{
    "uniprot_canonical_ac": "O96002-1",
    "uniprot_ac": "O96002",
    "uniprot_id": "CX001_HUMAN",
    "mass": {
        "chemical_mass": 13452.0,
        "monoisotopic_mass": 13452.0
    },
    "refseq": {},
    "gene_names": [
        {
            "name": "CXorf1",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/O96002",
            "id": "O96002"
        }
    ],
    "protein_names": [
        {
            "name": "Putative transmembrane protein CXorf1",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "O96002"
        }
    ],
    "function": [],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Homo sapiens",
            "taxid": 9606,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O96002",
                    "url": "https://www.uniprot.org/uniprot/O96002"
                }
            ],
            "common_name": "Human"
        }
    ],
    "gene": [
        {
            "name": "CXorf1",
            "url": "https://www.uniprot.org/uniprot/O96002",
            "locus": {}
        }
    ],
    "crossref": [
        {
            "id": "O96002",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:O96002*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "300565",
            "url": "http://www.omim.org/entry/300565",
            "database": "MIM",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "NX_O96002",
            "url": "https://www.nextprot.org/entry/NX_O96002",
            "database": "neXtProt",
            "categories": [
                "Protein",
                "Organism-specific"
            ]
        },
        {
            "id": "O96002",
            "url": "https://pharos.nih.gov/targets/O96002",
            "database": "PHAROS",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "NP_004700",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004700",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "O96002",
            "url": "https://www.uniprot.org/uniprot/O96002",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "O96002-1",
            "url": "https://www.uniprot.org/uniprot/O96002-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MYSRLFYLKSSYIIYFEPLFSNAIINILSFINSLASPLTIFCFALSAQALSTIFYFRIFIFIFHSWILLFHFYFTCSFKTYEHQHSKMVPAYRMQSPRALPRTYLYVWPYK",
        "length": 111,
        "header": "sp|O96002-1|CX001_HUMAN Isoform 1 of Putative transmembrane protein CXorf1  OS=Homo sapiens OX=9606 GN=CXorf1 PE=5 SV=1 CANONICAL=O96002-1"
    },
    "isoforms": [
        {
            "isoform_ac": "O96002-1",
            "url": "",
            "sequence": {
                "sequence": "MYSRLFYLKSSYIIYFEPLFSNAIINILSFINSLASPLTIFCFALSAQALSTIFYFRIFIFIFHSWILLFHFYFTCSFKTYEHQHSKMVPAYRMQSPRALPRTYLYVWPYK",
                "length": 111,
                "header": "sp|O96002-1|CX001_HUMAN Isoform 1 of Putative transmembrane protein CXorf1  OS=Homo sapiens OX=9606 GN=CXorf1 PE=5 SV=1 CANONICAL=O96002-1"
            },
            "locus": {}
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "Identification of CXorf1, a novel intronless gene in Xq27.3 expressed in human hippocampus.",
            "journal": "DNA Cell Biol.",
            "date": "1998",
            "authors": "Redolfi E, Montagna C, Mumm S, Affer M, Susani L, Reinbold R, Hol F, Vezzoni P, Cimino M, Zucchi I",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O96002",
                    "url": "https://www.uniprot.org/uniprot/O96002"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9881668",
                    "url": "https://glygen.org/publication/PubMed/9881668"
                }
            ]
        }
    ],
    "pathway": [],
    "orthologs": [],
    "go_annotation": {
        "categories": [
            {
                "name": "Cellular Component",
                "total": 1,
                "go_terms": [
                    {
                        "name": "membrane",
                        "id": "GO:0016020",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O96002",
                                "url": "https://www.uniprot.org/uniprot/O96002"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [],
    "sequence_features": {
        "n_linked_sites": [],
        "o_linked_sites": [],
        "snv_sites": [],
        "glycation_sites": [],
        "phosphorylation_sites": [],
        "sequon_annotation_sites": []
    },
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}