{ "uniprot_canonical_ac": "O96020-1", "uniprot_ac": "O96020", "uniprot_id": "CCNE2_HUMAN", "mass": { "chemical_mass": 46757.0, "monoisotopic_mass": 46757.0 }, "refseq": { "ac": "NP_477097", "name": "G1/S-specific cyclin-E2", "summary": "The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK2. This cyclin has been shown to specifically interact with CIP/KIP family of CDK inhibitors, and plays a role in cell cycle G1/S transition. The expression of this gene peaks at the G1-S phase and exhibits a pattern of tissue specificity distinct from that of cyclin E1. A significantly increased expression level of this gene was observed in tumor-derived cells. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_477097" }, "gene_names": [ { "name": "CCNE2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O96020", "id": "O96020" }, { "name": "CCNE2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_477097", "id": "NP_477097" }, { "name": "CYCE2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_477097", "id": "NP_477097" }, { "name": "hCG_15054", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O96020", "id": "O96020" } ], "protein_names": [ { "name": "G1/S-specific cyclin-E2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O96020" }, { "name": "G1/S-specific cyclin-E2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_477097", "id": "NP_477097" } ], "function": [ { "annotation": "E2F transcription factor 1 (E2F1) promotes the transforming growth factor TGF-beta1 induced human cardiac fibroblasts differentiation through promoting the transcription of CCNE2 gene.", "evidence": [ { "database": "RefSeq", "id": "NP_477097", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_477097" }, { "database": "PubMed", "id": "34521301", "url": "https://glygen.org/publication/PubMed/34521301" } ] }, { "annotation": "Essential for the control of the cell cycle at the late G1 and early S phase.", "evidence": [ { "database": "UniProtKB", "id": "O96020", "url": "https://www.uniprot.org/uniprot/O96020#function" } ] }, { "annotation": "Genome-wide chromatin contacts of super-enhancer-associated lncRNA identify LINC01013 as a regulator of fibrosis in the aortic valve. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_477097", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_477097" }, { "database": "PubMed", "id": "35041643", "url": "https://glygen.org/publication/PubMed/35041643" } ] }, { "annotation": "SP1-induced overexpression of LINC00520 facilitates non-small cell lung cancer progression through miR-577/CCNE2 pathway and predicts poor prognosis.", "evidence": [ { "database": "RefSeq", "id": "NP_477097", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_477097" }, { "database": "PubMed", "id": "33728585", "url": "https://glygen.org/publication/PubMed/33728585" } ] }, { "annotation": "The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK2. This cyclin has been shown to specifically interact with CIP/KIP family of CDK inhibitors, and plays a role in cell cycle G1/S transition. The expression of this gene peaks at the G1-S phase and exhibits a pattern of tissue specificity distinct from that of cyclin E1. A significantly increased expression level of this gene was observed in tumor-derived cells. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_477097", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_477097" } ] }, { "annotation": "Vascular endothelial cell-derived exosomal miR-30a-5p inhibits lung adenocarcinoma malignant progression by targeting CCNE2.", "evidence": [ { "database": "RefSeq", "id": "NP_477097", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_477097" }, { "database": "PubMed", "id": "34128973", "url": "https://glygen.org/publication/PubMed/34128973" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs546080247", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs546080247" }, { "id": "rs546080247", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs546080247" }, { "id": "rs546080247", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs546080247" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 120, "end_pos": 120, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KES->NES).", "chr_id": "8", "chr_pos": "94890508", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "K120", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs558172557", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs558172557" }, { "id": "rs558172557", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs558172557" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 183, "end_pos": 183, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NKN->NKS).", "chr_id": "8", "chr_pos": "94887979", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N183", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs138458120", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138458120" }, { "id": "rs138458120", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138458120" }, { "id": "rs138458120", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs138458120#frequency_tab" }, { "id": "rs138458120", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs138458120" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 320, "end_pos": 320, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SIS->NIS).", "chr_id": "8", "chr_pos": "94882274", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S320", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1395962105", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1395962105" }, { "id": "rs1395962105", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1395962105" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 336, "end_pos": 336, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KST->NST).", "chr_id": "8", "chr_pos": "94882225", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K336", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1388345566", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1388345566" }, { "id": "rs1388345566", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1388345566#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 35, "end_pos": 35, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "8", "chr_pos": "94894030", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T35", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1463318494", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1463318494" }, { "id": "rs1463318494", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1463318494#frequency_tab" }, { "id": "rs1463318494", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1463318494" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 36, "end_pos": 36, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "8", "chr_pos": "94894027", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T36", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs747525082", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747525082" }, { "id": "rs747525082", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747525082" }, { "id": "rs747525082", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747525082" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 373, "end_pos": 373, "sequence_org": "I", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NYI->NYT).", "chr_id": "8", "chr_pos": "94881729", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I373", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs928352337", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs928352337" }, { "id": "rs928352337", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs928352337#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 389, "end_pos": 389, "sequence_org": "G", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NGG->NGS).", "chr_id": "8", "chr_pos": "94881682", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "G389", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O96020", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O96020" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 83, "end_pos": 83, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DFS->NFS).", "chr_id": "8", "chr_pos": "94892888", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "D83", "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [ { "start_pos": 392, "end_pos": 392, "sequence_org": "T", "sequence_mut": "A", "comment": "Increase of steady state level.", "evidence": [ { "database": "UniProtKB", "id": "O96020", "url": "https://www.uniprot.org/uniprot/O96020" }, { "database": "PubMed", "id": "9840943", "url": "https://glygen.org/publication/PubMed/9840943" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "59.01", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000175305", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175305" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "67.92", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000175305", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175305" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "63.15", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000175305", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175305" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000175305", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175305" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "73.06", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000175305", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175305" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "82.38", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000175305", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175305" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "56.77", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000175305", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175305" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "59.43", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000175305", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175305" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "68.42", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000175305", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175305" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000175305", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175305" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "64.38", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000175305", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175305" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "70.26", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000175305", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175305" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "73.07", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000175305", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175305" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O96020", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O96020" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O96020", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O96020" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O96020", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O96020" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O96020", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O96020" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O96020", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O96020" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O96020", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O96020" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O96020", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O96020" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O96020", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O96020" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O96020", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O96020" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O96020", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O96020" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O96020", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O96020" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O96020", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O96020" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O96020", "url": "https://www.uniprot.org/uniprot/O96020" } ], "common_name": "Human" } ], "gene": [ { "name": "CCNE2", "url": "https://www.uniprot.org/uniprot/O96020", "locus": { "chromosome": "8", "start_pos": 94879770, "end_pos": 94896678, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000175305", "url": "https://www.ensembl.org/id/ENSG00000175305" } ] } } ], "crossref": [ { "id": "ENSG00000175305", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175305", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O96020", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O96020", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd20580", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd20580", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd20582", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd20582", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL2094126", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2094126", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "CHEMBL4523633", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4523633", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "CHEMBL4523635", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4523635", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "CCNE2", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CCNE2", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "9134", "url": "https://www.ncbi.nlm.nih.gov/gene/9134", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "1590", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=1590", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O96020", "url": "https://www.ebi.ac.uk/intact/interactors/id:O96020*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR004367", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004367", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006671", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006671", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013763", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013763", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036915", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036915", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039361", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039361", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR048258", "url": "https://www.ebi.ac.uk/interpro/entry/IPR048258", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:9134", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9134", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "603775", "url": "http://www.omim.org/entry/603775", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O96020", "url": "https://www.nextprot.org/entry/NX_O96020", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O96020", "url": "https://oglcnac.org/atlas/detail/O96020", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "O96020", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O96020", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "PVEDRHN", "url": "https://omabrowser.org/oma/group/PVEDRHN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5474295at2759", "url": "http://www.orthodb.org/?query=5474295at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10177", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10177", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10177:SF70", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10177:SF70", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00134", "url": "http://pfam.xfam.org/family/PF00134", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02984", "url": "http://pfam.xfam.org/family/PF02984", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O96020", "url": "https://pharos.nih.gov/targets/O96020", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O96020", "url": "http://purl.obolibrary.org/obo/PR_O96020", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1538133", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1538133", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-187577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-187577", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-390471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-390471", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6804116", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804116", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-69017", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69017", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-69200", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69200", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-69202", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69202", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-69563", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69563", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9661069", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9661069", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_477097", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_477097", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "E5RHN2", "url": "https://www.uniprot.org/uniprot/E5RHN2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RHN2-1", "url": "https://www.uniprot.org/uniprot/E5RHN2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RK20", "url": "https://www.uniprot.org/uniprot/E5RK20", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RK20-1", "url": "https://www.uniprot.org/uniprot/E5RK20-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YBQ2", "url": "https://www.uniprot.org/uniprot/H0YBQ2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YBQ2-1", "url": "https://www.uniprot.org/uniprot/H0YBQ2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O96020", "url": "https://www.uniprot.org/uniprot/O96020", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O96020-1", "url": "https://www.uniprot.org/uniprot/O96020-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O96020-2", "url": "https://www.uniprot.org/uniprot/O96020-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8WUE3", "url": "https://www.uniprot.org/uniprot/Q8WUE3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8WUE3-1", "url": "https://www.uniprot.org/uniprot/Q8WUE3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSRRSSRLQAKQQPQPSQTESPQEAQIIQAKKRKTTQDVKKRREEVTKKHQYEIRNCWPPVLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKEVWLNMLKKESRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDINKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELCPVTIISWLNLFLQVDALKDAPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILTAAALCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIPMEDRHNIQTHTNYLAMLEEVNYINTFRKGGQLSPVCNGGIMTPPKSTEKPPGKH", "length": 404, "header": "sp|O96020-1|CCNE2_HUMAN Isoform 1 of G1/S-specific cyclin-E2 OS=Homo sapiens OX=9606 GN=CCNE2 PE=1 SV=1 CANONICAL=O96020-1" }, "isoforms": [ { "isoform_ac": "E5RHN2-1", "url": "", "sequence": { "sequence": "MSRRSSRLQAKQQPQPSQTESPQEAQIIQAKKRKTTQFTNGLFYFPGCQKKKRGGHQETSV", "length": 61, "header": "tr|E5RHN2-1|CCNE2_HUMAN Computationally mapped isoform of G1/S-specific cyclin-E2 OS=Homo sapiens OX=9606 GN=CCNE2 PE=1 SV=1 CANONICAL=O96020-1" }, "locus": { "chromosome": "8", "start_pos": 94894221, "end_pos": 94893901, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000519889.5", "url": "https://www.ensembl.org/id/ENST00000519889.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000430875.1", "url": "https://www.ensembl.org/id/ENSP00000430875.1" } ] } }, { "isoform_ac": "E5RK20-1", "url": "", "sequence": { "sequence": "MSRRSSRLQAKQQPQPSQTESPQEAQIIQAKKRKTTQDVKKRREEVTKKHQYEIRLGMFKRSLAKHVKKGEQICS", "length": 75, "header": "tr|E5RK20-1|CCNE2_HUMAN Computationally mapped isoform of G1/S-specific cyclin-E2 OS=Homo sapiens OX=9606 GN=CCNE2 PE=1 SV=1 CANONICAL=O96020-1" }, "locus": { "chromosome": "8", "start_pos": 94894221, "end_pos": 94890491, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000521809.5", "url": "https://www.ensembl.org/id/ENST00000521809.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000428988.1", "url": "https://www.ensembl.org/id/ENSP00000428988.1" } ] } }, { "isoform_ac": "H0YBQ2-1", "url": "", "sequence": { "sequence": "XEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDINKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELCPVTIISWLNLFLQVDALKDAPKVLLPQYSQETFIQIAQLFSHFSYLLDQ", "length": 152, "header": "tr|H0YBQ2-1|CCNE2_HUMAN Computationally mapped isoform of G1/S-specific cyclin-E2 OS=Homo sapiens OX=9606 GN=CCNE2 PE=1 SV=1 CANONICAL=O96020-1" }, "locus": { "chromosome": "8", "start_pos": 94890458, "end_pos": 94883888, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000524224.5", "url": "https://www.ensembl.org/id/ENST00000524224.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000430060.1", "url": "https://www.ensembl.org/id/ENSP00000430060.1" } ] } }, { "isoform_ac": "O96020-1", "url": "", "sequence": { "sequence": "MSRRSSRLQAKQQPQPSQTESPQEAQIIQAKKRKTTQDVKKRREEVTKKHQYEIRNCWPPVLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKEVWLNMLKKESRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDINKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELCPVTIISWLNLFLQVDALKDAPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILTAAALCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIPMEDRHNIQTHTNYLAMLEEVNYINTFRKGGQLSPVCNGGIMTPPKSTEKPPGKH", "length": 404, "header": "sp|O96020-1|CCNE2_HUMAN Isoform 1 of G1/S-specific cyclin-E2 OS=Homo sapiens OX=9606 GN=CCNE2 PE=1 SV=1 CANONICAL=O96020-1" }, "locus": { "chromosome": "8", "start_pos": 94894221, "end_pos": 94881635, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000308108.9", "url": "https://www.ensembl.org/id/ENST00000308108.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000309181.4", "url": "https://www.ensembl.org/id/ENSP00000309181.4" } ] } }, { "isoform_ac": "O96020-2", "url": "", "sequence": { "sequence": "MSRRSSRLQAKQQPQPSQTESPQEAQIIQAKKRKTTQDVKKRREEVTKKHQYEIRNCWPPVLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKEVWLNMLKKESRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAYVTDGACSEEDILRMELIILKALKWELCPVTIISWLNLFLQVDALKDAPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILTAAALCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIPMEDRHNIQTHTNYLAMLEEVNYINTFRKGGQLSPVCNGGIMTPPKSTEKPPGKH", "length": 359, "header": "sp|O96020-2|CCNE2_HUMAN Isoform 2 of G1/S-specific cyclin-E2 OS=Homo sapiens OX=9606 GN=CCNE2 PE=1 SV=1 CANONICAL=O96020-1" }, "locus": {} }, { "isoform_ac": "Q8WUE3-1", "url": "", "sequence": { "sequence": "MSRRSSRLQAKQQPQPSQTESPQEAQIIQAKKRKTTQDVKKRREEVTKKHQYEIRNCWPPVLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKEVWLNMLKKESRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDINKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELCPVTIISWLNLFLQVDALKDAPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILTAAALCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIPMEDRHNIQTHTNYLAMLCMISSHV", "length": 374, "header": "tr|Q8WUE3-1|CCNE2_HUMAN Computationally mapped isoform of G1/S-specific cyclin-E2 OS=Homo sapiens OX=9606 GN=CCNE2 PE=1 SV=1 CANONICAL=O96020-1" }, "locus": { "chromosome": "8", "start_pos": 94894221, "end_pos": 94881749, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000396133.7", "url": "https://www.ensembl.org/id/ENST00000396133.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000379437.3", "url": "https://www.ensembl.org/id/ENSP00000379437.3" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 35, "start_aa": "Thr", "end_pos": 35, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr35", "evidence": [ { "id": "O96020", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O96020" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "O96020", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O96020" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 36, "start_aa": "Thr", "end_pos": 36, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr36", "evidence": [ { "id": "O96020", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O96020" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "O96020", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O96020" } ] } ], "phosphorylation": [ { "start_pos": 19, "end_pos": 19, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O96020", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O96020" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "O96020", "url": "http://phospho.elm.eu.org/byAccession/O96020.html" } ], "site_lbl": "Thr19" }, { "start_pos": 21, "end_pos": 21, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O96020", "url": "https://www.uniprot.org/uniprot/O96020" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "O96020", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O96020" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "O96020", "url": "http://phospho.elm.eu.org/byAccession/O96020.html" } ], "site_lbl": "Ser21" }, { "start_pos": 383, "end_pos": 383, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O96020", "url": "https://www.uniprot.org/uniprot/O96020" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "iPTMnet", "id": "O96020", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O96020" } ], "site_lbl": "Ser383" }, { "start_pos": 392, "end_pos": 392, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O96020", "url": "https://www.uniprot.org/uniprot/O96020" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "iPTMnet", "id": "O96020", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O96020" }, { "database": "PubMed", "id": "9840943", "url": "https://glygen.org/publication/PubMed/9840943" }, { "database": "phospho.ELM", "id": "O96020", "url": "http://phospho.elm.eu.org/byAccession/O96020.html" }, { "database": "PubMed", "id": "19084516", "url": "https://glygen.org/publication/PubMed/19084516" } ], "site_lbl": "Thr392" }, { "start_pos": 396, "end_pos": 396, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O96020", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O96020" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "19084516", "url": "https://glygen.org/publication/PubMed/19084516" } ], "site_lbl": "Ser396" }, { "start_pos": 63, "end_pos": 63, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O96020", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O96020" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ], "site_lbl": "Ser63" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "p53- and ATM-dependent apoptosis induced by telomeres lacking TRF2.", "journal": "Science (New York, N.Y.)", "date": "1999", "authors": "Karlseder J, Broccoli D, Dai Y, Hardy S, de Lange T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "10037601", "url": "https://glygen.org/publication/PubMed/10037601" } ] }, { "title": "Cumulative effect of phosphorylation of pRB on regulation of E2F activity.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Brown VD, Phillips RA, Gallie BL", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "10207050", "url": "https://glygen.org/publication/PubMed/10207050" } ] }, { "title": "Ubiquitination of p27 is regulated by Cdk-dependent phosphorylation and trimeric complex formation.", "journal": "Genes & development", "date": "1999", "authors": "Montagnoli A, Fiore F, Eytan E, Carrano AC, Draetta GF, Hershko A, Pagano M", "evidence": [ { "database": "Reactome", "id": "R-HSA-187577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-187577" } ], "reference": [ { "type": "PubMed", "id": "10323868", "url": "https://glygen.org/publication/PubMed/10323868" } ] }, { "title": "Multistep regulation of DNA replication by Cdk phosphorylation of HsCdc6.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Jiang W, Wells NJ, Hunter T", "evidence": [ { "database": "Reactome", "id": "R-HSA-69017", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69017" } ], "reference": [ { "type": "PubMed", "id": "10339564", "url": "https://glygen.org/publication/PubMed/10339564" } ] }, { "title": "p27(Kip1) ubiquitination and degradation is regulated by the SCF(Skp2) complex through phosphorylated Thr187 in p27.", "journal": "Current biology : CB", "date": "1999", "authors": "Tsvetkov LM, Yeh KH, Lee SJ, Sun H, Zhang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-187577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-187577" } ], "reference": [ { "type": "PubMed", "id": "10375532", "url": "https://glygen.org/publication/PubMed/10375532" } ] }, { "title": "CDK inhibitors: positive and negative regulators of G1-phase progression.", "journal": "Genes & development", "date": "1999", "authors": "Sherr CJ, Roberts JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "10385618", "url": "https://glygen.org/publication/PubMed/10385618" } ] }, { "title": "Ectopic expression of Cdc25A accelerates the G(1)/S transition and leads to premature activation of cyclin E- and cyclin A-dependent kinases.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Blomberg I, Hoffmann I", "evidence": [ { "database": "Reactome", "id": "R-HSA-69200", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69200" } ], "reference": [ { "type": "PubMed", "id": "10454565", "url": "https://glygen.org/publication/PubMed/10454565" } ] }, { "title": "Cdk phosphorylation triggers sequential intramolecular interactions that progressively block Rb functions as cells move through G1.", "journal": "Cell", "date": "1999", "authors": "Harbour JW, Luo RX, Dei Santi A, Postigo AA, Dean DC", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "10499802", "url": "https://glygen.org/publication/PubMed/10499802" } ] }, { "title": "SKP2 is required for ubiquitin-mediated degradation of the CDK inhibitor p27.", "journal": "Nature cell biology", "date": "1999", "authors": "Carrano AC, Eytan E, Hershko A, Pagano M", "evidence": [ { "database": "Reactome", "id": "R-HSA-187577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-187577" } ], "reference": [ { "type": "PubMed", "id": "10559916", "url": "https://glygen.org/publication/PubMed/10559916" } ] }, { "title": "Control of human telomere length by TRF1 and TRF2.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Smogorzewska A, van Steensel B, Bianchi A, Oelmann S, Schaefer MR, Schnapp G, de Lange T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "10669743", "url": "https://glygen.org/publication/PubMed/10669743" } ] }, { "title": "Phosphorylation at serine 10, a major phosphorylation site of p27(Kip1), increases its protein stability.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Ishida N, Kitagawa M, Hatakeyama S, Nakayama K", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "10831586", "url": "https://glygen.org/publication/PubMed/10831586" } ] }, { "title": "MCG10, a novel p53 target gene that encodes a KH domain RNA-binding protein, is capable of inducing apoptosis and cell cycle arrest in G(2)-M.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Zhu J, Chen X", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804116", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804116" } ], "reference": [ { "type": "PubMed", "id": "10891498", "url": "https://glygen.org/publication/PubMed/10891498" } ] }, { "title": "Cell cycle- and cell growth-regulated proteolysis of mammalian CDC6 is dependent on APC-CDH1.", "journal": "Genes & development", "date": "2000", "authors": "Petersen BO, Wagener C, Marinoni F, Kramer ER, Melixetian M, Lazzerini Denchi E, Gieffers C, Matteucci C, Peters JM, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-69017", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69017" } ], "reference": [ { "type": "PubMed", "id": "10995389", "url": "https://glygen.org/publication/PubMed/10995389" } ] }, { "title": "Downregulation of cyclin D1 alters cdk 4- and cdk 2-specific phosphorylation of retinoblastoma protein.", "journal": "Molecular cell biology research communications : MCBRC", "date": "2000", "authors": "Yu B, Lane ME, Pestell RG, Albanese C, Wadler S", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "11032757", "url": "https://glygen.org/publication/PubMed/11032757" } ] }, { "title": "Chromatin association of human origin recognition complex, cdc6, and minichromosome maintenance proteins during the cell cycle: assembly of prereplication complexes in late mitosis.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Mendez J, Stillman B", "evidence": [ { "database": "Reactome", "id": "R-HSA-69017", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69017" } ], "reference": [ { "type": "PubMed", "id": "11046155", "url": "https://glygen.org/publication/PubMed/11046155" } ] }, { "title": "Analysis of cyclin D3-cdk4 complexes in fibroblasts expressing and lacking p27(kip1) and p21(cip1).", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Bagui TK, Jackson RJ, Agrawal D, Pledger WJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "11073976", "url": "https://glygen.org/publication/PubMed/11073976" } ] }, { "title": "Phosphorylation-dependent and -independent functions of p130 cooperate to evoke a sustained G1 block.", "journal": "The EMBO journal", "date": "2001", "authors": "Hansen K, Farkas T, Lukas J, Holm K, Ronnstrand L, Bartek J", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "11157749", "url": "https://glygen.org/publication/PubMed/11157749" } ] }, { "title": "Cytoplasmic localization of p21Cip1/WAF1 by Akt-induced phosphorylation in HER-2/neu-overexpressing cells.", "journal": "Nature cell biology", "date": "2001", "authors": "Zhou BP, Liao Y, Xia W, Spohn B, Lee MH, Hung MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "11231573", "url": "https://glygen.org/publication/PubMed/11231573" } ] }, { "title": "The cell-cycle regulatory protein Cks1 is required for SCF(Skp2)-mediated ubiquitinylation of p27.", "journal": "Nature cell biology", "date": "2001", "authors": "Ganoth D, Bornstein G, Ko TK, Larsen B, Tyers M, Pagano M, Hershko A", "evidence": [ { "database": "Reactome", "id": "R-HSA-187577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-187577" } ], "reference": [ { "type": "PubMed", "id": "11231585", "url": "https://glygen.org/publication/PubMed/11231585" } ] }, { "title": "Differential regulation of retinoblastoma tumor suppressor protein by G(1) cyclin-dependent kinase complexes in vivo.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Ezhevsky SA, Ho A, Becker-Hapak M, Davis PK, Dowdy SF", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "11416152", "url": "https://glygen.org/publication/PubMed/11416152" } ] }, { "title": "Nuclear retention of ATM at sites of DNA double strand breaks.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Andegeko Y, Moyal L, Mittelman L, Tsarfaty I, Shiloh Y, Rotman G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "11454856", "url": "https://glygen.org/publication/PubMed/11454856" } ] }, { "title": "Cables enhances cdk2 tyrosine 15 phosphorylation by Wee1, inhibits cell growth, and is lost in many human colon and squamous cancers.", "journal": "Cancer research", "date": "2001", "authors": "Wu CL, Kirley SD, Xiao H, Chuang Y, Chung DC, Zukerberg LR", "evidence": [ { "database": "Reactome", "id": "R-HSA-69202", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69202" } ], "reference": [ { "type": "PubMed", "id": "11585773", "url": "https://glygen.org/publication/PubMed/11585773" } ] }, { "title": "The E2F1-3 transcription factors are essential for cellular proliferation.", "journal": "Nature", "date": "2001", "authors": "Wu L, Timmers C, Maiti B, Saavedra HI, Sang L, Chong GT, Nuckolls F, Giangrande P, Wright FA, Field SJ, Greenberg ME, Orkin S, Nevins JR, Robinson ML, Leone G", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "11719808", "url": "https://glygen.org/publication/PubMed/11719808" } ] }, { "title": "A functional screen identifies hDRIL1 as an oncogene that rescues RAS-induced senescence.", "journal": "Nature cell biology", "date": "2002", "authors": "Peeper DS, Shvarts A, Brummelkamp T, Douma S, Koh EY, Daley GQ, Bernards R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804116", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804116" } ], "reference": [ { "type": "PubMed", "id": "11812999", "url": "https://glygen.org/publication/PubMed/11812999" } ] }, { "title": "Reversal of growth suppression by p107 via direct phosphorylation by cyclin D1/cyclin-dependent kinase 4.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Leng X, Noble M, Adams PD, Qin J, Harper JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "11884610", "url": "https://glygen.org/publication/PubMed/11884610" } ] }, { "title": "Cyclin A- and cyclin E-Cdk complexes shuttle between the nucleus and the cytoplasm.", "journal": "Molecular biology of the cell", "date": "2002", "authors": "Jackman M, Kubota Y, den Elzen N, Hagting A, Pines J", "evidence": [ { "database": "Reactome", "id": "R-HSA-69202", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69202" } ], "reference": [ { "type": "PubMed", "id": "11907280", "url": "https://glygen.org/publication/PubMed/11907280" } ] }, { "title": "Human telomeric position effect is determined by chromosomal context and telomeric chromatin integrity.", "journal": "EMBO reports", "date": "2002", "authors": "Koering CE, Pollice A, Zibella MP, Bauwens S, Puisieux A, Brunori M, Brun C, Martins L, Sabatier L, Pulitzer JF, Gilson E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "12393752", "url": "https://glygen.org/publication/PubMed/12393752" } ] }, { "title": "The pRb-related protein p130 is regulated by phosphorylation-dependent proteolysis via the protein-ubiquitin ligase SCF(Skp2).", "journal": "Genes & development", "date": "2002", "authors": "Tedesco D, Lukas J, Reed SI", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "12435635", "url": "https://glygen.org/publication/PubMed/12435635" } ] }, { "title": "Activation of cyclin D1-kinase in murine fibroblasts lacking both p21(Cip1) and p27(Kip1).", "journal": "Oncogene", "date": "2002", "authors": "Sugimoto M, Martin N, Wilks DP, Tamai K, Huot TJ, Pantoja C, Okumura K, Serrano M, Hara E", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "12444543", "url": "https://glygen.org/publication/PubMed/12444543" } ] }, { "title": "Assembly of the SMRT-histone deacetylase 3 repression complex requires the TCP-1 ring complex.", "journal": "Genes & development", "date": "2002", "authors": "Guenther MG, Yu J, Kao GD, Yen TJ, Lazar MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-390471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-390471" } ], "reference": [ { "type": "PubMed", "id": "12502735", "url": "https://glygen.org/publication/PubMed/12502735" } ] }, { "title": "DNA damage activates ATM through intermolecular autophosphorylation and dimer dissociation.", "journal": "Nature", "date": "2003", "authors": "Bakkenist CJ, Kastan MB", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "12556884", "url": "https://glygen.org/publication/PubMed/12556884" } ] }, { "title": "E2FBP1/DRIL1, an AT-rich interaction domain-family transcription factor, is regulated by p53.", "journal": "Molecular cancer research : MCR", "date": "2003", "authors": "Ma K, Araki K, Ichwan SJ, Suganuma T, Tamamori-Adachi M, Ikeda MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804116", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804116" } ], "reference": [ { "type": "PubMed", "id": "12692263", "url": "https://glygen.org/publication/PubMed/12692263" } ] }, { "title": "Identification and properties of an atypical catalytic subunit (p34PSK-J3/cdk4) for mammalian D type G1 cyclins.", "journal": "Cell", "date": "1992", "authors": "Matsushime H, Ewen ME, Strom DK, Kato JY, Hanks SK, Roussel MF, Sherr CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "1423597", "url": "https://glygen.org/publication/PubMed/1423597" } ] }, { "title": "P27Kip1 and p21Cip1 are not required for the formation of active D cyclin-cdk4 complexes.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Bagui TK, Mohapatra S, Haura E, Pledger WJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "14517297", "url": "https://glygen.org/publication/PubMed/14517297" } ] }, { "title": "Requirement of the MRN complex for ATM activation by DNA damage.", "journal": "The EMBO journal", "date": "2003", "authors": "Uziel T, Lerenthal Y, Moyal L, Andegeko Y, Mittelman L, Shiloh Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "14532133", "url": "https://glygen.org/publication/PubMed/14532133" } ] }, { "title": "p53 functions through stress- and promoter-specific recruitment of transcription initiation components before and after DNA damage.", "journal": "Molecular cell", "date": "2003", "authors": "Espinosa JM, Verdun RE, Emerson BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804116", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804116" } ], "reference": [ { "type": "PubMed", "id": "14580351", "url": "https://glygen.org/publication/PubMed/14580351" } ] }, { "title": "The cyclin D3-CDK4-p27kip1 holoenzyme in thyroid epithelial cells: activation by TSH, inhibition by TGFbeta, and phosphorylations of its subunits demonstrated by two-dimensional gel electrophoresis.", "journal": "Experimental cell research", "date": "2003", "authors": "Coulonval K, Bockstaele L, Paternot S, Dumont JE, Roger PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "14597415", "url": "https://glygen.org/publication/PubMed/14597415" } ] }, { "title": "E2F7, a novel E2F featuring DP-independent repression of a subset of E2F-regulated genes.", "journal": "The EMBO journal", "date": "2003", "authors": "Di Stefano L, Jensen MR, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804116", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804116" } ], "reference": [ { "type": "PubMed", "id": "14633988", "url": "https://glygen.org/publication/PubMed/14633988" } ] }, { "title": "Direct activation of the ATM protein kinase by the Mre11/Rad50/Nbs1 complex.", "journal": "Science (New York, N.Y.)", "date": "2004", "authors": "Lee JH, Paull TT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "15064416", "url": "https://glygen.org/publication/PubMed/15064416" } ] }, { "title": "E2F-7: a distinctive E2F family member with an unusual organization of DNA-binding domains.", "journal": "Oncogene", "date": "2004", "authors": "Logan N, Delavaine L, Graham A, Reilly C, Wilson J, Brummelkamp TR, Hijmans EM, Bernards R, La Thangue NB", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804116", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804116" } ], "reference": [ { "type": "PubMed", "id": "15133492", "url": "https://glygen.org/publication/PubMed/15133492" } ] }, { "title": "Noncatalytic requirement for cyclin A-cdk2 in p27 turnover.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Zhu XH, Nguyen H, Halicka HD, Traganos F, Koff A", "evidence": [ { "database": "Reactome", "id": "R-HSA-187577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-187577" } ], "reference": [ { "type": "PubMed", "id": "15199159", "url": "https://glygen.org/publication/PubMed/15199159" } ] }, { "title": "Choreography of the DNA damage response: spatiotemporal relationships among checkpoint and repair proteins.", "journal": "Cell", "date": "2004", "authors": "Lisby M, Barlow JH, Burgess RC, Rothstein R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "15369670", "url": "https://glygen.org/publication/PubMed/15369670" } ] }, { "title": "Distribution and dynamics of chromatin modification induced by a defined DNA double-strand break.", "journal": "Current biology : CB", "date": "2004", "authors": "Shroff R, Arbel-Eden A, Pilch D, Ira G, Bonner WM, Petrini JH, Haber JE, Lichten M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "15458641", "url": "https://glygen.org/publication/PubMed/15458641" } ] }, { "title": "An Rb-Skp2-p27 pathway mediates acute cell cycle inhibition by Rb and is retained in a partial-penetrance Rb mutant.", "journal": "Molecular cell", "date": "2004", "authors": "Ji P, Jiang H, Rekhtman K, Bloom J, Ichetovkin M, Pagano M, Zhu L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9661069", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9661069" } ], "reference": [ { "type": "PubMed", "id": "15469821", "url": "https://glygen.org/publication/PubMed/15469821" } ] }, { "title": "Autophosphorylation of ataxia-telangiectasia mutated is regulated by protein phosphatase 2A.", "journal": "The EMBO journal", "date": "2004", "authors": "Goodarzi AA, Jonnalagadda JC, Douglas P, Young D, Ye R, Moorhead GB, Lees-Miller SP, Khanna KK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "15510216", "url": "https://glygen.org/publication/PubMed/15510216" } ] }, { "title": "Phosphorylation of p27Kip1 at Thr-157 interferes with its association with importin alpha during G1 and prevents nuclear re-entry.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Shin I, Rotty J, Wu FY, Arteaga CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "15579463", "url": "https://glygen.org/publication/PubMed/15579463" } ] }, { "title": "The p400 E1A-associated protein is a novel component of the p53 --> p21 senescence pathway.", "journal": "Genes & development", "date": "2005", "authors": "Chan HM, Narita M, Lowe SW, Livingston DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "15655109", "url": "https://glygen.org/publication/PubMed/15655109" } ] }, { "title": "Cloning and characterization of mouse E2F8, a novel mammalian E2F family member capable of blocking cellular proliferation.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Maiti B, Li J, de Bruin A, Gordon F, Timmers C, Opavsky R, Patil K, Tuttle J, Cleghorn W, Leone G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804116", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804116" } ], "reference": [ { "type": "PubMed", "id": "15722552", "url": "https://glygen.org/publication/PubMed/15722552" } ] }, { "title": "ATM activation by DNA double-strand breaks through the Mre11-Rad50-Nbs1 complex.", "journal": "Science (New York, N.Y.)", "date": "2005", "authors": "Lee JH, Paull TT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "15790808", "url": "https://glygen.org/publication/PubMed/15790808" } ] }, { "title": "A role for the Tip60 histone acetyltransferase in the acetylation and activation of ATM.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Sun Y, Jiang X, Chen S, Fernandes N, Price BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "16141325", "url": "https://glygen.org/publication/PubMed/16141325" } ] }, { "title": "Shelterin: the protein complex that shapes and safeguards human telomeres.", "journal": "Genes & development", "date": "2005", "authors": "de Lange T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "16166375", "url": "https://glygen.org/publication/PubMed/16166375" } ] }, { "title": "Tyrosine phosphorylation modulates binding preference to cyclin-dependent kinases and subcellular localization of p27Kip1 in the acute promyelocytic leukemia cell line NB4.", "journal": "Blood", "date": "2006", "authors": "Kardinal C, Dangers M, Kardinal A, Koch A, Brandt DT, Tamura T, Welte K", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "16195327", "url": "https://glygen.org/publication/PubMed/16195327" } ] }, { "title": "Structural basis of the Cks1-dependent recognition of p27(Kip1) by the SCF(Skp2) ubiquitin ligase.", "journal": "Molecular cell", "date": "2005", "authors": "Hao B, Zheng N, Schulman BA, Wu G, Miller JJ, Pagano M, Pavletich NP", "evidence": [ { "database": "Reactome", "id": "R-HSA-187577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-187577" } ], "reference": [ { "type": "PubMed", "id": "16209941", "url": "https://glygen.org/publication/PubMed/16209941" } ] }, { "title": "Ubiquitination of p21Cip1/WAF1 by SCFSkp2: substrate requirement and ubiquitination site selection.", "journal": "Biochemistry", "date": "2005", "authors": "Wang W, Nacusi L, Sheaff RJ, Liu X", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "16262255", "url": "https://glygen.org/publication/PubMed/16262255" } ] }, { "title": "Regulated activating Thr172 phosphorylation of cyclin-dependent kinase 4(CDK4): its relationship with cyclins and CDK `inhibitors`.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Bockstaele L, Kooken H, Libert F, Paternot S, Dumont JE, de Launoit Y, Roger PP, Coulonval K", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "16782892", "url": "https://glygen.org/publication/PubMed/16782892" } ] }, { "title": "Involvement of novel autophosphorylation sites in ATM activation.", "journal": "The EMBO journal", "date": "2006", "authors": "Kozlov SV, Graham ME, Peng C, Chen P, Robinson PJ, Lavin MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "16858402", "url": "https://glygen.org/publication/PubMed/16858402" } ] }, { "title": "Regulation of CDK4.", "journal": "Cell division", "date": "2006", "authors": "Bockstaele L, Coulonval K, Kooken H, Paternot S, Roger PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "17092340", "url": "https://glygen.org/publication/PubMed/17092340" } ] }, { "title": "Cdk-inhibitory activity and stability of p27Kip1 are directly regulated by oncogenic tyrosine kinases.", "journal": "Cell", "date": "2007", "authors": "Grimmler M, Wang Y, Mund T, Cilensek Z, Keidel EM, Waddell MB, Jakel H, Kullmann M, Kriwacki RW, Hengst L", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "17254966", "url": "https://glygen.org/publication/PubMed/17254966" } ] }, { "title": "p27 phosphorylation by Src regulates inhibition of cyclin E-Cdk2.", "journal": "Cell", "date": "2007", "authors": "Chu I, Sun J, Arnaout A, Kahn H, Hanna W, Narod S, Sun P, Tan CK, Hengst L, Slingerland J", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "17254967", "url": "https://glygen.org/publication/PubMed/17254967" } ] }, { "title": "MRE11-RAD50-NBS1 and ATM function as co-mediators of TRF1 in telomere length control.", "journal": "Nature structural & molecular biology", "date": "2007", "authors": "Wu Y, Xiao S, Zhu XD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "17694070", "url": "https://glygen.org/publication/PubMed/17694070" } ] }, { "title": "Hzf Determines cell survival upon genotoxic stress by modulating p53 transactivation.", "journal": "Cell", "date": "2007", "authors": "Das S, Raj L, Zhao B, Kimura Y, Bernstein A, Aaronson SA, Lee SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804116", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804116" } ], "reference": [ { "type": "PubMed", "id": "17719541", "url": "https://glygen.org/publication/PubMed/17719541" } ] }, { "title": "Differential modification of p27Kip1 controls its cyclin D-cdk4 inhibitory activity.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "James MK, Ray A, Leznova D, Blain SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "17908796", "url": "https://glygen.org/publication/PubMed/17908796" } ] }, { "title": "DNA damage-induced acetylation of lysine 3016 of ATM activates ATM kinase activity.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Sun Y, Xu Y, Roy K, Price BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "17923702", "url": "https://glygen.org/publication/PubMed/17923702" } ] }, { "title": "Synergistic function of E2F7 and E2F8 is essential for cell survival and embryonic development.", "journal": "Developmental cell", "date": "2008", "authors": "Li J, Ran C, Li E, Gordon F, Comstock G, Siddiqui H, Cleghorn W, Chen HZ, Kornacker K, Liu CG, Pandit SK, Khanizadeh M, Weinstein M, Leone G, de Bruin A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804116", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804116" } ], "reference": [ { "type": "PubMed", "id": "18194653", "url": "https://glygen.org/publication/PubMed/18194653" } ] }, { "title": "DNA-damage response control of E2F7 and E2F8.", "journal": "EMBO reports", "date": "2008", "authors": "Zalmas LP, Zhao X, Graham AL, Fisher R, Reilly C, Coutts AS, La Thangue NB", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804116", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804116" } ], "reference": [ { "type": "PubMed", "id": "18202719", "url": "https://glygen.org/publication/PubMed/18202719" } ] }, { "title": "Nonfunctional mutants of the retinoblastoma protein are characterized by defects in phosphorylation, viral oncoprotein association, and nuclear tethering.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1991", "authors": "Templeton DJ, Park SH, Lanier L, Weinberg RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9661069", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9661069" } ], "reference": [ { "type": "PubMed", "id": "1826560", "url": "https://glygen.org/publication/PubMed/1826560" } ] }, { "title": "The E2F transcription factor is a cellular target for the RB protein.", "journal": "Cell", "date": "1991", "authors": "Chellappan SP, Hiebert S, Mudryj M, Horowitz JM, Nevins JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "1828392", "url": "https://glygen.org/publication/PubMed/1828392" } ] }, { "title": "The retinoblastoma protein copurifies with E2F-I, an E1A-regulated inhibitor of the transcription factor E2F.", "journal": "Cell", "date": "1991", "authors": "Bagchi S, Weinmann R, Raychaudhuri P", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "1828393", "url": "https://glygen.org/publication/PubMed/1828393" } ] }, { "title": "The T/E1A-binding domain of the retinoblastoma product can interact selectively with a sequence-specific DNA-binding protein.", "journal": "Cell", "date": "1991", "authors": "Chittenden T, Livingston DM, Kaelin WG Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "1828394", "url": "https://glygen.org/publication/PubMed/1828394" } ] }, { "title": "Switching cyclin D-Cdk4 kinase activity on and off.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2008", "authors": "Blain SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "18414028", "url": "https://glygen.org/publication/PubMed/18414028" } ] }, { "title": "HP1-beta mobilization promotes chromatin changes that initiate the DNA damage response.", "journal": "Nature", "date": "2008", "authors": "Ayoub N, Jeyasekharan AD, Bernal JA, Venkitaraman AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "18438399", "url": "https://glygen.org/publication/PubMed/18438399" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "O96020", "url": "https://www.uniprot.org/uniprot/O96020" }, { "database": "iPTMnet", "id": "O96020-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O96020-1" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.", "journal": "Molecular cell", "date": "2008", "authors": "Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O96020", "url": "https://www.uniprot.org/uniprot/O96020" }, { "database": "iPTMnet", "id": "O96020-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O96020-1" } ], "reference": [ { "type": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ] }, { "title": "Phosphorylation of p27Kip1 regulates assembly and activation of cyclin D1-Cdk4.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Larrea MD, Liang J, Da Silva T, Hong F, Shao SH, Han K, Dumont D, Slingerland JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "18710949", "url": "https://glygen.org/publication/PubMed/18710949" } ] }, { "title": "Brk is coamplified with ErbB2 to promote proliferation in breast cancer.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Xiang B, Chatti K, Qiu H, Lakshmi B, Krasnitz A, Hicks J, Yu M, Miller WT, Muthuswamy SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-187577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-187577" } ], "reference": [ { "type": "PubMed", "id": "18719096", "url": "https://glygen.org/publication/PubMed/18719096" } ] }, { "title": "The CCT/TRiC chaperonin is required for maturation of sphingosine kinase 1.", "journal": "The international journal of biochemistry & cell biology", "date": "2009", "authors": "Zebol JR, Hewitt NM, Moretti PA, Lynn HE, Lake JA, Li P, Vadas MA, Wattenberg BW, Pitson SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-390471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-390471" } ], "reference": [ { "type": "PubMed", "id": "18775504", "url": "https://glygen.org/publication/PubMed/18775504" } ] }, { "title": "Migratory localization of cyclin D2-Cdk4 complex suggests a spatial regulation of the G1-S transition.", "journal": "Cell structure and function", "date": "2008", "authors": "Wang Z, Xie Y, Zhang L, Zhang H, An X, Wang T, Meng A", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "18827403", "url": "https://glygen.org/publication/PubMed/18827403" } ] }, { "title": "Defining the TRiC/CCT interactome links chaperonin function to stabilization of newly made proteins with complex topologies.", "journal": "Nature structural & molecular biology", "date": "2008", "authors": "Yam AY, Xia Y, Lin HT, Burlingame A, Gerstein M, Frydman J", "evidence": [ { "database": "Reactome", "id": "R-HSA-390471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-390471" } ], "reference": [ { "type": "PubMed", "id": "19011634", "url": "https://glygen.org/publication/PubMed/19011634" } ] }, { "title": "p27Kip1 inhibits cyclin D-cyclin-dependent kinase 4 by two independent modes.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Ray A, James MK, Larochelle S, Fisher RP, Blain SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "19075005", "url": "https://glygen.org/publication/PubMed/19075005" } ] }, { "title": "SCF(Fbxw7/hCdc4) targets cyclin E2 for ubiquitin-dependent proteolysis.", "journal": "Experimental cell research", "date": "2009", "authors": "Klotz K, Cepeda D, Tan Y, Sun D, Sangfelt O, Spruck C", "evidence": [ { "database": "iPTMnet", "id": "O96020", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O96020" } ], "reference": [ { "type": "PubMed", "id": "19084516", "url": "https://glygen.org/publication/PubMed/19084516" } ] }, { "title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.", "journal": "Analytical chemistry", "date": "2009", "authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S", "evidence": [ { "database": "iPTMnet", "id": "O96020-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O96020-1" } ], "reference": [ { "type": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ] }, { "title": "Combined inhibition of MEK and mammalian target of rapamycin abolishes phosphorylation of cyclin-dependent kinase 4 in glioblastoma cell lines and prevents their proliferation.", "journal": "Cancer research", "date": "2009", "authors": "Paternot S, Roger PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "19458076", "url": "https://glygen.org/publication/PubMed/19458076" } ] }, { "title": "Differential regulation of cyclin-dependent kinase 4 (CDK4) and CDK6, evidence that CDK4 might not be activated by CDK7, and design of a CDK6 activating mutation.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Bockstaele L, Bisteau X, Paternot S, Roger PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "19487459", "url": "https://glygen.org/publication/PubMed/19487459" } ] }, { "title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.", "journal": "Science signaling", "date": "2009", "authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK", "evidence": [ { "database": "UniProtKB", "id": "O96020", "url": "https://www.uniprot.org/uniprot/O96020" }, { "database": "iPTMnet", "id": "O96020", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O96020" } ], "reference": [ { "type": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" } ] }, { "title": "Histone H3 methylation links DNA damage detection to activation of the tumour suppressor Tip60.", "journal": "Nature cell biology", "date": "2009", "authors": "Sun Y, Jiang X, Xu Y, Ayrapetov MK, Moreau LA, Whetstine JR, Price BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "19783983", "url": "https://glygen.org/publication/PubMed/19783983" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O96020-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O96020-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Rb inactivation in cell cycle and cancer: the puzzle of highly regulated activating phosphorylation of CDK4 versus constitutively active CDK-activating kinase.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2010", "authors": "Paternot S, Bockstaele L, Bisteau X, Kooken H, Coulonval K, Roger PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "20107323", "url": "https://glygen.org/publication/PubMed/20107323" } ] }, { "title": "B55alpha PP2A holoenzymes modulate the phosphorylation status of the retinoblastoma-related protein p107 and its activation.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Jayadeva G, Kurimchak A, Garriga J, Sotillo E, Davis AJ, Haines DS, Mumby M, Grana X", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "20663872", "url": "https://glygen.org/publication/PubMed/20663872" } ] }, { "title": "The cyclin-dependent kinase inhibitor p21 is regulated by RNA-binding protein PCBP4 via mRNA stability.", "journal": "Nucleic acids research", "date": "2011", "authors": "Scoumanne A, Cho SJ, Zhang J, Chen X", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804116", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804116" } ], "reference": [ { "type": "PubMed", "id": "20817677", "url": "https://glygen.org/publication/PubMed/20817677" } ] }, { "title": "Structural and functional analysis of cyclin D1 reveals p27 and substrate inhibitor binding requirements.", "journal": "ACS chemical biology", "date": "2010", "authors": "Liu S, Bolger JK, Kirkland LO, Premnath PN, McInnes C", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "20843055", "url": "https://glygen.org/publication/PubMed/20843055" } ] }, { "title": "p57Kip2 is a downstream effector of BCR-ABL kinase inhibitors in chronic myelogenous leukemia cells.", "journal": "Carcinogenesis", "date": "2011", "authors": "Borriello A, Caldarelli I, Bencivenga D, Cucciolla V, Oliva A, Usala E, Danise P, Ronzoni L, Perrotta S, Della Ragione F", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "20952511", "url": "https://glygen.org/publication/PubMed/20952511" } ] }, { "title": "Decreased glucocerebrosidase activity in Gaucher disease parallels quantitative enzyme loss due to abnormal interaction with TCP1 and c-Cbl.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Lu J, Chiang J, Iyer RR, Thompson E, Kaneski CR, Xu DS, Yang C, Chen M, Hodes RJ, Lonser RR, Brady RO, Zhuang Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-390471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-390471" } ], "reference": [ { "type": "PubMed", "id": "21098288", "url": "https://glygen.org/publication/PubMed/21098288" } ] }, { "title": "Phosphorylation of p27Kip1 by JAK2 directly links cytokine receptor signaling to cell cycle control.", "journal": "Oncogene", "date": "2011", "authors": "Jakel H, Weinl C, Hengst L", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "21423214", "url": "https://glygen.org/publication/PubMed/21423214" } ] }, { "title": "DYRK1A protein kinase promotes quiescence and senescence through DREAM complex assembly.", "journal": "Genes & development", "date": "2011", "authors": "Litovchick L, Florens LA, Swanson SK, Washburn MP, DeCaprio JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1538133", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1538133" } ], "reference": [ { "type": "PubMed", "id": "21498570", "url": "https://glygen.org/publication/PubMed/21498570" } ] }, { "title": "Incomplete folding upon binding mediates Cdk4/cyclin D complex activation by tyrosine phosphorylation of inhibitor p27 protein.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Ou L, Ferreira AM, Otieno S, Xiao L, Bashford D, Kriwacki RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "21715330", "url": "https://glygen.org/publication/PubMed/21715330" } ] }, { "title": "Chaperonin TRiC assists the refolding of sperm-specific glyceraldehyde-3-phosphate dehydrogenase.", "journal": "Archives of biochemistry and biophysics", "date": "2011", "authors": "Naletova IN, Popova KM, Eldarov MA, Kuravsky ML, Schmalhausen EV, Sevostyanova IA, Muronetz VI", "evidence": [ { "database": "Reactome", "id": "R-HSA-390471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-390471" } ], "reference": [ { "type": "PubMed", "id": "21995946", "url": "https://glygen.org/publication/PubMed/21995946" } ] }, { "title": "Cooperation between ARID3A and p53 in the transcriptional activation of p21WAF1 in response to DNA damage.", "journal": "Biochemical and biophysical research communications", "date": "2012", "authors": "Lestari W, Ichwan SJ, Otsu M, Yamada S, Iseki S, Shimizu S, Ikeda MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804116", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804116" } ], "reference": [ { "type": "PubMed", "id": "22172947", "url": "https://glygen.org/publication/PubMed/22172947" } ] }, { "title": "E2F7, a novel target, is up-regulated by p53 and mediates DNA damage-dependent transcriptional repression.", "journal": "Genes & development", "date": "2012", "authors": "Carvajal LA, Hamard PJ, Tonnessen C, Manfredi JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804116", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804116" } ], "reference": [ { "type": "PubMed", "id": "22802528", "url": "https://glygen.org/publication/PubMed/22802528" } ] }, { "title": "The atypical E2F family member E2F7 couples the p53 and RB pathways during cellular senescence.", "journal": "Genes & development", "date": "2012", "authors": "Aksoy O, Chicas A, Zeng T, Zhao Z, McCurrach M, Wang X, Lowe SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804116", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804116" } ], "reference": [ { "type": "PubMed", "id": "22802529", "url": "https://glygen.org/publication/PubMed/22802529" } ] }, { "title": "Tyrosine phosphorylation of the p21 cyclin-dependent kinase inhibitor facilitates the development of proneural glioma.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Hukkelhoven E, Liu Y, Yeh N, Ciznadija D, Blain SW, Koff A", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "23007395", "url": "https://glygen.org/publication/PubMed/23007395" } ] }, { "title": "E2F8 is essential for polyploidization in mammalian cells.", "journal": "Nature cell biology", "date": "2012", "authors": "Pandit SK, Westendorp B, Nantasanti S, van Liere E, Tooten PC, Cornelissen PW, Toussaint MJ, Lamers WH, de Bruin A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804116", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804116" } ], "reference": [ { "type": "PubMed", "id": "23064264", "url": "https://glygen.org/publication/PubMed/23064264" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "O96020", "url": "https://www.uniprot.org/uniprot/O96020" }, { "database": "iPTMnet", "id": "O96020", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O96020" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Telomeres shorten during ageing of human fibroblasts.", "journal": "Nature", "date": "1990", "authors": "Harley CB, Futcher AB, Greider CW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "2342578", "url": "https://glygen.org/publication/PubMed/2342578" } ] }, { "title": "A Cdk7-Cdk4 T-loop phosphorylation cascade promotes G1 progression.", "journal": "Molecular cell", "date": "2013", "authors": "Schachter MM, Merrick KA, Larochelle S, Hirschi A, Zhang C, Shokat KM, Rubin SM, Fisher RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "23622515", "url": "https://glygen.org/publication/PubMed/23622515" } ] }, { "title": "CDK4 T172 phosphorylation is central in a CDK7-dependent bidirectional CDK4/CDK2 interplay mediated by p21 phosphorylation at the restriction point.", "journal": "PLoS genetics", "date": "2013", "authors": "Bisteau X, Paternot S, Colleoni B, Ecker K, Coulonval K, De Groote P, Declercq W, Hengst L, Roger PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "23737759", "url": "https://glygen.org/publication/PubMed/23737759" } ] }, { "title": "Interaction of p53 with the CCT complex promotes protein folding and wild-type p53 activity.", "journal": "Molecular cell", "date": "2013", "authors": "Trinidad AG, Muller PA, Cuellar J, Klejnot M, Nobis M, Valpuesta JM, Vousden KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-390471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-390471" } ], "reference": [ { "type": "PubMed", "id": "23747015", "url": "https://glygen.org/publication/PubMed/23747015" } ] }, { "title": "Telomere reduction in human colorectal carcinoma and with ageing.", "journal": "Nature", "date": "1990", "authors": "Hastie ND, Dempster M, Dunlop MG, Thompson AM, Green DK, Allshire RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "2392154", "url": "https://glygen.org/publication/PubMed/2392154" } ] }, { "title": "Genetic characterization of the role of the Cip/Kip family of proteins as cyclin-dependent kinase inhibitors and assembly factors.", "journal": "Molecular and cellular biology", "date": "2014", "authors": "Cerqueira A, Martin A, Symonds CE, Odajima J, Dubus P, Barbacid M, Santamaria D", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "24515438", "url": "https://glygen.org/publication/PubMed/24515438" } ] }, { "title": "Modulation of STAT3 folding and function by TRiC/CCT chaperonin.", "journal": "PLoS biology", "date": "2014", "authors": "Kasembeli M, Lau WC, Roh SH, Eckols TK, Frydman J, Chiu W, Tweardy DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-390471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-390471" } ], "reference": [ { "type": "PubMed", "id": "24756126", "url": "https://glygen.org/publication/PubMed/24756126" } ] }, { "title": "Cyclin D activates the Rb tumor suppressor by mono-phosphorylation.", "journal": "eLife", "date": "2014", "authors": "Narasimha AM, Kaulich M, Shapiro GS, Choi YJ, Sicinski P, Dowdy SF", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "24876129", "url": "https://glygen.org/publication/PubMed/24876129" } ] }, { "title": "Dimer monomer transition and dimer re-formation play important role for ATM cellular function during DNA repair.", "journal": "Biochemical and biophysical research communications", "date": "2014", "authors": "Du F, Zhang M, Li X, Yang C, Meng H, Wang D, Chang S, Xu Y, Price B, Sun Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "25240135", "url": "https://glygen.org/publication/PubMed/25240135" } ] }, { "title": "The molecular chaperone TRiC/CCT binds to the Trp-Asp 40 (WD40) repeat protein WDR68 and promotes its folding, protein kinase DYRK1A binding, and nuclear accumulation.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Miyata Y, Shibata T, Aoshima M, Tsubata T, Nishida E", "evidence": [ { "database": "Reactome", "id": "R-HSA-390471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-390471" } ], "reference": [ { "type": "PubMed", "id": "25342745", "url": "https://glygen.org/publication/PubMed/25342745" } ] }, { "title": "Proteostatic control of telomerase function through TRiC-mediated folding of TCAB1.", "journal": "Cell", "date": "2014", "authors": "Freund A, Zhong FL, Venteicher AS, Meng Z, Veenstra TD, Frydman J, Artandi SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-390471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-390471" } ], "reference": [ { "type": "PubMed", "id": "25467444", "url": "https://glygen.org/publication/PubMed/25467444" } ] }, { "title": "Brk/Protein tyrosine kinase 6 phosphorylates p27KIP1, regulating the activity of cyclin D-cyclin-dependent kinase 4.", "journal": "Molecular and cellular biology", "date": "2015", "authors": "Patel P, Asbach B, Shteyn E, Gomez C, Coltoff A, Bhuyan S, Tyner AL, Wagner R, Blain SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-187577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-187577" } ], "reference": [ { "type": "PubMed", "id": "25733683", "url": "https://glygen.org/publication/PubMed/25733683" } ] }, { "title": "Synergistic functions of E2F7 and E2F8 are critical to suppress stress-induced skin cancer.", "journal": "Oncogene", "date": "2017", "authors": "Thurlings I, Martinez-Lopez LM, Westendorp B, Zijp M, Kuiper R, Tooten P, Kent LN, Leone G, Vos HJ, Burgering B, de Bruin A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804116", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804116" } ], "reference": [ { "type": "PubMed", "id": "27452520", "url": "https://glygen.org/publication/PubMed/27452520" } ] }, { "title": "An Isotope-Coded Photocleavable Probe for Quantitative Profiling of Protein O-GlcNAcylation.", "journal": "ACS chemical biology", "date": "2019", "authors": "Li J, Li Z, Duan X, Qin K, Dang L, Sun S, Cai L, Hsieh-Wilson LC, Wu L, Yi W", "evidence": [ { "database": "O-GlcNAc Database", "id": "O96020", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O96020" }, { "database": "O-GlcNAc Atlas", "id": "O96020", "url": "https://oglcnac.org/atlas/detail/O96020" } ], "reference": [ { "type": "PubMed", "id": "30620550", "url": "https://glygen.org/publication/PubMed/30620550" } ] }, { "title": "A Code of Mono-phosphorylation Modulates the Function of RB.", "journal": "Molecular cell", "date": "2019", "authors": "Sanidas I, Morris R, Fella KA, Rumde PH, Boukhali M, Tai EC, Ting DT, Lawrence MS, Haas W, Dyson NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "30711375", "url": "https://glygen.org/publication/PubMed/30711375" } ] }, { "title": "Transient Hysteresis in CDK4/6 Activity Underlies Passage of the Restriction Point in G1.", "journal": "Molecular cell", "date": "2019", "authors": "Chung M, Liu C, Yang HW, Koberlin MS, Cappell SD, Meyer T", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "31543423", "url": "https://glygen.org/publication/PubMed/31543423" } ] }, { "title": "SP1-induced overexpression of LINC00520 facilitates non-small cell lung cancer progression through miR-577/CCNE2 pathway and predicts poor prognosis.", "journal": "Human cell", "date": "2021", "authors": "Wang JF, Xi ZN, Su HJ, Bao Z, Qiao YH", "evidence": [ { "database": "RefSeq", "id": "NP_477097", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_477097" } ], "reference": [ { "type": "PubMed", "id": "33728585", "url": "https://glygen.org/publication/PubMed/33728585" } ] }, { "title": "Vascular endothelial cell-derived exosomal miR-30a-5p inhibits lung adenocarcinoma malignant progression by targeting CCNE2.", "journal": "Carcinogenesis", "date": "2021", "authors": "Tao K, Liu J, Liang J, Xu X, Xu L, Mao W", "evidence": [ { "database": "RefSeq", "id": "NP_477097", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_477097" } ], "reference": [ { "type": "PubMed", "id": "34128973", "url": "https://glygen.org/publication/PubMed/34128973" } ] }, { "title": "E2F transcription factor 1 (E2F1) promotes the transforming growth factor TGF-beta1 induced human cardiac fibroblasts differentiation through promoting the transcription of CCNE2 gene.", "journal": "Bioengineered", "date": "2021", "authors": "Liao R, Xie B, Cui J, Qi Z, Xue S, Wang Y", "evidence": [ { "database": "RefSeq", "id": "NP_477097", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_477097" } ], "reference": [ { "type": "PubMed", "id": "34521301", "url": "https://glygen.org/publication/PubMed/34521301" } ] }, { "title": "Genome-wide chromatin contacts of super-enhancer-associated lncRNA identify LINC01013 as a regulator of fibrosis in the aortic valve.", "journal": "PLoS genetics", "date": "2022", "authors": "Chignon A, Argaud D, Boulanger MC, Mkannez G, Bon-Baret V, Li Z, Theriault S, Bosse Y, Mathieu P", "evidence": [ { "database": "RefSeq", "id": "NP_477097", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_477097" } ], "reference": [ { "type": "PubMed", "id": "35041643", "url": "https://glygen.org/publication/PubMed/35041643" } ] }, { "title": "Both p16 and p21 families of cyclin-dependent kinase (CDK) inhibitors block the phosphorylation of cyclin-dependent kinases by the CDK-activating kinase.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Aprelikova O, Xiong Y, Liu ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-69200", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69200" } ], "reference": [ { "type": "PubMed", "id": "7629134", "url": "https://glygen.org/publication/PubMed/7629134" } ] }, { "title": "Regulation of the human WEE1Hu CDK tyrosine 15-kinase during the cell cycle.", "journal": "The EMBO journal", "date": "1995", "authors": "Watanabe N, Broome M, Hunter T", "evidence": [ { "database": "Reactome", "id": "R-HSA-69202", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69202" } ], "reference": [ { "type": "PubMed", "id": "7743995", "url": "https://glygen.org/publication/PubMed/7743995" } ] }, { "title": "Regulation of the retinoblastoma protein-related p107 by G1 cyclin complexes.", "journal": "Genes & development", "date": "1995", "authors": "Beijersbergen RL, Carlee L, Kerkhoven RM, Bernards R", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "7797074", "url": "https://glygen.org/publication/PubMed/7797074" } ] }, { "title": "Effects of phosphorylation by CAK on cyclin binding by CDC2 and CDK2.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "Desai D, Wessling HC, Fisher RP, Morgan DO", "evidence": [ { "database": "Reactome", "id": "R-HSA-69202", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69202" } ], "reference": [ { "type": "PubMed", "id": "7799941", "url": "https://glygen.org/publication/PubMed/7799941" } ] }, { "title": "Cyclic AMP-induced G1 phase arrest mediated by an inhibitor (p27Kip1) of cyclin-dependent kinase 4 activation.", "journal": "Cell", "date": "1994", "authors": "Kato JY, Matsuoka M, Polyak K, Massague J, Sherr CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "7954814", "url": "https://glygen.org/publication/PubMed/7954814" } ] }, { "title": "Identification of G1 kinase activity for cdk6, a novel cyclin D partner.", "journal": "Molecular and cellular biology", "date": "1994", "authors": "Meyerson M, Harlow E", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "8114739", "url": "https://glygen.org/publication/PubMed/8114739" } ] }, { "title": "Regulation of cyclin D-dependent kinase 4 (cdk4) by cdk4-activating kinase.", "journal": "Molecular and cellular biology", "date": "1994", "authors": "Kato JY, Matsuoka M, Strom DK, Sherr CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "8139570", "url": "https://glygen.org/publication/PubMed/8139570" } ] }, { "title": "The p21 Cdk-interacting protein Cip1 is a potent inhibitor of G1 cyclin-dependent kinases.", "journal": "Cell", "date": "1993", "authors": "Harper JW, Adami GR, Wei N, Keyomarsi K, Elledge SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "8242751", "url": "https://glygen.org/publication/PubMed/8242751" } ] }, { "title": "WAF1, a potential mediator of p53 tumor suppression.", "journal": "Cell", "date": "1993", "authors": "el-Deiry WS, Tokino T, Velculescu VE, Levy DB, Parsons R, Trent JM, Lin D, Mercer WE, Kinzler KW, Vogelstein B", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "8242752", "url": "https://glygen.org/publication/PubMed/8242752" } ] }, { "title": "The retinoblastoma protein binds to a family of E2F transcription factors.", "journal": "Molecular and cellular biology", "date": "1993", "authors": "Lees JA, Saito M, Vidal M, Valentine M, Look T, Harlow E, Dyson N, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "8246996", "url": "https://glygen.org/publication/PubMed/8246996" } ] }, { "title": "A bipartite nuclear localization signal in the retinoblastoma gene product and its importance for biological activity.", "journal": "Molecular and cellular biology", "date": "1993", "authors": "Zacksenhaus E, Bremner R, Phillips RA, Gallie BL", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "8336704", "url": "https://glygen.org/publication/PubMed/8336704" } ] }, { "title": "Inhibition of E2F-1 transactivation by direct binding of the retinoblastoma protein.", "journal": "Molecular and cellular biology", "date": "1993", "authors": "Helin K, Harlow E, Fattaey A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9661069", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9661069" } ], "reference": [ { "type": "PubMed", "id": "8413249", "url": "https://glygen.org/publication/PubMed/8413249" } ] }, { "title": "Regions of the retinoblastoma gene product required for its interaction with the E2F transcription factor are necessary for E2 promoter repression and pRb-mediated growth suppression.", "journal": "Molecular and cellular biology", "date": "1993", "authors": "Hiebert SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "8497257", "url": "https://glygen.org/publication/PubMed/8497257" } ] }, { "title": "Cdc25 cell-cycle phosphatase as a target of c-myc.", "journal": "Nature", "date": "1996", "authors": "Galaktionov K, Chen X, Beach D", "evidence": [ { "database": "Reactome", "id": "R-HSA-69202", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69202" } ], "reference": [ { "type": "PubMed", "id": "8700224", "url": "https://glygen.org/publication/PubMed/8700224" } ] }, { "title": "The subcellular locations of p15(Ink4b) and p27(Kip1) coordinate their inhibitory interactions with cdk4 and cdk2.", "journal": "Genes & development", "date": "1997", "authors": "Reynisdottir I, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "9042862", "url": "https://glygen.org/publication/PubMed/9042862" } ] }, { "title": "New functional activities for the p21 family of CDK inhibitors.", "journal": "Genes & development", "date": "1997", "authors": "LaBaer J, Garrett MD, Stevenson LF, Slingerland JM, Sandhu C, Chou HS, Fattaey A, Harlow E", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "9106657", "url": "https://glygen.org/publication/PubMed/9106657" } ] }, { "title": "The subcellular localization of E2F-4 is cell-cycle dependent.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Lindeman GJ, Gaubatz S, Livingston DM, Ginsberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "9144196", "url": "https://glygen.org/publication/PubMed/9144196" } ] }, { "title": "Cyclin D1/Cdk4 regulates retinoblastoma protein-mediated cell cycle arrest by site-specific phosphorylation.", "journal": "Molecular biology of the cell", "date": "1997", "authors": "Connell-Crowley L, Harper JW, Goodrich DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "9190208", "url": "https://glygen.org/publication/PubMed/9190208" } ] }, { "title": "p130 and p107 use a conserved domain to inhibit cellular cyclin-dependent kinase activity.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Woo MS, Sanchez I, Dynlacht BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1538133", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1538133" } ], "reference": [ { "type": "PubMed", "id": "9199292", "url": "https://glygen.org/publication/PubMed/9199292" } ] }, { "title": "Differential interaction of the cyclin-dependent kinase (Cdk) inhibitor p27Kip1 with cyclin A-Cdk2 and cyclin D2-Cdk4.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Blain SW, Montalvo E, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "9325318", "url": "https://glygen.org/publication/PubMed/9325318" } ] }, { "title": "Incomplete penetrance of familial retinoblastoma linked to germ-line mutations that result in partial loss of RB function.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Otterson GA, Chen Wd, Coxon AB, Khleif SN, Kaye FJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9661069", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9661069" } ], "reference": [ { "type": "PubMed", "id": "9342358", "url": "https://glygen.org/publication/PubMed/9342358" } ] }, { "title": "Functional inactivation of the retinoblastoma protein requires sequential modification by at least two distinct cyclin-cdk complexes.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Lundberg AS, Weinberg RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "9447971", "url": "https://glygen.org/publication/PubMed/9447971" } ] }, { "title": "Assembly of cyclin D-dependent kinase and titration of p27Kip1 regulated by mitogen-activated protein kinase kinase (MEK1).", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Cheng M, Sexl V, Sherr CJ, Roussel MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "9448290", "url": "https://glygen.org/publication/PubMed/9448290" } ] }, { "title": "Identification of a substrate-targeting domain in cyclin E necessary for phosphorylation of the retinoblastoma protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Kelly BL, Wolfe KG, Roberts JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-69202", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69202" } ], "reference": [ { "type": "PubMed", "id": "9482921", "url": "https://glygen.org/publication/PubMed/9482921" } ] }, { "title": "A requirement for cyclin D3-cyclin-dependent kinase (cdk)-4 assembly in the cyclic adenosine monophosphate-dependent proliferation of thyrocytes.", "journal": "The Journal of cell biology", "date": "1998", "authors": "Depoortere F, Van Keymeulen A, Lukas J, Costagliola S, Bartkova J, Dumont JE, Bartek J, Roger PP, Dremier S", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "9508775", "url": "https://glygen.org/publication/PubMed/9508775" } ] }, { "title": "Cytoplasmic displacement of cyclin E-cdk2 inhibitors p21Cip1 and p27Kip1 in anchorage-independent cells.", "journal": "Oncogene", "date": "1998", "authors": "Orend G, Hunter T, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-69202", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69202" } ], "reference": [ { "type": "PubMed", "id": "9632134", "url": "https://glygen.org/publication/PubMed/9632134" } ] }, { "title": "The three members of the pocket proteins family share the ability to repress E2F activity through recruitment of a histone deacetylase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Ferreira R, Magnaghi-Jaulin L, Robin P, Harel-Bellan A, Trouche D", "evidence": [ { "database": "Reactome", "id": "R-HSA-1538133", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1538133" } ], "reference": [ { "type": "PubMed", "id": "9724731", "url": "https://glygen.org/publication/PubMed/9724731" } ] }, { "title": "Enhanced phosphorylation of p53 by ATM in response to DNA damage.", "journal": "Science (New York, N.Y.)", "date": "1998", "authors": "Banin S, Moyal L, Shieh S, Taya Y, Anderson CW, Chessa L, Smorodinsky NI, Prives C, Reiss Y, Shiloh Y, Ziv Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "9733514", "url": "https://glygen.org/publication/PubMed/9733514" } ] }, { "title": "Activation of the ATM kinase by ionizing radiation and phosphorylation of p53.", "journal": "Science (New York, N.Y.)", "date": "1998", "authors": "Canman CE, Lim DS, Cimprich KA, Taya Y, Tamai K, Sakaguchi K, Appella E, Kastan MB, Siliciano JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "9733515", "url": "https://glygen.org/publication/PubMed/9733515" } ] }, { "title": "A novel E2F binding protein with Myc-type HLH motif stimulates E2F-dependent transcription by forming a heterodimer.", "journal": "Oncogene", "date": "1998", "authors": "Suzuki M, Okuyama S, Okamoto S, Shirasuna K, Nakajima T, Hachiya T, Nojima H, Sekiya S, Oda K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804116", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804116" } ], "reference": [ { "type": "PubMed", "id": "9780002", "url": "https://glygen.org/publication/PubMed/9780002" } ] }, { "title": "Maturation of human cyclin E requires the function of eukaryotic chaperonin CCT.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Won KA, Schumacher RJ, Farr GW, Horwich AL, Reed SI", "evidence": [ { "database": "Reactome", "id": "R-HSA-390471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-390471" } ], "reference": [ { "type": "PubMed", "id": "9819444", "url": "https://glygen.org/publication/PubMed/9819444" } ] }, { "title": "Cyclin E2: a novel CDK2 partner in the late G1 and S phases of the mammalian cell cycle.", "journal": "Oncogene", "date": "1998", "authors": "Lauper N, Beck A R, Cariou S, Richman L, Hofmann K, Reith W, Slingerland J M, Amati B", "evidence": [ { "database": "UniProtKB", "id": "O96020", "url": "https://www.uniprot.org/uniprot/O96020" } ], "reference": [ { "type": "PubMed", "id": "9840927", "url": "https://glygen.org/publication/PubMed/9840927" } ] }, { "title": "Cyclin E2, a novel human G1 cyclin and activating partner of CDK2 and CDK3, is induced by viral oncoproteins.", "journal": "Oncogene", "date": "1998", "authors": "Zariwala M, Liu J, Xiong Y", "evidence": [ { "database": "UniProtKB", "id": "O96020", "url": "https://www.uniprot.org/uniprot/O96020" }, { "database": "iPTMnet", "id": "O96020-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O96020-1" } ], "reference": [ { "type": "PubMed", "id": "9840943", "url": "https://glygen.org/publication/PubMed/9840943" } ] }, { "title": "ATM associates with and phosphorylates p53: mapping the region of interaction.", "journal": "Nature genetics", "date": "1998", "authors": "Khanna KK, Keating KE, Kozlov S, Scott S, Gatei M, Hobson K, Taya Y, Gabrielli B, Chan D, Lees-Miller SP, Lavin MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "9843217", "url": "https://glygen.org/publication/PubMed/9843217" } ] }, { "title": "Cyclin E2, a novel G1 cyclin that binds Cdk2 and is aberrantly expressed in human cancers.", "journal": "Mol. Cell. Biol.", "date": "1999", "authors": "Gudas JM, Payton M, Thukral S, Chen E, Bass M, Robinson MO, Coats S", "evidence": [ { "database": "UniProtKB", "id": "O96020", "url": "https://www.uniprot.org/uniprot/O96020" } ], "reference": [ { "type": "PubMed", "id": "9858585", "url": "https://glygen.org/publication/PubMed/9858585" } ] }, { "title": "Retinoblastoma protein contains a C-terminal motif that targets it for phosphorylation by cyclin-cdk complexes.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Adams PD, Li X, Sellers WR, Baker KB, Leng X, Harper JW, Taya Y, Kaelin WG Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-69202", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69202" } ], "reference": [ { "type": "PubMed", "id": "9891042", "url": "https://glygen.org/publication/PubMed/9891042" } ] } ], "pathway": [ { "id": "hsa:9134", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9134", "resource": "KEGG Pathway" }, { "id": "R-HSA-1538133", "name": "G0 and Early G1", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1538133", "resource": "Reactome", "description": "G0 and Early G1" }, { "id": "R-HSA-187577", "name": "SCF(Skp2)-mediated degradation of p27/p21", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-187577", "resource": "Reactome", "description": "SCF(Skp2)-mediated degradation of p27/p21" }, { "id": "R-HSA-2559586", "name": "DNA Damage/Telomere Stress Induced Senescence", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586", "resource": "Reactome", "description": "DNA Damage/Telomere Stress Induced Senescence" }, { "id": "R-HSA-390471", "name": "Association of TriC/CCT with target proteins during biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-390471", "resource": "Reactome", "description": "Association of TriC/CCT with target proteins during biosynthesis" }, { "id": "R-HSA-6804116", "name": "TP53 Regulates Transcription of Genes Involved in G1 Cell Cycle Arrest", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804116", "resource": "Reactome", "description": "TP53 Regulates Transcription of Genes Involved in G1 Cell Cycle Arrest" }, { "id": "R-HSA-69017", "name": "CDK-mediated phosphorylation and removal of Cdc6", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69017", "resource": "Reactome", "description": "CDK-mediated phosphorylation and removal of Cdc6" }, { "id": "R-HSA-69200", "name": "Phosphorylation of proteins involved in G1/S transition by active Cyclin E:Cdk2 complexes", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69200", "resource": "Reactome", "description": "Phosphorylation of proteins involved in G1/S transition by active Cyclin E:Cdk2 complexes" }, { "id": "R-HSA-69202", "name": "Cyclin E associated events during G1/S transition", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69202", "resource": "Reactome", "description": "Cyclin E associated events during G1/S transition" }, { "id": "R-HSA-69231", "name": "Cyclin D associated events in G1", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231", "resource": "Reactome", "description": "Cyclin D associated events in G1" }, { "id": "R-HSA-69563", "name": "p53-Dependent G1 DNA Damage Response", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69563", "resource": "Reactome", "description": "p53-Dependent G1 DNA Damage Response" }, { "id": "R-HSA-9661069", "name": "Defective binding of RB1 mutants to E2F1,(E2F2, E2F3)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9661069", "resource": "Reactome", "description": "Defective binding of RB1 mutants to E2F1,(E2F2, E2F3)" } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZQ41-1", "protein_name": "Cyclin E2", "gene_name": "Ccne2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSRRSSRLQAKQQHARPNQPDSPQEAQIIQAKKRKTAQDVKKRTEEITKKHQYEIRNCWPPVLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWACSQEVWQNMLQKESRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDVNKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEVDILKMELNILKALKWELCPVTVISWLNLFLQVDAVKDIPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILAAAALCHFTSIEVVKKASGLEWDDISECVDWMVPFVSVVKSVSPVKLKTFKKIPMEDRHNIQTHTNYLALLNEVNYVNIFRKGGQLSPVCNGGIMTPPKSTEKPPVKF", "length": 405 }, "evidence": [ { "id": "45929339", "url": "http://www.informatics.jax.org/homology/45929339", "database": "MGI" }, { "id": "O96020", "url": "https://omabrowser.org/oma/group/O96020/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9Z238-1", "protein_name": "G1/S-specific cyclin-E2", "gene_name": "Ccne2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSRRSSRLQAKQHAQPNQPDSPQETQIIQAKKRKTAQDVKKRKEEITKKHQYEIRNCWPPVLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWACSQEVWQNMLQKENRYVHDKHFQVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDVNKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEVDILKMELNILKALKWELCPVTVISWLNLFLQVDAVKDVPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILAAAALCHFTSIEVVKKASGLEWDDISECVDWMVPFVSVVKSVSPVKLKTFKKIPMEDRHNIQTHTNYLALLNEVNYVNIYRKGGQLSPVCNGGIMTPPKSTEKPPGKH", "length": 404 }, "evidence": [ { "id": "45929339", "url": "http://www.informatics.jax.org/homology/45929339", "database": "MGI" }, { "id": "O96020", "url": "https://omabrowser.org/oma/group/O96020/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O96020", "url": "https://www.uniprot.org/uniprot/O96020" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "O96020", "url": "https://www.uniprot.org/uniprot/O96020" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O96020", "url": "https://www.uniprot.org/uniprot/O96020" } ], "pmid": "" }, { "name": "centrosome", "id": "GO:0005813", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005813", "evidence": [ { "database": "UniProtKB", "id": "O96020", "url": "https://www.uniprot.org/uniprot/O96020" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O96020", "url": "https://www.uniprot.org/uniprot/O96020" } ], "pmid": "" }, { "name": "cyclin E1-CDK2 complex", "id": "GO:0097134", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097134", "evidence": [ { "database": "UniProtKB", "id": "O96020", "url": "https://www.uniprot.org/uniprot/O96020" } ], "pmid": "" }, { "name": "cyclin E2-CDK2 complex", "id": "GO:0097135", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097135", "evidence": [ { "database": "UniProtKB", "id": "O96020", "url": "https://www.uniprot.org/uniprot/O96020" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "protein kinase binding", "id": "GO:0019901", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019901", "evidence": [ { "database": "UniProtKB", "id": "O96020", "url": "https://www.uniprot.org/uniprot/O96020" } ], "pmid": "" }, { "name": "cyclin-dependent protein serine/threonine kinase regulator activity", "id": "GO:0016538", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016538", "evidence": [ { "database": "UniProtKB", "id": "O96020", "url": "https://www.uniprot.org/uniprot/O96020" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "cell division", "id": "GO:0051301", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051301", "evidence": [ { "database": "UniProtKB", "id": "O96020", "url": "https://www.uniprot.org/uniprot/O96020" } ], "pmid": "" }, { "name": "telomere maintenance", "id": "GO:0000723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000723", "evidence": [ { "database": "UniProtKB", "id": "O96020", "url": "https://www.uniprot.org/uniprot/O96020" } ], "pmid": "" }, { "name": "regulation of protein localization", "id": "GO:0032880", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032880", "evidence": [ { "database": "UniProtKB", "id": "O96020", "url": "https://www.uniprot.org/uniprot/O96020" } ], "pmid": "" }, { "name": "regulation of cyclin-dependent protein serine/threonine kinase activity", "id": "GO:0000079", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000079", "evidence": [ { "database": "UniProtKB", "id": "O96020", "url": "https://www.uniprot.org/uniprot/O96020" } ], "pmid": "" }, { "name": "G1/S transition of mitotic cell cycle", "id": "GO:0000082", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000082", "evidence": [ { "database": "UniProtKB", "id": "O96020", "url": "https://www.uniprot.org/uniprot/O96020" } ], "pmid": "" }, { "name": "DNA replication initiation", "id": "GO:0006270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006270", "evidence": [ { "database": "UniProtKB", "id": "O96020", "url": "https://www.uniprot.org/uniprot/O96020" } ], "pmid": "" }, { "name": "homologous chromosome pairing at meiosis", "id": "GO:0007129", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007129", "evidence": [ { "database": "UniProtKB", "id": "O96020", "url": "https://www.uniprot.org/uniprot/O96020" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 35, 36 ], "snv_sites": [ 35, 36, 83, 120, 183, 320, 336, 373, 389 ], "glycation_sites": [], "phosphorylation_sites": [ 19, 21, 63, 383, 392, 396 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 9 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 8 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 158 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }