{ "uniprot_canonical_ac": "O96390-1", "uniprot_ac": "O96390", "uniprot_id": "RACF1_DICDI", "mass": { "chemical_mass": 21830.0, "monoisotopic_mass": 21830.0 }, "refseq": { "ac": "XP_646071", "name": "Rho GTPase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_646071" }, "gene_names": [ { "name": "racF1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O96390", "id": "O96390" }, { "name": "DDB_G0269176", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O96390", "id": "O96390" }, { "name": "racF1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_646071", "id": "XP_646071" } ], "protein_names": [ { "name": "Rho-related protein racF1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O96390" }, { "name": "Rho GTPase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_646071", "id": "XP_646071" } ], "function": [ { "annotation": "Might act in concert and/or share functions with other members of the RHO family in the regulation of a subset of cytoskeletal rearrangements that are required for these processes.", "evidence": [ { "database": "UniProtKB", "id": "O96390", "url": "https://www.uniprot.org/uniprot/O96390#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Dictyostelium discoideum", "taxid": 44689, "evidence": [ { "database": "UniProtKB", "id": "O96390", "url": "https://www.uniprot.org/uniprot/O96390" } ], "common_name": "Cellular slime molds" } ], "gene": [ { "name": "racF1", "url": "https://www.uniprot.org/uniprot/O96390", "locus": {} } ], "crossref": [ { "id": "cd00157", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00157", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "DDB_G0269176", "url": "http://dictybase.org/gene/DDB_G0269176", "database": "dictyBase", "categories": [ "Organism-specific" ] }, { "id": "8617020", "url": "https://www.ncbi.nlm.nih.gov/gene/8617020", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "O96390", "url": "https://www.ebi.ac.uk/intact/interactors/id:O96390*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001806", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001806", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003578", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003578", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR005225", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005225", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ddi:DDB_G0269176", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0269176", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "EKPICME", "url": "https://omabrowser.org/oma/group/EKPICME/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR24072", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24072", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24072:SF359", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24072:SF359", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00071", "url": "http://pfam.xfam.org/family/PF00071", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_O96390", "url": "http://purl.obolibrary.org/obo/PR_O96390", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-DDI-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-9013404", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-9013407", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-9013407", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-9013408", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-9013418", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-9013418", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-9013422", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-9013422", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_646071", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_646071", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "O96390", "url": "https://www.uniprot.org/uniprot/O96390", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O96390-1", "url": "https://www.uniprot.org/uniprot/O96390-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MQNIKCVVVGDGAVGKTCMLISYTTNGFPSEYIPTVFDNYCANLMLEGKPYSLGLWDTAGQEDYDRLRPLSYPHTDVFLICFSIISQASFENVTTKWFKEVNHHAPGVPIILVGTKQDIRNDNDSIKKLKEKNIELVPYEKGLEKAKEINAIYLEASALTQRGIKDVFDQCIRSVIYPNKLIKKPKKKSCTIM", "length": 193, "header": "sp|O96390-1|RACF1_DICDI Isoform 1 of Rho-related protein racF1 OS=Dictyostelium discoideum OX=44689 GN=racF1 PE=1 SV=1 CANONICAL=O96390-1" }, "isoforms": [ { "isoform_ac": "O96390-1", "url": "", "sequence": { "sequence": "MQNIKCVVVGDGAVGKTCMLISYTTNGFPSEYIPTVFDNYCANLMLEGKPYSLGLWDTAGQEDYDRLRPLSYPHTDVFLICFSIISQASFENVTTKWFKEVNHHAPGVPIILVGTKQDIRNDNDSIKKLKEKNIELVPYEKGLEKAKEINAIYLEASALTQRGIKDVFDQCIRSVIYPNKLIKKPKKKSCTIM", "length": 193, "header": "sp|O96390-1|RACF1_DICDI Isoform 1 of Rho-related protein racF1 OS=Dictyostelium discoideum OX=44689 GN=racF1 PE=1 SV=1 CANONICAL=O96390-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "RacF1, a novel member of the Rho protein family in Dictyostelium discoideum, associates transiently with cell contact areas, macropinosomes and phagosomes.", "journal": "Mol. Biol. Cell", "date": "1999", "authors": "Rivero F, Albrecht R, Dislich H, Bracco E, Graciotti L, Bozzaro S, Noegel A A", "evidence": [ { "database": "UniProtKB", "id": "O96390", "url": "https://www.uniprot.org/uniprot/O96390" } ], "reference": [ { "type": "PubMed", "id": "10198067", "url": "https://glygen.org/publication/PubMed/10198067" } ] }, { "title": "Cellular distribution and functions of wild-type and constitutively activated Dictyostelium PakB.", "journal": "Mol. Biol. Cell", "date": "2005", "authors": "de la Roche Marc, Mahasneh Amjad, Lee Sheu-Fen, Rivero Francisco, C\u00f4t\u00e9 Graham P", "evidence": [ { "database": "UniProtKB", "id": "O96390", "url": "https://www.uniprot.org/uniprot/O96390" } ], "reference": [ { "type": "PubMed", "id": "15509655", "url": "https://glygen.org/publication/PubMed/15509655" } ] }, { "title": "The genome of the social amoeba Dictyostelium discoideum.", "journal": "Nature", "date": "2005", "authors": "Eichinger L, Pachebat J A, Gl\u00f6ckner G, Rajandream M-A, Sucgang R, Berriman M, Song J, Olsen R, Szafranski K, Xu Q, Tunggal B, Kummerfeld S, Madera M, Konfortov B A, Rivero F, Bankier A T, Lehmann R, Hamlin N, Davies R, Gaudet P, Fey P, Pilcher K, Chen G, Saunders D, Sodergren E, Davis P, Kerhornou A, Nie X, Hall N, Anjard C, Hemphill L, Bason N, Farbrother P, Desany B, Just E, Morio T, Rost R, Churcher C, Cooper J, Haydock S, van Driessche N, Cronin A, Goodhead I, Muzny D, Mourier T, Pain A, Lu M, Harper D, Lindsay R, Hauser H, James K, Quiles M, Madan Babu M, Saito T, Buchrieser C, Wardroper A, Felder M, Thangavelu M, Johnson D, Knights A, Loulseged H, Mungall K, Oliver K, Price C, Quail M A, Urushihara H, Hernandez J, Rabbinowitsch E, Steffen D, Sanders M, Ma J, Kohara Y, Sharp S, Simmonds M, Spiegler S, Tivey A, Sugano S, White B, Walker D, Woodward J, Winckler T, Tanaka Y, Shaulsky G, Schleicher M, Weinstock G, Rosenthal A, Cox E C, Chisholm R L, Gibbs R, Loomis W F, Platzer M, Kay R R, Williams J, Dear P H, Noegel A A, Barrell B, Kuspa A", "evidence": [ { "database": "UniProtKB", "id": "O96390", "url": "https://www.uniprot.org/uniprot/O96390" } ], "reference": [ { "type": "PubMed", "id": "15875012", "url": "https://glygen.org/publication/PubMed/15875012" } ] } ], "pathway": [ { "id": "ddi:DDB_G0269176", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0269176", "resource": "KEGG Pathway" }, { "id": "R-DDI-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" }, { "id": "R-DDI-9013404", "name": "RAC2 GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-9013404", "resource": "Reactome", "description": "RAC2 GTPase cycle" }, { "id": "R-DDI-9013407", "name": "RHOH GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-9013407", "resource": "Reactome", "description": "RHOH GTPase cycle" }, { "id": "R-DDI-9013408", "name": "RHOG GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-9013408", "resource": "Reactome", "description": "RHOG GTPase cycle" }, { "id": "R-DDI-9013418", "name": "RHOBTB2 GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-9013418", "resource": "Reactome", "description": "RHOBTB2 GTPase cycle" }, { "id": "R-DDI-9013422", "name": "RHOBTB1 GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-9013422", "resource": "Reactome", "description": "RHOBTB1 GTPase cycle" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 11, "go_terms": [ { "name": "sexual reproduction", "id": "GO:0019953", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019953", "evidence": [ { "database": "UniProtKB", "id": "O96390", "url": "https://www.uniprot.org/uniprot/O96390" } ], "pmid": "" }, { "name": "actin filament organization", "id": "GO:0007015", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007015", "evidence": [ { "database": "UniProtKB", "id": "O96390", "url": "https://www.uniprot.org/uniprot/O96390" } ], "pmid": "" }, { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "O96390", "url": "https://www.uniprot.org/uniprot/O96390" } ], "pmid": "" }, { "name": "regulation of actin cytoskeleton organization", "id": "GO:0032956", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032956", "evidence": [ { "database": "UniProtKB", "id": "O96390", "url": "https://www.uniprot.org/uniprot/O96390" } ], "pmid": "" }, { "name": "small GTPase mediated signal transduction", "id": "GO:0007264", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007264", "evidence": [ { "database": "UniProtKB", "id": "O96390", "url": "https://www.uniprot.org/uniprot/O96390" } ], "pmid": "" }, { "name": "regulation of cell shape", "id": "GO:0008360", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008360", "evidence": [ { "database": "UniProtKB", "id": "O96390", "url": "https://www.uniprot.org/uniprot/O96390" } ], "pmid": "" }, { "name": "mitotic cytokinesis", "id": "GO:0000281", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000281", "evidence": [ { "database": "UniProtKB", "id": "O96390", "url": "https://www.uniprot.org/uniprot/O96390" } ], "pmid": "" }, { "name": "engulfment of apoptotic cell", "id": "GO:0043652", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043652", "evidence": [ { "database": "UniProtKB", "id": "O96390", "url": "https://www.uniprot.org/uniprot/O96390" } ], "pmid": "" }, { "name": "establishment or maintenance of cell polarity", "id": "GO:0007163", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007163", "evidence": [ { "database": "UniProtKB", "id": "O96390", "url": "https://www.uniprot.org/uniprot/O96390" } ], "pmid": "" }, { "name": "cortical cytoskeleton organization", "id": "GO:0030865", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030865", "evidence": [ { "database": "UniProtKB", "id": "O96390", "url": "https://www.uniprot.org/uniprot/O96390" } ], "pmid": "" }, { "name": "response to imidacloprid", "id": "GO:1902351", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902351", "evidence": [ { "database": "UniProtKB", "id": "O96390", "url": "https://www.uniprot.org/uniprot/O96390" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 8, "go_terms": [ { "name": "phagocytic cup", "id": "GO:0001891", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001891", "evidence": [ { "database": "UniProtKB", "id": "O96390", "url": "https://www.uniprot.org/uniprot/O96390" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O96390", "url": "https://www.uniprot.org/uniprot/O96390" } ], "pmid": "" }, { "name": "cytoskeleton", "id": "GO:0005856", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005856", "evidence": [ { "database": "UniProtKB", "id": "O96390", "url": "https://www.uniprot.org/uniprot/O96390" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "O96390", "url": "https://www.uniprot.org/uniprot/O96390" } ], "pmid": "" }, { "name": "cell cortex", "id": "GO:0005938", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005938", "evidence": [ { "database": "UniProtKB", "id": "O96390", "url": "https://www.uniprot.org/uniprot/O96390" } ], "pmid": "" }, { "name": "cytoplasmic vesicle", "id": "GO:0031410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031410", "evidence": [ { "database": "UniProtKB", "id": "O96390", "url": "https://www.uniprot.org/uniprot/O96390" } ], "pmid": "" }, { "name": "macropinosome", "id": "GO:0044354", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044354", "evidence": [ { "database": "UniProtKB", "id": "O96390", "url": "https://www.uniprot.org/uniprot/O96390" } ], "pmid": "" }, { "name": "cell projection", "id": "GO:0042995", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042995", "evidence": [ { "database": "UniProtKB", "id": "O96390", "url": "https://www.uniprot.org/uniprot/O96390" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "GTPase activity", "id": "GO:0003924", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003924", "evidence": [ { "database": "UniProtKB", "id": "O96390", "url": "https://www.uniprot.org/uniprot/O96390" } ], "pmid": "" }, { "name": "GTP binding", "id": "GO:0005525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005525", "evidence": [ { "database": "UniProtKB", "id": "O96390", "url": "https://www.uniprot.org/uniprot/O96390" } ], "pmid": "" }, { "name": "protein kinase binding", "id": "GO:0019901", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019901", "evidence": [ { "database": "UniProtKB", "id": "O96390", "url": "https://www.uniprot.org/uniprot/O96390" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 123, "end_pos": 125, "annotation": "n_glycosylation_sequon" }, { "start_pos": 92, "end_pos": 94, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 123, "end_pos": 125 }, { "start_pos": 92, "end_pos": 94 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }