ { "database": "UniProtKB", "id": "O96622", "url": "https://www.uniprot.org/uniprot/O96622" } ], "pmid": "" }, { "name": "filopodium", "id": "GO:0030175", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030175", "evidence": [ { "database": "UniProtKB", "id": "O96622", "url": "https://www.uniprot.org/uniprot/O96622" } ], "pmid": "" }, { "name": "phagocytic vesicle", "id": "GO:0045335", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045335", "evidence": [ { "database": "UniProtKB", "id": "O96622", "url": "https://www.uniprot.org/uniprot/O96622" } ], "pmid": "" }, { "name": "pseudopodium", "id": "GO:0031143", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031143", "evidence": [ { "database": "UniProtKB", "id": "O96622", "url": "https://www.uniprot.org/uniprot/O96622" } ], "pmid": "" }, { "name": "Arp2/3 protein complex", "id": "GO:0005885", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005885", "evidence": [ { "database": "UniProtKB", "id": "O96622", "url": "https://www.uniprot.org/uniprot/O96622" } ], "pmid": "" }, { "name": "cortical actin cytoskeleton", "id": "GO:0030864", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030864", "evidence": [ { "database": "UniProtKB", "id": "O96622", "url": "https://www.uniprot.org/uniprot/O96622" } ], "pmid": "" }, { "name": "cell projection", "id": "GO:0042995", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042995", "evidence": [ { "database": "UniProtKB", "id": "O96622", "url": "https://www.uniprot.org/uniprot/O96622" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "actin filament binding", "id": "GO:0051015", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051015", "evidence": [ { "database": "UniProtKB", "id": "O96622", "url": "https://www.uniprot.org/uniprot/O96622" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "phagocytosis", "id": "GO:0006909", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006909", "evidence": [ { "database": "UniProtKB", "id": "O96622", "url": "https://www.uniprot.org/uniprot/O96622" } ], "pmid": "" }, { "name": "actin filament polymerization", "id": "GO:0030041", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030041", "evidence": [ { "database": "UniProtKB", "id": "O96622", "url": "https://www.uniprot.org/uniprot/O96622" } ], "pmid": "" }, { "name": "Arp2/3 complex-mediated actin nucleation", "id": "GO:0034314", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034314", "evidence": [ { "database": "UniProtKB", "id": "O96622", "url": "https://www.uniprot.org/uniprot/O96622" } ], "pmid": "" }, { "name": "exocytosis", "id": "GO:0006887", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006887", "evidence": [ { "database": "UniProtKB", "id": "O96622", "url": "https://www.uniprot.org/uniprot/O96622" } ], "pmid": "" }, { "name": "actin nucleation", "id": "GO:0045010", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045010", "evidence": [ { "database": "UniProtKB", "id": "O96622", "url": "https://www.uniprot.org/uniprot/O96622" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 230, "end_pos": 232, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 230, "end_pos": 232 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }