{ "uniprot_canonical_ac": "O95999-1", "uniprot_ac": "O95999", "uniprot_id": "BCL10_HUMAN", "mass": { "chemical_mass": 26252.0, "monoisotopic_mass": 26252.0 }, "refseq": { "ac": "NP_003912", "name": "B-cell lymphoma/leukemia 10 isoform 1", "summary": "This gene was identified by its translocation in a case of mucosa-associated lymphoid tissue (MALT) lymphoma. The protein encoded by this gene contains a caspase recruitment domain (CARD), and has been shown to induce apoptosis and to activate NF-kappaB. This protein is reported to interact with other CARD domain containing proteins including CARD9, 10, 11 and 14, which are thought to function as upstream regulators in NF-kappaB signaling. This protein is found to form a complex with MALT1, a protein encoded by another gene known to be translocated in MALT lymphoma. MALT1 and this protein are thought to synergize in the activation of NF-kappaB, and the deregulation of either of them may contribute to the same pathogenetic process that leads to the malignancy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003912" }, "gene_names": [ { "name": "BCL10", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O95999", "id": "O95999" }, { "name": "BCL10", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003912", "id": "NP_003912" }, { "name": "CIPER", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O95999", "id": "O95999" }, { "name": "CLAP", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O95999", "id": "O95999" }, { "name": "c-E10; CARMEN; CIPER; CLAP; IMD37; mE10", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003912", "id": "NP_003912" } ], "protein_names": [ { "name": "B-cell lymphoma/leukemia 10", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O95999" }, { "name": "B-cell CLL/lymphoma 10", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95999" }, { "name": "B-cell lymphoma/leukemia 10 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003912", "id": "NP_003912" }, { "name": "Bcl-10", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95999" }, { "name": "CARD-containing apoptotic signaling protein; CARD containing molecule enhancing NF-kB; caspase-recruiting domain-containing protein; CARD-containing proapoptotic protein; B-cell lymphoma/leukemia 10; hCLAP; cCARMEN; cellular-E10; cellular homolog of vCARMEN; CARD-containing molecule enhancing NF-kappa-B; mammalian CARD-containing adapter molecule E10; CED-3/ICH-1 prodomain homologous E10-like regulator; B cell CLL/lymphoma 10", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003912", "id": "NP_003912" }, { "name": "CARD-containing molecule enhancing NF-kappa-B", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95999" }, { "name": "CARD-like apoptotic protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95999" }, { "name": "CED-3/ICH-1 prodomain homologous E10-like regulator", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95999" }, { "name": "CIPER", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95999" }, { "name": "Cellular homolog of vCARMEN", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95999" }, { "name": "Cellular-E10", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95999" }, { "name": "Mammalian CARD-containing adapter molecule E10", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95999" }, { "name": "c-E10", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95999" }, { "name": "cCARMEN", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95999" }, { "name": "hCLAP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95999" }, { "name": "mE10", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95999" } ], "function": [ { "annotation": "A nucleation barrier spring-loads the CBM signalosome for binary activation. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_003912", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003912" }, { "database": "PubMed", "id": "35727133", "url": "https://glygen.org/publication/PubMed/35727133" } ] }, { "annotation": "A transposable element into the human long noncoding RNA CARMEN is a switch for cardiac precursor cell specification.", "evidence": [ { "database": "RefSeq", "id": "NP_003912", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003912" }, { "database": "PubMed", "id": "36537036", "url": "https://glygen.org/publication/PubMed/36537036" } ] }, { "annotation": "BCL10 Mutations Define Distinct Dependencies Guiding Precision Therapy for DLBCL.", "evidence": [ { "database": "RefSeq", "id": "NP_003912", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003912" }, { "database": "PubMed", "id": "35658124", "url": "https://glygen.org/publication/PubMed/35658124" } ] }, { "annotation": "BCL10 loss-of-function novel mutation leading to atypical severe combined immunodeficiency.", "evidence": [ { "database": "RefSeq", "id": "NP_003912", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003912" }, { "database": "PubMed", "id": "35750252", "url": "https://glygen.org/publication/PubMed/35750252" } ] }, { "annotation": "Plays a key role in both adaptive and innate immune signaling by bridging CARD domain-containing proteins to immune activation (PubMed:10187770, PubMed:10364242, PubMed:10400625, PubMed:25365219, PubMed:24074955). Acts by channeling adaptive and innate immune signaling downstream of CARD domain-containing proteins CARD9, CARD11 and CARD14 to activate NF-kappa-B and MAP kinase p38 (MAPK11, MAPK12, MAPK13 and/or MAPK14) pathways which stimulate expression of genes encoding pro-inflammatory cytokines and chemokines (PubMed:24074955). Recruited by activated CARD domain-containing proteins: homooligomerized CARD domain-containing proteins form a nucleating helical template that recruits BCL10 via CARD-CARD interaction, thereby promoting polymerization of BCL10, subsequent recruitment of MALT1 and formation of a CBM complex (PubMed:24074955). This leads to activation of NF-kappa-B and MAP kinase p38 (MAPK11, MAPK12, MAPK13 and/or MAPK14) pathways which stimulate expression of genes encoding pro-inflammatory cytokines and chemokines (PubMed:18287044, PubMed:27777308, PubMed:24074955). Activated by CARD9 downstream of C-type lectin receptors; CARD9-mediated signals are essential for antifungal immunity (PubMed:26488816). Activated by CARD11 downstream of T-cell receptor (TCR) and B-cell receptor (BCR) (PubMed:18264101, PubMed:18287044, PubMed:27777308, PubMed:24074955). Promotes apoptosis, pro-caspase-9 maturation and activation of NF-kappa-B via NIK and IKK (PubMed:10187815).", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999#function" }, { "database": "PubMed", "id": "10187815", "url": "https://glygen.org/publication/PubMed/10187815" }, { "database": "PubMed", "id": "18264101", "url": "https://glygen.org/publication/PubMed/18264101" }, { "database": "PubMed", "id": "10187770", "url": "https://glygen.org/publication/PubMed/10187770" }, { "database": "PubMed", "id": "18287044", "url": "https://glygen.org/publication/PubMed/18287044" }, { "database": "PubMed", "id": "27777308", "url": "https://glygen.org/publication/PubMed/27777308" }, { "database": "PubMed", "id": "26488816", "url": "https://glygen.org/publication/PubMed/26488816" }, { "database": "PubMed", "id": "24074955", "url": "https://glygen.org/publication/PubMed/24074955" }, { "database": "PubMed", "id": "10400625", "url": "https://glygen.org/publication/PubMed/10400625" }, { "database": "PubMed", "id": "10364242", "url": "https://glygen.org/publication/PubMed/10364242" }, { "database": "PubMed", "id": "25365219", "url": "https://glygen.org/publication/PubMed/25365219" } ] }, { "annotation": "Regulatory roles of CARD9-BCL10-Rac1 (CBR) signalome in islet beta-cell function in health and metabolic stress: Is there room for MALT1? Review article", "evidence": [ { "database": "RefSeq", "id": "NP_003912", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003912" }, { "database": "PubMed", "id": "37991197", "url": "https://glygen.org/publication/PubMed/37991197" } ] }, { "annotation": "This gene was identified by its translocation in a case of mucosa-associated lymphoid tissue (MALT) lymphoma. The protein encoded by this gene contains a caspase recruitment domain (CARD), and has been shown to induce apoptosis and to activate NF-kappaB. This protein is reported to interact with other CARD domain containing proteins including CARD9, 10, 11 and 14, which are thought to function as upstream regulators in NF-kappaB signaling. This protein is found to form a complex with MALT1, a protein encoded by another gene known to be translocated in MALT lymphoma. MALT1 and this protein are thought to synergize in the activation of NF-kappaB, and the deregulation of either of them may contribute to the same pathogenetic process that leads to the malignancy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016].", "evidence": [ { "database": "RefSeq", "id": "NP_003912", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003912" } ] } ], "disease": [ { "disease_id": "DOID:0050909", "recommended_name": { "id": "DOID:0050909", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050909", "name": "extranodal marginal zone lymphoma of mucosa-associated lymphoid tissue", "description": "A marginal zone B-cell lymphoma that has_material_basis_in mucosal tissue involved in antibody production." }, "synonyms": [ { "id": "DOID:0050909", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050909", "name": "MALT lymphoma", "description": "" }, { "id": "DOID:0050909", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050909", "name": "mucosa-associated lymphoid tissue lymphoma", "description": "" }, { "id": "DOID:0050909", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050909", "name": "MALT lymphoma of the dura", "description": "" }, { "id": "MONDO:0007650", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007650", "name": "MALT lymphoma", "description": "An indolent, extranodal type of non-Hodgkin lymphoma composed of small B-lymphocytes (centrocyte-like cells). The gastrointestinal tract is the most common site of involvement. Other common sites of involvement include lung, head and neck, ocular adnexae, skin, thyroid, and breast. Gastric involvement is associated with the presence of H. pylori infection. (WHO, 2001)" }, { "id": "MONDO:0007650", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007650", "name": "Extranodal marginal zone B-cell lymphoma", "description": "" }, { "id": "MONDO:0007650", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007650", "name": "Extranodal marginal zone B-cell lymphoma of mucosa-associated lymphoid tissue", "description": "" }, { "id": "MONDO:0007650", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007650", "name": "Extranodal marginal zone B-cell lymphoma of mucosa-associated lymphoid tissue (MALT-lymphoma)", "description": "" }, { "id": "MONDO:0007650", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007650", "name": "Extranodal marginal zone lymphoma of mucosa-associated lymphoid tissue", "description": "" }, { "id": "MONDO:0007650", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007650", "name": "Immunocytoma", "description": "" }, { "id": "MONDO:0007650", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007650", "name": "MALT lymphoma", "description": "" }, { "id": "MONDO:0007650", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007650", "name": "MALT-lymphoma", "description": "" }, { "id": "MONDO:0007650", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007650", "name": "MALToma", "description": "" }, { "id": "MONDO:0007650", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007650", "name": "lymphoma of mucosa-associated lymphoid tissue", "description": "" }, { "id": "MONDO:0007650", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007650", "name": "lymphoma, MALT, somatic", "description": "" }, { "id": "MONDO:0007650", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007650", "name": "mucosa-associated lymphatic tissue lymphoma", "description": "" }, { "id": "MONDO:0007650", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007650", "name": "mucosa-associated lymphoid tissue lymphoma", "description": "" }, { "id": "MONDO:0007650", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007650", "name": "extranodal marginal zone lymphoma of mucosa-associated lymphoid tissue (MALT lymphoma)", "description": "" }, { "id": "MONDO:0007650", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007650", "name": "familial primary gastric lymphoma", "description": "" }, { "id": "MONDO:0007650", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007650", "name": "gastric lymphoma, primary", "description": "" }, { "id": "MONDO:0007650", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007650", "name": "lymphoma, mucosa-associated lymphoid type", "description": "" }, { "id": "MIM:137245", "resource": "MIM", "url": "https://www.omim.org/entry/137245", "name": "Lymphoma, mucosa-associated lymphoid type", "description": "Lymphoma, mucosa-associated lymphoid type" } ], "evidence": [ { "id": "137245", "database": "MIM", "url": "https://www.omim.org/entry/137245" } ] }, { "disease_id": "DOID:0111939", "recommended_name": { "id": "DOID:0111939", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111939", "name": "immunodeficiency 37", "description": "A combined T cell and B cell immunodeficiency characterized by hypogammaglobulinemia with profoundly reduced memory B cells and memory T cells and increased numbers of circulating naive lymphocytes that has_material_basis_in homozygous or compound heterozygous mutation in the BCL10 gene on chromosome 1p22.3." }, "synonyms": [ { "id": "DOID:0111939", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111939", "name": "IMD37", "description": "" }, { "id": "MONDO:0014491", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014491", "name": "immunodeficiency 37", "description": "Any primary immunodeficiency disease in which the cause of the disease is a mutation in the BCL10 gene." }, { "id": "MONDO:0014491", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014491", "name": "BCL10 primary immunodeficiency disease", "description": "" }, { "id": "MONDO:0014491", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014491", "name": "combined immunodeficiency due to BCL10 deficiency", "description": "" }, { "id": "MONDO:0014491", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014491", "name": "immunodeficiency 37", "description": "" }, { "id": "MONDO:0014491", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014491", "name": "immunodeficiency type 37", "description": "" }, { "id": "MONDO:0014491", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014491", "name": "primary immunodeficiency disease caused by mutation in BCL10", "description": "" }, { "id": "MONDO:0014491", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014491", "name": "IMD37", "description": "" }, { "id": "MIM:616098", "resource": "MIM", "url": "https://www.omim.org/entry/616098", "name": "Immunodeficiency 37", "description": "Immunodeficiency 37" } ], "evidence": [ { "id": "616098", "database": "MIM", "url": "https://www.omim.org/entry/616098" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 105, "end_pos": 115, "sequence_org": "KLRNIKLEHLK", "sequence_mut": "RLRNIRLEHLR", "comment": "Does not affect ubiquitination and ability to bind NEMO.", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" }, { "database": "PubMed", "id": "18287044", "url": "https://glygen.org/publication/PubMed/18287044" } ] }, { "start_pos": 17, "end_pos": 17, "sequence_org": "K", "sequence_mut": "R", "comment": "Decreased linear ubiquitination and impaired ability to activate NF-kappa-B; when associated with R-31 and R-63.", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" }, { "database": "PubMed", "id": "27777308", "url": "https://glygen.org/publication/PubMed/27777308" } ] }, { "start_pos": 228, "end_pos": 228, "sequence_org": "R", "sequence_mut": "G", "comment": "Abolishes MALT1-mediated cleavage.", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" }, { "database": "PubMed", "id": "18264101", "url": "https://glygen.org/publication/PubMed/18264101" } ] }, { "start_pos": 231, "end_pos": 231, "sequence_org": "S", "sequence_mut": "A", "comment": "Promotes NF-kappa-B activation.", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ] }, { "start_pos": 28, "end_pos": 28, "sequence_org": "L", "sequence_mut": "A", "comment": "Abolishes cell death-inducing capability.", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" }, { "database": "PubMed", "id": "10187815", "url": "https://glygen.org/publication/PubMed/10187815" } ] }, { "start_pos": 31, "end_pos": 31, "sequence_org": "K", "sequence_mut": "R", "comment": "Decreased ubiquitination and ability to bind NEMO; when associated with 63-R--R-67. Decreased ubiquitination and ability to bind NEMO, impaired ability to activate NF-kappa-B; when associated with R-63. Decreased linear ubiquitination and impaired ability to activate NF-kappa-B; when associated with R-17 and R-63.", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" }, { "database": "PubMed", "id": "18287044", "url": "https://glygen.org/publication/PubMed/18287044" }, { "database": "PubMed", "id": "27777308", "url": "https://glygen.org/publication/PubMed/27777308" } ] }, { "start_pos": 36, "end_pos": 36, "sequence_org": "R", "sequence_mut": "E", "comment": "Abolished homomultimerization and formation of a CBM complex, abolished ability to activate NF-kappa-B.", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" }, { "database": "PubMed", "id": "24074955", "url": "https://glygen.org/publication/PubMed/24074955" } ] }, { "start_pos": 41, "end_pos": 41, "sequence_org": "L", "sequence_mut": "A", "comment": "Abolishes cell death-inducing capability.", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" }, { "database": "PubMed", "id": "10187815", "url": "https://glygen.org/publication/PubMed/10187815" }, { "database": "PubMed", "id": "10187770", "url": "https://glygen.org/publication/PubMed/10187770" } ] }, { "start_pos": 41, "end_pos": 41, "sequence_org": "L", "sequence_mut": "Q", "comment": "Abolishes NF-kappa-B activation and homo/heterodimerization.", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" }, { "database": "PubMed", "id": "10187815", "url": "https://glygen.org/publication/PubMed/10187815" }, { "database": "PubMed", "id": "10187770", "url": "https://glygen.org/publication/PubMed/10187770" } ] }, { "start_pos": 46, "end_pos": 46, "sequence_org": "I", "sequence_mut": "A", "comment": "Abolishes cell death-inducing capability.", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" }, { "database": "PubMed", "id": "10187815", "url": "https://glygen.org/publication/PubMed/10187815" } ] }, { "start_pos": 47, "end_pos": 47, "sequence_org": "L", "sequence_mut": "A", "comment": "Abolishes cell death-inducing capability.", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" }, { "database": "PubMed", "id": "10187815", "url": "https://glygen.org/publication/PubMed/10187815" } ] }, { "start_pos": 50, "end_pos": 50, "sequence_org": "E", "sequence_mut": "R", "comment": "Abolished homomultimerization and formation of a CBM complex, abolished ability to activate NF-kappa-B.", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" }, { "database": "PubMed", "id": "24074955", "url": "https://glygen.org/publication/PubMed/24074955" } ] }, { "start_pos": 50, "end_pos": 51, "sequence_org": "ED", "sequence_mut": "RR", "comment": "Abolished homomultimerization and formation of a CBM complex.", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" }, { "database": "PubMed", "id": "24074955", "url": "https://glygen.org/publication/PubMed/24074955" } ] }, { "start_pos": 53, "end_pos": 53, "sequence_org": "E", "sequence_mut": "A", "comment": "Abolishes cell death-inducing capability.", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" }, { "database": "PubMed", "id": "10187815", "url": "https://glygen.org/publication/PubMed/10187815" } ] }, { "start_pos": 53, "end_pos": 53, "sequence_org": "E", "sequence_mut": "R", "comment": "Abolished homomultimerization and formation of a CBM complex, abolished ability to activate NF-kappa-B.", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" }, { "database": "PubMed", "id": "24074955", "url": "https://glygen.org/publication/PubMed/24074955" } ] }, { "start_pos": 55, "end_pos": 55, "sequence_org": "I", "sequence_mut": "A", "comment": "Abolishes cell death-inducing capability.", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" }, { "database": "PubMed", "id": "10187815", "url": "https://glygen.org/publication/PubMed/10187815" } ] }, { "start_pos": 63, "end_pos": 63, "sequence_org": "K", "sequence_mut": "R", "comment": "Decreased ubiquitination and ability to bind NEMO, impaired ability to activate NF-kappa-B; when associated with R-31. Decreased linear ubiquitination and impaired ability to activate NF-kappa-B; when associated with R-17 and R-31.", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" }, { "database": "PubMed", "id": "18287044", "url": "https://glygen.org/publication/PubMed/18287044" }, { "database": "PubMed", "id": "27777308", "url": "https://glygen.org/publication/PubMed/27777308" } ] }, { "start_pos": 63, "end_pos": 67, "sequence_org": "KRAGK", "sequence_mut": "RRAGR", "comment": "Decreased ubiquitination and ability to bind NEMO; when associated with R-31.", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" }, { "database": "PubMed", "id": "18287044", "url": "https://glygen.org/publication/PubMed/18287044" } ] }, { "start_pos": 78, "end_pos": 78, "sequence_org": "G", "sequence_mut": "R", "comment": "Abolishes NF-kappa-B activation.", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" }, { "database": "PubMed", "id": "10187770", "url": "https://glygen.org/publication/PubMed/10187770" } ] }, { "start_pos": 81, "end_pos": 85, "sequence_org": "TLVES", "sequence_mut": "ALVEA", "comment": "Complete loss of IKBKB/IKKB-mediated phosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" }, { "database": "PubMed", "id": "17213322", "url": "https://glygen.org/publication/PubMed/17213322" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "81.25", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000142867", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142867" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "93.22", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000142867", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142867" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "83.37", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000142867", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142867" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000142867", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142867" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "81.48", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000142867", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142867" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "90.94", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000142867", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142867" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "88.47", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000142867", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142867" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "81.73", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000142867", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142867" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "77.41", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000142867", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142867" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "85.91", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000142867", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142867" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "80.6", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000142867", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142867" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "74.06", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000142867", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142867" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "80.25", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000142867", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142867" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O95999", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95999" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O95999", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95999" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O95999", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95999" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O95999", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95999" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O95999", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95999" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O95999", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95999" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O95999", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95999" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O95999", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95999" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O95999", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95999" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O95999", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95999" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O95999", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95999" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O95999", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95999" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "common_name": "Human" } ], "gene": [ { "name": "BCL10", "url": "https://www.uniprot.org/uniprot/O95999", "locus": { "chromosome": "1", "start_pos": 16129, "end_pos": 5273, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "LRG_1210", "url": "https://www.ensembl.org/id/LRG_1210" } ] } } ], "crossref": [ { "id": "ENSG00000142867", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142867", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd08810", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd08810", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "BCL10", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=BCL10", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "8915", "url": "https://www.ncbi.nlm.nih.gov/gene/8915", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "989", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=989", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O95999", "url": "https://www.ebi.ac.uk/intact/interactors/id:O95999*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001315", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001315", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011029", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011029", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033238", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033238", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR042143", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042143", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:8915", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8915", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "137245", "url": "http://www.omim.org/entry/137245", "database": "MIM", "categories": [ "Other" ] }, { "id": "603517", "url": "http://www.omim.org/entry/603517", "database": "MIM", "categories": [ "Other" ] }, { "id": "616098", "url": "http://www.omim.org/entry/616098", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O95999", "url": "https://www.nextprot.org/entry/NX_O95999", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O95999", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95999", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "HPDGEQS", "url": "https://omabrowser.org/oma/group/HPDGEQS/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5392691at2759", "url": "http://www.orthodb.org/?query=5392691at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR34920", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR34920", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR34920:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR34920:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2MB9", "url": "https://www.rcsb.org/structure/2MB9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6BZE", "url": "https://www.rcsb.org/structure/6BZE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6GK2", "url": "https://www.rcsb.org/structure/6GK2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8CZD", "url": "https://www.rcsb.org/structure/8CZD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8CZO", "url": "https://www.rcsb.org/structure/8CZO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00619", "url": "http://pfam.xfam.org/family/PF00619", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O95999", "url": "https://pharos.nih.gov/targets/O95999", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O95999", "url": "http://purl.obolibrary.org/obo/PR_O95999", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_003912", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003912", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A087WWW9", "url": "https://www.uniprot.org/uniprot/A0A087WWW9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WWW9-1", "url": "https://www.uniprot.org/uniprot/A0A087WWW9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3B3ISX2", "url": "https://www.uniprot.org/uniprot/A0A3B3ISX2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3B3ISX2-1", "url": "https://www.uniprot.org/uniprot/A0A3B3ISX2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95999-1", "url": "https://www.uniprot.org/uniprot/O95999-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTSSRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLKCSSCEPFPDGATNNLSRSNSDESNFSEKLRASTVMYHPEGESSTTPFFSTNSSLNLPVLEVGRTENTIFSSTTLPRPGDPGAPPLPPDLQLEEEGTCANSSEMFLPLRSRTVSRQ", "length": 233, "header": "sp|O95999-1|BCL10_HUMAN Isoform 1 of B-cell lymphoma/leukemia 10 OS=Homo sapiens OX=9606 GN=BCL10 PE=1 SV=1 CANONICAL=O95999-1" }, "isoforms": [ { "isoform_ac": "A0A087WWW9-1", "url": "", "sequence": { "sequence": "MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTSSRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKDGATNNLSRSNSDESNFSEKLRASTVMYHPEGESSTTPFFSTNSSLNLPVLEVGRTENTIFSSTTLPRPGDPGAPPLPPDLQLEEEGTCANSSEMFLPLRSRTVSRQ", "length": 222, "header": "tr|A0A087WWW9-1|BCL10_HUMAN Computationally mapped isoform of B-cell lymphoma/leukemia 10 OS=Homo sapiens OX=9606 GN=BCL10 PE=1 SV=2 CANONICAL=O95999-1" }, "locus": { "chromosome": "1", "start_pos": 85276352, "end_pos": 85267630, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000620248.3", "url": "https://www.ensembl.org/id/ENST00000620248.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000480561.2", "url": "https://www.ensembl.org/id/ENSP00000480561.2" } ] } }, { "isoform_ac": "A0A3B3ISX2-1", "url": "", "sequence": { "sequence": "MEPTAPSLTEEDLTEVKKDVSNAAVPRAGGGGLQPSGRRKRKPGVRGQGGSSRSEERKVLAQEDCGEPCIRGTLVAVILQ", "length": 80, "header": "tr|A0A3B3ISX2-1|BCL10_HUMAN Computationally mapped isoform of B-cell lymphoma/leukemia 10 OS=Homo sapiens OX=9606 GN=BCL10 PE=1 SV=1 CANONICAL=O95999-1" }, "locus": {} }, { "isoform_ac": "O95999-1", "url": "", "sequence": { "sequence": "MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTSSRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLKCSSCEPFPDGATNNLSRSNSDESNFSEKLRASTVMYHPEGESSTTPFFSTNSSLNLPVLEVGRTENTIFSSTTLPRPGDPGAPPLPPDLQLEEEGTCANSSEMFLPLRSRTVSRQ", "length": 233, "header": "sp|O95999-1|BCL10_HUMAN Isoform 1 of B-cell lymphoma/leukemia 10 OS=Homo sapiens OX=9606 GN=BCL10 PE=1 SV=1 CANONICAL=O95999-1" }, "locus": { "chromosome": "1", "start_pos": 85276352, "end_pos": 85267630, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000648566.1", "url": "https://www.ensembl.org/id/ENST00000648566.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000498104.1", "url": "https://www.ensembl.org/id/ENSP00000498104.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O95999", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95999" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" } ] } ], "phosphorylation": [ { "start_pos": 138, "end_pos": 138, "kinase_uniprot_canonical_ac": "Q9UQM7-1", "kinase_gene_name": "CAMK2A", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95999", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95999" }, { "database": "PubMed", "id": "17052756", "url": "https://glygen.org/publication/PubMed/17052756" } ], "site_lbl": "Ser138" }, { "start_pos": 138, "end_pos": 138, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "O95999", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95999" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" }, { "database": "PubMed", "id": "17052756", "url": "https://glygen.org/publication/PubMed/17052756" }, { "database": "PubMed", "id": "17371994", "url": "https://glygen.org/publication/PubMed/17371994" }, { "database": "PubMed", "id": "17502353", "url": "https://glygen.org/publication/PubMed/17502353" }, { "database": "PubMed", "id": "20466000", "url": "https://glygen.org/publication/PubMed/20466000" }, { "database": "PubMed", "id": "21674474", "url": "https://glygen.org/publication/PubMed/21674474" }, { "database": "PubMed", "id": "21700900", "url": "https://glygen.org/publication/PubMed/21700900" }, { "database": "PubMed", "id": "26038114", "url": "https://glygen.org/publication/PubMed/26038114" } ], "site_lbl": "Ser138" }, { "start_pos": 171, "end_pos": 171, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95999", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95999" }, { "database": "PubMed", "id": "26038114", "url": "https://glygen.org/publication/PubMed/26038114" } ], "site_lbl": "Ser171" }, { "start_pos": 218, "end_pos": 218, "kinase_uniprot_canonical_ac": "P31749-1", "kinase_gene_name": "AKT1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95999", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95999" }, { "database": "PubMed", "id": "16280327", "url": "https://glygen.org/publication/PubMed/16280327" } ], "site_lbl": "Ser218" }, { "start_pos": 218, "end_pos": 218, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "PRO", "id": "O95999", "url": "http://purl.obolibrary.org/obo/O95999" }, { "database": "iPTMnet", "id": "O95999", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95999" }, { "database": "PubMed", "id": "16280327", "url": "https://glygen.org/publication/PubMed/16280327" } ], "site_lbl": "Ser218" }, { "start_pos": 231, "end_pos": 231, "kinase_uniprot_canonical_ac": "P31749-1", "kinase_gene_name": "AKT1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95999", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95999" }, { "database": "PubMed", "id": "16280327", "url": "https://glygen.org/publication/PubMed/16280327" } ], "site_lbl": "Ser231" }, { "start_pos": 231, "end_pos": 231, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "PRO", "id": "O95999", "url": "http://purl.obolibrary.org/obo/O95999" }, { "database": "iPTMnet", "id": "O95999", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95999" }, { "database": "PubMed", "id": "16280327", "url": "https://glygen.org/publication/PubMed/16280327" } ], "site_lbl": "Ser231" }, { "start_pos": 91, "end_pos": 91, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95999", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95999" }, { "database": "PubMed", "id": "24732096", "url": "https://glygen.org/publication/PubMed/24732096" } ], "site_lbl": "Thr91" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "IkappaBalpha ubiquitination is catalyzed by an SCF-like complex containing Skp1, cullin-1, and two F-box/WD40-repeat proteins, betaTrCP1 and betaTrCP2.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Suzuki H, Chiba T, Kobayashi M, Takeuchi M, Suzuki T, Ichiyama A, Ikenoue T, Omata M, Furuichi K, Tanaka K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "10066435", "url": "https://glygen.org/publication/PubMed/10066435" } ] }, { "title": "CIPER, a novel NF kappaB-activating protein containing a caspase recruitment domain with homology to Herpesvirus-2 protein E10.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Koseki T, Inohara N, Chen S, Carrio R, Merino J, Hottiger MO, Nabel GJ, Nunez G", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" }, { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "10187770", "url": "https://glygen.org/publication/PubMed/10187770" } ] }, { "title": "Equine herpesvirus-2 E10 gene product, but not its cellular homologue, activates NF-kappaB transcription factor and c-Jun N-terminal kinase.", "journal": "J. Biol. Chem.", "date": "1999", "authors": "Thome M, Martinon F, Hofmann K, Rubio V, Steiner V, Schneider P, Mattmann C, Tschopp J", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "reference": [ { "type": "PubMed", "id": "10187771", "url": "https://glygen.org/publication/PubMed/10187771" } ] }, { "title": "mE10, a novel caspase recruitment domain-containing proapoptotic molecule.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Yan M, Lee J, Schilbach S, Goddard A, Dixit V", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "reference": [ { "type": "PubMed", "id": "10187815", "url": "https://glygen.org/publication/PubMed/10187815" } ] }, { "title": "Recruitment of a ROC1-CUL1 ubiquitin ligase by Skp1 and HOS to catalyze the ubiquitination of I kappa B alpha.", "journal": "Molecular cell", "date": "1999", "authors": "Tan P, Fuchs SY, Chen A, Wu K, Gomez C, Ronai Z, Pan ZQ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "10230406", "url": "https://glygen.org/publication/PubMed/10230406" } ] }, { "title": "Inactivating mutations and overexpression of BCL10, a caspase recruitment domain-containing gene, in MALT lymphoma with t(1;14)(p22;q32).", "journal": "Nature genetics", "date": "1999", "authors": "Zhang Q, Siebert R, Yan M, Hinzmann B, Cui X, Xue L, Rakestraw KM, Naeve CW, Beckmann G, Weisenburger DD, Sanger WG, Nowotny H, Vesely M, Callet-Bauchu E, Salles G, Dixit VM, Rosenthal A, Schlegelberger B, Morris SW", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "reference": [ { "type": "PubMed", "id": "10319863", "url": "https://glygen.org/publication/PubMed/10319863" } ] }, { "title": "HOS, a human homolog of Slimb, forms an SCF complex with Skp1 and Cullin1 and targets the phosphorylation-dependent degradation of IkappaB and beta-catenin.", "journal": "Oncogene", "date": "1999", "authors": "Fuchs SY, Chen A, Xiong Y, Pan ZQ, Ronai Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "10321728", "url": "https://glygen.org/publication/PubMed/10321728" } ] }, { "title": "CLAP, a novel caspase recruitment domain-containing protein in the tumor necrosis factor receptor pathway, regulates NF-kappaB activation and apoptosis.", "journal": "The Journal of biological chemistry", "date": "1999-06-18", "authors": "Srinivasula S M, Ahmad M, Lin J H, Poyet J L, Fernandes-Alnemri T, Tsichlis P N, Alnemri E S", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "reference": [ { "type": "PubMed", "id": "10364242", "url": "https://glygen.org/publication/PubMed/10364242" } ] }, { "title": "Absence of BCL10 mutations in human malignant mesothelioma.", "journal": "Cell", "date": "1999", "authors": "Apostolou S, De Rienzo A, Murthy SS, Jhanwar SC, Testa JR", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "reference": [ { "type": "PubMed", "id": "10380921", "url": "https://glygen.org/publication/PubMed/10380921" } ] }, { "title": "c-E10 is a caspase-recruiting domain-containing protein that interacts with components of death receptors signaling pathway and activates nuclear factor-kappaB.", "journal": "The Journal of biological chemistry", "date": "1999-07-16", "authors": "Costanzo A, Guiet C, Vito P", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "reference": [ { "type": "PubMed", "id": "10400625", "url": "https://glygen.org/publication/PubMed/10400625" } ] }, { "title": "beta-TrCP mediates the signal-induced ubiquitination of IkappaBbeta.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Wu C, Ghosh S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "10514424", "url": "https://glygen.org/publication/PubMed/10514424" } ] }, { "title": "PEX12 interacts with PEX5 and PEX10 and acts downstream of receptor docking in peroxisomal matrix protein import.", "journal": "The Journal of cell biology", "date": "1999", "authors": "Chang CC, Warren DS, Sacksteder KA, Gould SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "10562279", "url": "https://glygen.org/publication/PubMed/10562279" } ] }, { "title": "Point mutations and deletions of the Bcl10 gene in solid tumors and malignant lymphomas.", "journal": "Cancer research", "date": "1999", "authors": "Lee SH, Shin MS, Kim HS, Park WS, Kim SY, Lee HK, Park JY, Oh RR, Jang JJ, Park KM, Han JY, Kang CS, Lee JY, Yoo NJ", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "reference": [ { "type": "PubMed", "id": "10582682", "url": "https://glygen.org/publication/PubMed/10582682" } ] }, { "title": "Peptides corresponding to the N and C termini of IkappaB-alpha, -beta, and -epsilon as probes of the two catalytic subunits of IkappaB kinase, IKK-1 and IKK-2.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Burke JR, Wood MK, Ryseck RP, Walther S, Meyers CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "10593898", "url": "https://glygen.org/publication/PubMed/10593898" } ] }, { "title": "The PI3K-PDK1 connection: more than just a road to PKB.", "journal": "The Biochemical journal", "date": "2000", "authors": "Vanhaesebroeck B, Alessi DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "10698680", "url": "https://glygen.org/publication/PubMed/10698680" } ] }, { "title": "TAK1 mitogen-activated protein kinase kinase kinase is activated by autophosphorylation within its activation loop.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Kishimoto K, Matsumoto K, Ninomiya-Tsuji J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "10702308", "url": "https://glygen.org/publication/PubMed/10702308" } ] }, { "title": "Structure, function, and biology of SHIP proteins.", "journal": "Genes & development", "date": "2000", "authors": "Rohrschneider LR, Fuller JF, Wolf I, Liu Y, Lucas DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "10716940", "url": "https://glygen.org/publication/PubMed/10716940" } ] }, { "title": "Identification of a novel, dendritic cell-associated molecule, dectin-1, by subtractive cDNA cloning.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Ariizumi K, Shen GL, Shikano S, Xu S, Ritter R 3rd, Kumamoto T, Edelbaum D, Morita A, Bergstresser PR, Takashima A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "10779524", "url": "https://glygen.org/publication/PubMed/10779524" } ] }, { "title": "Phosphorylation-dependent activation of TAK1 mitogen-activated protein kinase kinase kinase by TAB1.", "journal": "FEBS letters", "date": "2000", "authors": "Sakurai H, Miyoshi H, Mizukami J, Sugita T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "10838074", "url": "https://glygen.org/publication/PubMed/10838074" } ] }, { "title": "TAB2, a novel adaptor protein, mediates activation of TAK1 MAPKKK by linking TAK1 to TRAF6 in the IL-1 signal transduction pathway.", "journal": "Molecular cell", "date": "2000", "authors": "Takaesu G, Kishida S, Hiyama A, Yamaguchi K, Shibuya H, Irie K, Ninomiya-Tsuji J, Matsumoto K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "10882101", "url": "https://glygen.org/publication/PubMed/10882101" } ] }, { "title": "CARD9 is a novel caspase recruitment domain-containing protein that interacts with BCL10/CLAP and activates NF-kappa B.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Bertin J, Guo Y, Wang L, Srinivasula SM, Jacobson MD, Poyet JL, Merriam S, Du MQ, Dyer MJ, Robison KE, DiStefano PS, Alnemri ES", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "11053425", "url": "https://glygen.org/publication/PubMed/11053425" } ] }, { "title": "Activation of the IkappaB kinase complex by TRAF6 requires a dimeric ubiquitin-conjugating enzyme complex and a unique polyubiquitin chain.", "journal": "Cell", "date": "2000", "authors": "Deng L, Wang C, Spencer E, Yang L, Braun A, You J, Slaughter C, Pickart C, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "11057907", "url": "https://glygen.org/publication/PubMed/11057907" } ] }, { "title": "Identification of paracaspases and metacaspases: two ancient families of caspase-like proteins, one of which plays a key role in MALT lymphoma.", "journal": "Molecular cell", "date": "2000", "authors": "Uren AG, O'Rourke K, Aravind LA, Pisabarro MT, Seshagiri S, Koonin EV, Dixit VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "11090634", "url": "https://glygen.org/publication/PubMed/11090634" } ] }, { "title": "Bcl10 and MALT1, independent targets of chromosomal translocation in malt lymphoma, cooperate in a novel NF-kappa B signaling pathway.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Lucas PC, Yonezumi M, Inohara N, McAllister-Lucas LM, Abazeed ME, Chen FF, Yamaoka S, Seto M, Nunez G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "11262391", "url": "https://glygen.org/publication/PubMed/11262391" } ] }, { "title": "Persistent activation of NF-kappa B by the tax transforming protein involves chronic phosphorylation of IkappaB kinase subunits IKKbeta and IKKgamma.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Carter RS, Geyer BC, Xie M, Acevedo-Suarez CA, Ballard DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "11325957", "url": "https://glygen.org/publication/PubMed/11325957" } ] }, { "title": "Protein kinase C theta is expressed in mast cells and is functionally involved in Fcepsilon receptor I signaling.", "journal": "Journal of leukocyte biology", "date": "2001", "authors": "Liu Y, Graham C, Parravicini V, Brown MJ, Rivera J, Shaw S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "11358993", "url": "https://glygen.org/publication/PubMed/11358993" } ] }, { "title": "TAK1 is a ubiquitin-dependent kinase of MKK and IKK.", "journal": "Nature", "date": "2001", "authors": "Wang C, Deng L, Hong M, Akkaraju GR, Inoue J, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "11460167", "url": "https://glygen.org/publication/PubMed/11460167" } ] }, { "title": "Interchangeable binding of Bcl10 to TRAF2 and cIAPs regulates apoptosis signaling.", "journal": "Oncogene", "date": "2001", "authors": "Yui D, Yoneda T, Oono K, Katayama T, Imaizumi K, Tohyama M", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "reference": [ { "type": "PubMed", "id": "11466612", "url": "https://glygen.org/publication/PubMed/11466612" } ] }, { "title": "Tyrosine residues in phospholipase Cgamma 2 essential for the enzyme function in B-cell signaling.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Rodriguez R, Matsuda M, Perisic O, Bravo J, Paul A, Jones NP, Light Y, Swann K, Williams RL, Katan M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "11606584", "url": "https://glygen.org/publication/PubMed/11606584" } ] }, { "title": "The AAA ATPase Cdc48/p97 and its partners transport proteins from the ER into the cytosol.", "journal": "Nature", "date": "2001", "authors": "Ye Y, Meyer HH, Rapoport TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "11740563", "url": "https://glygen.org/publication/PubMed/11740563" } ] }, { "title": "Phosphorylation of the protein kinase C-theta activation loop and hydrophobic motif regulates its kinase activity, but only activation loop phosphorylation is critical to in vivo nuclear-factor-kappaB induction.", "journal": "The Biochemical journal", "date": "2002", "authors": "Liu Y, Graham C, Li A, Fisher RJ, Shaw S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "11772397", "url": "https://glygen.org/publication/PubMed/11772397" } ] }, { "title": "Regulation of the immune response by SHIP.", "journal": "Seminars in immunology", "date": "2002", "authors": "March ME, Ravichandran K", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "11884229", "url": "https://glygen.org/publication/PubMed/11884229" } ] }, { "title": "Protein kinase C beta controls nuclear factor kappaB activation in B cells through selective regulation of the IkappaB kinase alpha.", "journal": "The Journal of experimental medicine", "date": "2002", "authors": "Saijo K, Mecklenbrauker I, Santana A, Leitger M, Schmedt C, Tarakhovsky A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "12070292", "url": "https://glygen.org/publication/PubMed/12070292" } ] }, { "title": "PKC-beta controls I kappa B kinase lipid raft recruitment and activation in response to BCR signaling.", "journal": "Nature immunology", "date": "2002", "authors": "Su TT, Guo B, Kawakami Y, Sommer K, Chae K, Humphries LA, Kato RM, Kang S, Patrone L, Wall R, Teitell M, Leitges M, Kawakami T, Rawlings DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "12118249", "url": "https://glygen.org/publication/PubMed/12118249" } ] }, { "title": "Protein kinase C delta (PKC delta): activation mechanisms and functions.", "journal": "Journal of biochemistry", "date": "2002", "authors": "Kikkawa U, Matsuzaki H, Yamamoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "12473183", "url": "https://glygen.org/publication/PubMed/12473183" } ] }, { "title": "Protein kinase C-theta (PKC theta): a key enzyme in T cell life and death.", "journal": "Journal of biochemistry", "date": "2002", "authors": "Altman A, Villalba M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "12473184", "url": "https://glygen.org/publication/PubMed/12473184" } ] }, { "title": "The role of PI3K in immune cells.", "journal": "Nature immunology", "date": "2003", "authors": "Koyasu S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "12660731", "url": "https://glygen.org/publication/PubMed/12660731" } ] }, { "title": "Signal-induced ubiquitination of I kappaB Kinase-beta.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Carter RS, Pennington KN, Ungurait BJ, Arrate P, Ballard DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "14514672", "url": "https://glygen.org/publication/PubMed/14514672" } ] }, { "title": "Bcl10 activates the NF-kappaB pathway through ubiquitination of NEMO.", "journal": "Nature", "date": "2004", "authors": "Zhou H, Wertz I, O'Rourke K, Ultsch M, Seshagiri S, Eby M, Xiao W, Dixit VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "14695475", "url": "https://glygen.org/publication/PubMed/14695475" } ] }, { "title": "Mechanism of diacylglycerol-induced membrane targeting and activation of protein kinase Cdelta.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Stahelin RV, Digman MA, Medkova M, Ananthanarayanan B, Rafter JD, Melowic HR, Cho W", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "15105418", "url": "https://glygen.org/publication/PubMed/15105418" } ] }, { "title": "CARMA1, BCL-10 and MALT1 in lymphocyte development and activation.", "journal": "Nature reviews. Immunology", "date": "2004", "authors": "Thome M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "15122200", "url": "https://glygen.org/publication/PubMed/15122200" } ] }, { "title": "The TRAF6 ubiquitin ligase and TAK1 kinase mediate IKK activation by BCL10 and MALT1 in T lymphocytes.", "journal": "Molecular cell", "date": "2004", "authors": "Sun L, Deng L, Ea CK, Xia ZP, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "15125833", "url": "https://glygen.org/publication/PubMed/15125833" } ] }, { "title": "The two NF-kappaB activation pathways and their role in innate and adaptive immunity.", "journal": "Trends in immunology", "date": "2004", "authors": "Bonizzi G, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "15145317", "url": "https://glygen.org/publication/PubMed/15145317" } ] }, { "title": "A membrane protein required for dislocation of misfolded proteins from the ER.", "journal": "Nature", "date": "2004", "authors": "Lilley BN, Ploegh HL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "15215855", "url": "https://glygen.org/publication/PubMed/15215855" } ] }, { "title": "A membrane protein complex mediates retro-translocation from the ER lumen into the cytosol.", "journal": "Nature", "date": "2004", "authors": "Ye Y, Shibata Y, Yun C, Ron D, Rapoport TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "15215856", "url": "https://glygen.org/publication/PubMed/15215856" } ] }, { "title": "TAB2 and TAB3 activate the NF-kappaB pathway through binding to polyubiquitin chains.", "journal": "Molecular cell", "date": "2004", "authors": "Kanayama A, Seth RB, Sun L, Ea CK, Hong M, Shaito A, Chiu YH, Deng L, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "15327770", "url": "https://glygen.org/publication/PubMed/15327770" } ] }, { "title": "Signaling to NF-kappaB.", "journal": "Genes & development", "date": "2004", "authors": "Hayden MS, Ghosh S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "15371334", "url": "https://glygen.org/publication/PubMed/15371334" } ] }, { "title": "The roles of CARMA1, Bcl10, and MALT1 in antigen receptor signaling.", "journal": "Seminars in immunology", "date": "2004", "authors": "Lin X, Wang D", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "15541657", "url": "https://glygen.org/publication/PubMed/15541657" } ] }, { "title": "Syk-dependent cytokine induction by Dectin-1 reveals a novel pattern recognition pathway for C type lectins.", "journal": "Immunity", "date": "2005", "authors": "Rogers NC, Slack EC, Edwards AD, Nolte MA, Schulz O, Schweighoffer E, Williams DL, Gordon S, Tybulewicz VL, Brown GD, Reis e Sousa C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "15845454", "url": "https://glygen.org/publication/PubMed/15845454" } ] }, { "title": "Ubiquitin signalling in the NF-kappaB pathway.", "journal": "Nature cell biology", "date": "2005", "authors": "Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "16056267", "url": "https://glygen.org/publication/PubMed/16056267" } ] }, { "title": "Essential function for the kinase TAK1 in innate and adaptive immune responses.", "journal": "Nature immunology", "date": "2005", "authors": "Sato S, Sanjo H, Takeda K, Ninomiya-Tsuji J, Yamamoto M, Kawai T, Matsumoto K, Takeuchi O, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "16186825", "url": "https://glygen.org/publication/PubMed/16186825" } ] }, { "title": "Critical role of novel Thr-219 autophosphorylation for the cellular function of PKCtheta in T lymphocytes.", "journal": "The EMBO journal", "date": "2005", "authors": "Thuille N, Heit I, Fresser F, Krumbock N, Bauer B, Leuthaeusser S, Dammeier S, Graham C, Copeland TD, Shaw S, Baier G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "16252004", "url": "https://glygen.org/publication/PubMed/16252004" } ] }, { "title": "A pathway for tumor necrosis factor-alpha-induced Bcl10 nuclear translocation. Bcl10 is up-regulated by NF-kappaB and phosphorylated by Akt1 and then complexes with Bcl3 to enter the nucleus.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Yeh PY, Kuo SH, Yeh KH, Chuang SE, Hsu CH, Chang WC, Lin HI, Gao M, Cheng AL", "evidence": [ { "database": "iPTMnet", "id": "O95999", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95999" } ], "reference": [ { "type": "PubMed", "id": "16280327", "url": "https://glygen.org/publication/PubMed/16280327" } ] }, { "title": "PKC beta regulates BCR-mediated IKK activation by facilitating the interaction between TAK1 and CARMA1.", "journal": "The Journal of experimental medicine", "date": "2005", "authors": "Shinohara H, Yasuda T, Aiba Y, Sanjo H, Hamadate M, Watarai H, Sakurai H, Kurosaki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "16301747", "url": "https://glygen.org/publication/PubMed/16301747" } ] }, { "title": "Monoubiquitination of human histone H2B: the factors involved and their roles in HOX gene regulation.", "journal": "Molecular cell", "date": "2005", "authors": "Zhu B, Zheng Y, Pham AD, Mandal SS, Erdjument-Bromage H, Tempst P, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "16307923", "url": "https://glygen.org/publication/PubMed/16307923" } ] }, { "title": "Dectin-1: a signalling non-TLR pattern-recognition receptor.", "journal": "Nature reviews. Immunology", "date": "2006", "authors": "Brown GD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "16341139", "url": "https://glygen.org/publication/PubMed/16341139" } ] }, { "title": "Phosphorylation of CARMA1: the link(er) to NF-kappaB activation.", "journal": "Immunity", "date": "2005", "authors": "Rueda D, Thome M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "16356853", "url": "https://glygen.org/publication/PubMed/16356853" } ] }, { "title": "Phosphorylation of the CARMA1 linker controls NF-kappaB activation.", "journal": "Immunity", "date": "2005", "authors": "Sommer K, Guo B, Pomerantz JL, Bandaranayake AD, Moreno-Garcia ME, Ovechkina YL, Rawlings DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "16356855", "url": "https://glygen.org/publication/PubMed/16356855" } ] }, { "title": "Phosphorylation of CARMA1 plays a critical role in T Cell receptor-mediated NF-kappaB activation.", "journal": "Immunity", "date": "2005", "authors": "Matsumoto R, Wang D, Blonska M, Li H, Kobayashi M, Pappu B, Chen Y, Wang D, Lin X", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "16356856", "url": "https://glygen.org/publication/PubMed/16356856" } ] }, { "title": "Normal T-cell development and immune functions in TRIM-deficient mice.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Kolsch U, Arndt B, Reinhold D, Lindquist JA, Juling N, Kliche S, Pfeffer K, Bruyns E, Schraven B, Simeoni L", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "16612002", "url": "https://glygen.org/publication/PubMed/16612002" } ] }, { "title": "The IRAK-1-BCL10-MALT1-TRAF6-TAK1 cascade mediates signaling to NF-kappaB from Toll-like receptor 4.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Dong W, Liu Y, Peng J, Chen L, Zou T, Xiao H, Liu Z, Li W, Bu Y, Qi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "16831874", "url": "https://glygen.org/publication/PubMed/16831874" } ] }, { "title": "E2-25K mediates US11-triggered retro-translocation of MHC class I heavy chains in a permeabilized cell system.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Flierman D, Coleman CS, Pickart CM, Rapoport TA, Chau V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "16868077", "url": "https://glygen.org/publication/PubMed/16868077" } ] }, { "title": "Selective function of PKC-theta in T cells.", "journal": "Cellular & molecular immunology", "date": "2006", "authors": "Manicassamy S, Gupta S, Sun Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "16978534", "url": "https://glygen.org/publication/PubMed/16978534" } ] }, { "title": "Regulation and function of IKK and IKK-related kinases.", "journal": "Science's STKE : signal transduction knowledge environment", "date": "2006", "authors": "Hacker H, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "17047224", "url": "https://glygen.org/publication/PubMed/17047224" } ] }, { "title": "Bcl10 is phosphorylated on Ser138 by Ca2+/calmodulin-dependent protein kinase II.", "journal": "Molecular immunology", "date": "2007", "authors": "Ishiguro K, Ando T, Goto H, Xavier R", "evidence": [ { "database": "iPTMnet", "id": "O95999", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95999" } ], "reference": [ { "type": "PubMed", "id": "17052756", "url": "https://glygen.org/publication/PubMed/17052756" } ] }, { "title": "Introduction to NF-kappaB: players, pathways, perspectives.", "journal": "Oncogene", "date": "2006", "authors": "Gilmore TD", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "17072321", "url": "https://glygen.org/publication/PubMed/17072321" } ] }, { "title": "Human SHPRH is a ubiquitin ligase for Mms2-Ubc13-dependent polyubiquitylation of proliferating cell nuclear antigen.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Unk I, Hajdu I, Fatyol K, Szakal B, Blastyak A, Bermudez V, Hurwitz J, Prakash L, Prakash S, Haracska L", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "17108083", "url": "https://glygen.org/publication/PubMed/17108083" } ] }, { "title": "Human SHPRH suppresses genomic instability through proliferating cell nuclear antigen polyubiquitination.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Motegi A, Sood R, Moinova H, Markowitz SD, Liu PP, Myung K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "17130289", "url": "https://glygen.org/publication/PubMed/17130289" } ] }, { "title": "Site-specific Lys-63-linked tumor necrosis factor receptor-associated factor 6 auto-ubiquitination is a critical determinant of I kappa B kinase activation.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Lamothe B, Besse A, Campos AD, Webster WK, Wu H, Darnay BG", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "17135271", "url": "https://glygen.org/publication/PubMed/17135271" } ] }, { "title": "TAK1-dependent signaling requires functional interaction with TAB2/TAB3.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Besse A, Lamothe B, Campos AD, Webster WK, Maddineni U, Lin SC, Wu H, Darnay BG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "17158449", "url": "https://glygen.org/publication/PubMed/17158449" } ] }, { "title": "Negative feedback loop in T cell activation through IkappaB kinase-induced phosphorylation and degradation of Bcl10.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Lobry C, Lopez T, Israel A, Weil R", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "reference": [ { "type": "PubMed", "id": "17213322", "url": "https://glygen.org/publication/PubMed/17213322" } ] }, { "title": "Caveolin-1 triggers T-cell activation via CD26 in association with CARMA1.", "journal": "J. Biol. Chem.", "date": "2007", "authors": "Ohnuma K, Uchiyama M, Yamochi T, Nishibashi K, Hosono O, Takahashi N, Kina S, Tanaka H, Lin X, Dang NH, Morimoto C", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "reference": [ { "type": "PubMed", "id": "17287217", "url": "https://glygen.org/publication/PubMed/17287217" } ] }, { "title": "Phosphorylation and ubiquitination of the IkappaB kinase complex by two distinct signaling pathways.", "journal": "The EMBO journal", "date": "2007", "authors": "Shambharkar PB, Blonska M, Pappu BP, Li H, You Y, Sakurai H, Darnay BG, Hara H, Penninger J, Lin X", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "17363905", "url": "https://glygen.org/publication/PubMed/17363905" } ] }, { "title": "Bcl10 controls TCR- and FcgammaR-induced actin polymerization.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2007", "authors": "Rueda D, Gaide O, Ho L, Lewkowicz E, Niedergang F, Hailfinger S, Rebeaud F, Guzzardi M, Conne B, Thelen M, Delon J, Ferch U, Mak TW, Ruland J, Schwaller J, Thome M", "evidence": [ { "database": "iPTMnet", "id": "O95999", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95999" } ], "reference": [ { "type": "PubMed", "id": "17371994", "url": "https://glygen.org/publication/PubMed/17371994" } ] }, { "title": "CARMA1 coiled-coil domain is involved in the oligomerization and subcellular localization of CARMA1 and is required for T cell receptor-induced NF-kappaB activation.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Tanner MJ, Hanel W, Gaffen SL, Lin X", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "17428801", "url": "https://glygen.org/publication/PubMed/17428801" } ] }, { "title": "Post-translational modifications regulate distinct functions of CARMA1 and BCL10.", "journal": "Trends in immunology", "date": "2007", "authors": "Thome M, Weil R", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "17468049", "url": "https://glygen.org/publication/PubMed/17468049" } ] }, { "title": "Ubiquitin-mediated activation of TAK1 and IKK.", "journal": "Oncogene", "date": "2007", "authors": "Adhikari A, Xu M, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "17496917", "url": "https://glygen.org/publication/PubMed/17496917" } ] }, { "title": "Phosphorylation of Bcl10 negatively regulates T-cell receptor-mediated NF-kappaB activation.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Zeng H, Di L, Fu G, Chen Y, Gao X, Xu L, Lin X, Wen R", "evidence": [ { "database": "iPTMnet", "id": "O95999", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95999" } ], "reference": [ { "type": "PubMed", "id": "17502353", "url": "https://glygen.org/publication/PubMed/17502353" } ] }, { "title": "Mechanism of diacylglycerol-induced membrane targeting and activation of protein kinase Ctheta.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Melowic HR, Stahelin RV, Blatner NR, Tian W, Hayashi K, Altman A, Cho W", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "17548359", "url": "https://glygen.org/publication/PubMed/17548359" } ] }, { "title": "Cytoplasmic retention, DNA binding and processing of the NF-kappa B p50 precursor are controlled by a small region in its C-terminus.", "journal": "The EMBO journal", "date": "1991", "authors": "Blank V, Kourilsky P, Israel A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "1756723", "url": "https://glygen.org/publication/PubMed/1756723" } ] }, { "title": "Ubiquitination of mammalian Pex5p, the peroxisomal import receptor.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Carvalho AF, Pinto MP, Grou CP, Alencastre IS, Fransen M, Sa-Miranda C, Azevedo JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "17726030", "url": "https://glygen.org/publication/PubMed/17726030" } ] }, { "title": "Identification of TRAF6-dependent NEMO polyubiquitination sites through analysis of a new NEMO mutation causing incontinentia pigmenti.", "journal": "Human molecular genetics", "date": "2007", "authors": "Sebban-Benin H, Pescatore A, Fusco F, Pascuale V, Gautheron J, Yamaoka S, Moncla A, Ursini MV, Courtois G", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "17728323", "url": "https://glygen.org/publication/PubMed/17728323" } ] }, { "title": "Malt1 ubiquitination triggers NF-kappaB signaling upon T-cell activation.", "journal": "The EMBO journal", "date": "2007", "authors": "Oeckinghaus A, Wegener E, Welteke V, Ferch U, Arslan SC, Ruland J, Scheidereit C, Krappmann D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "17948050", "url": "https://glygen.org/publication/PubMed/17948050" } ] }, { "title": "The proteolytic activity of the paracaspase MALT1 is key in T cell activation.", "journal": "Nature immunology", "date": "2008", "authors": "Rebeaud F, Hailfinger S, Posevitz-Fejfar A, Tapernoux M, Moser R, Rueda D, Gaide O, Guzzardi M, Iancu EM, Rufer N, Fasel N, Thome M", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "reference": [ { "type": "PubMed", "id": "18264101", "url": "https://glygen.org/publication/PubMed/18264101" } ] }, { "title": "NEMO recognition of ubiquitinated Bcl10 is required for T cell receptor-mediated NF-kappaB activation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Wu CJ, Ashwell JD", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "reference": [ { "type": "PubMed", "id": "18287044", "url": "https://glygen.org/publication/PubMed/18287044" } ] }, { "title": "Human HLTF functions as a ubiquitin ligase for proliferating cell nuclear antigen polyubiquitination.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Unk I, Hajdu I, Fatyol K, Hurwitz J, Yoon JH, Prakash L, Prakash S, Haracska L", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "18316726", "url": "https://glygen.org/publication/PubMed/18316726" } ] }, { "title": "Members of the E2D (UbcH5) family mediate the ubiquitination of the conserved cysteine of Pex5p, the peroxisomal import receptor.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Grou CP, Carvalho AF, Pinto MP, Wiese S, Piechura H, Meyer HE, Warscheid B, Sa-Miranda C, Azevedo JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "18359941", "url": "https://glygen.org/publication/PubMed/18359941" } ] }, { "title": "NF-kappaB p52, RelB and c-Rel are transported into the nucleus via a subset of importin alpha molecules.", "journal": "Cellular signalling", "date": "2008", "authors": "Fagerlund R, Melen K, Cao X, Julkunen I", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "18462924", "url": "https://glygen.org/publication/PubMed/18462924" } ] }, { "title": "Polyubiquitination of proliferating cell nuclear antigen by HLTF and SHPRH prevents genomic instability from stalled replication forks.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Motegi A, Liaw HJ, Lee KY, Roest HP, Maas A, Wu X, Moinova H, Markowitz SD, Ding H, Hoeijmakers JH, Myung K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "18719106", "url": "https://glygen.org/publication/PubMed/18719106" } ] }, { "title": "TRAF6 specifically contributes to FcepsilonRI-mediated cytokine production but not mast cell degranulation.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Yang YJ, Chen W, Carrigan SO, Chen WM, Roth K, Akiyama T, Inoue J, Marshall JS, Berman JN, Lin TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "18772140", "url": "https://glygen.org/publication/PubMed/18772140" } ] }, { "title": "Analysis of nucleocytoplasmic shuttling of NF kappa B proteins in human leukocytes.", "journal": "Methods in molecular biology (Clifton, N.J.)", "date": "2008", "authors": "Ghosh CC, Vu HY, Mujo T, Vancurova I", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "19066035", "url": "https://glygen.org/publication/PubMed/19066035" } ] }, { "title": "Properties of the ubiquitin-pex5p thiol ester conjugate.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Grou CP, Carvalho AF, Pinto MP, Huybrechts SJ, Sa-Miranda C, Fransen M, Azevedo JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "19208625", "url": "https://glygen.org/publication/PubMed/19208625" } ] }, { "title": "CARD9 versus CARMA1 in innate and adaptive immunity.", "journal": "Trends in immunology", "date": "2009", "authors": "Hara H, Saito T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "19359218", "url": "https://glygen.org/publication/PubMed/19359218" } ] }, { "title": "RAD6-Mediated transcription-coupled H2B ubiquitylation directly stimulates H3K4 methylation in human cells.", "journal": "Cell", "date": "2009", "authors": "Kim J, Guermah M, McGinty RK, Lee JS, Tang Z, Milne TA, Shilatifard A, Muir TW, Roeder RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "19410543", "url": "https://glygen.org/publication/PubMed/19410543" } ] }, { "title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Pan C, Olsen JV, Daub H, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O95999", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95999" } ], "reference": [ { "type": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ] }, { "title": "Biochemical characterisation of the SWI/SNF family member HLTF.", "journal": "Biochemical and biophysical research communications", "date": "2009", "authors": "MacKay C, Toth R, Rouse J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "19723507", "url": "https://glygen.org/publication/PubMed/19723507" } ] }, { "title": "Comprehending the complex connection between PKCbeta, TAK1, and IKK in BCR signaling.", "journal": "Immunological reviews", "date": "2009", "authors": "Shinohara H, Kurosaki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "19909372", "url": "https://glygen.org/publication/PubMed/19909372" } ] }, { "title": "Protein kinase C: poised to signal.", "journal": "American journal of physiology. Endocrinology and metabolism", "date": "2010", "authors": "Newton AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "19934406", "url": "https://glygen.org/publication/PubMed/19934406" } ] }, { "title": "Lysine 63-linked polyubiquitination of TAK1 at lysine 158 is required for tumor necrosis factor alpha- and interleukin-1beta-induced IKK/NF-kappaB and JNK/AP-1 activation.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Fan Y, Yu Y, Shi Y, Sun W, Xie M, Ge N, Mao R, Chang A, Xu G, Schneider MD, Zhang H, Fu S, Qin J, Yang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "20038579", "url": "https://glygen.org/publication/PubMed/20038579" } ] }, { "title": "Phosphoproteome analysis of human liver tissue by long-gradient nanoflow LC coupled with multiple stage MS analysis.", "journal": "Electrophoresis", "date": "2010", "authors": "Han G, Ye M, Liu H, Song C, Sun D, Wu Y, Jiang X, Chen R, Wang C, Wang L, Zou H", "evidence": [ { "database": "iPTMnet", "id": "O95999", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95999" } ], "reference": [ { "type": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" } ] }, { "title": "Syk-coupled C-type lectin receptors that mediate cellular activation via single tyrosine based activation motifs.", "journal": "Immunological reviews", "date": "2010", "authors": "Kerrigan AM, Brown GD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "20193029", "url": "https://glygen.org/publication/PubMed/20193029" } ] }, { "title": "The IKK complex, a central regulator of NF-kappaB activation.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2010", "authors": "Israel A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "20300203", "url": "https://glygen.org/publication/PubMed/20300203" } ] }, { "title": "Competition between TRAF2 and TRAF6 regulates NF-kappaB activation in human B lymphocytes.", "journal": "Chinese medical sciences journal = Chung-kuo i hsueh k'o hsueh tsa chih", "date": "2010", "authors": "Zhang W, Zhang X, Wu XL, He LS, Zeng XF, Crammer AC, Lipsky PE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "20449947", "url": "https://glygen.org/publication/PubMed/20449947" } ] }, { "title": "Lipopolysaccharide-induced activation of NF-kappaB non-canonical pathway requires BCL10 serine 138 and NIK phosphorylations.", "journal": "Experimental cell research", "date": "2010", "authors": "Bhattacharyya S, Borthakur A, Dudeja PK, Tobacman JK", "evidence": [ { "database": "iPTMnet", "id": "O95999", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95999" } ], "reference": [ { "type": "PubMed", "id": "20466000", "url": "https://glygen.org/publication/PubMed/20466000" } ] }, { "title": "Autoactivation of transforming growth factor beta-activated kinase 1 is a sequential bimolecular process.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Scholz R, Sidler CL, Thali RF, Winssinger N, Cheung PC, Neumann D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "20538596", "url": "https://glygen.org/publication/PubMed/20538596" } ] }, { "title": "Antigen receptor signaling to NF-kappaB via CARMA1, BCL10, and MALT1.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2010", "authors": "Thome M, Charton JE, Pelzer C, Hailfinger S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "20685844", "url": "https://glygen.org/publication/PubMed/20685844" } ] }, { "title": "RNF152, a novel lysosome localized E3 ligase with pro-apoptotic activities.", "journal": "Protein & cell", "date": "2010", "authors": "Zhang S, Wu W, Wu Y, Zheng J, Suo T, Tang H, Tang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "21203937", "url": "https://glygen.org/publication/PubMed/21203937" } ] }, { "title": "WAC, a functional partner of RNF20/40, regulates histone H2B ubiquitination and gene transcription.", "journal": "Molecular cell", "date": "2011", "authors": "Zhang F, Yu X", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "21329877", "url": "https://glygen.org/publication/PubMed/21329877" } ] }, { "title": "SHPRH and HLTF act in a damage-specific manner to coordinate different forms of postreplication repair and prevent mutagenesis.", "journal": "Molecular cell", "date": "2011", "authors": "Lin JR, Zeman MK, Chen JY, Yee MC, Cimprich KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "21396873", "url": "https://glygen.org/publication/PubMed/21396873" } ] }, { "title": "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.", "journal": "Science signaling", "date": "2011", "authors": "Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" }, { "database": "iPTMnet", "id": "O95999", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95999" } ], "reference": [ { "type": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" } ] }, { "title": "Activation of the innate immune receptor Dectin-1 upon formation of a 'phagocytic synapse'.", "journal": "Nature", "date": "2011", "authors": "Goodridge HS, Reyes CN, Becker CA, Katsumoto TR, Ma J, Wolf AJ, Bose N, Chan AS, Magee AS, Danielson ME, Weiss A, Vasilakos JP, Underhill DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "21525931", "url": "https://glygen.org/publication/PubMed/21525931" } ] }, { "title": "Cysteine ubiquitination of PTS1 receptor Pex5p regulates Pex5p recycling.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2011", "authors": "Okumoto K, Misono S, Miyata N, Matsumoto Y, Mukai S, Fujiki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "21554508", "url": "https://glygen.org/publication/PubMed/21554508" } ] }, { "title": "Dephosphorylation of Bcl-10 by calcineurin is essential for canonical NF-kappaB activation in Th cells.", "journal": "European journal of immunology", "date": "2011", "authors": "Frischbutter S, Gabriel C, Bendfeldt H, Radbruch A, Baumgrass R", "evidence": [ { "database": "iPTMnet", "id": "O95999", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95999" } ], "reference": [ { "type": "PubMed", "id": "21674474", "url": "https://glygen.org/publication/PubMed/21674474" } ] }, { "title": "Specific effects of BCL10 Serine mutations on phosphorylations in canonical and noncanonical pathways of NF-kappaB activation following carrageenan.", "journal": "American journal of physiology. Gastrointestinal and liver physiology", "date": "2011", "authors": "Bhattacharyya S, Borthakur A, Anbazhagan AN, Katyal S, Dudeja PK, Tobacman JK", "evidence": [ { "database": "iPTMnet", "id": "O95999", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95999" } ], "reference": [ { "type": "PubMed", "id": "21700900", "url": "https://glygen.org/publication/PubMed/21700900" } ] }, { "title": "Oligomeric structure of the MALT1 tandem Ig-like domains.", "journal": "PloS one", "date": "2011", "authors": "Qiu L, Dhe-Paganon S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "21966355", "url": "https://glygen.org/publication/PubMed/21966355" } ] }, { "title": "The tumor suppressor CDC73 interacts with the ring finger proteins RNF20 and RNF40 and is required for the maintenance of histone 2B monoubiquitination.", "journal": "Human molecular genetics", "date": "2012", "authors": "Hahn MA, Dickson KA, Jackson S, Clarkson A, Gill AJ, Marsh DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "22021426", "url": "https://glygen.org/publication/PubMed/22021426" } ] }, { "title": "Polyubiquitination of transforming growth factor beta (TGFbeta)-associated kinase 1 mediates nuclear factor-kappaB activation in response to different inflammatory stimuli.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Hamidi A, von Bulow V, Hamidi R, Winssinger N, Barluenga S, Heldin CH, Landstrom M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "22069318", "url": "https://glygen.org/publication/PubMed/22069318" } ] }, { "title": "Syk kinase-coupled C-type lectin receptors engage protein kinase C-sigma to elicit Card9 adaptor-mediated innate immunity.", "journal": "Immunity", "date": "2012", "authors": "Strasser D, Neumann K, Bergmann H, Marakalala MJ, Guler R, Rojowska A, Hopfner KP, Brombacher F, Urlaub H, Baier G, Brown GD, Leitges M, Ruland J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "22265677", "url": "https://glygen.org/publication/PubMed/22265677" } ] }, { "title": "Regulation of PKC-theta function by phosphorylation in T cell receptor signaling.", "journal": "Frontiers in immunology", "date": "2012", "authors": "Wang X, Chuang HC, Li JP, Tan TH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "22798961", "url": "https://glygen.org/publication/PubMed/22798961" } ] }, { "title": "Proteome wide purification and identification of O-GlcNAc-modified proteins using click chemistry and mass spectrometry.", "journal": "Journal of proteome research", "date": "2013", "authors": "Hahne H, Sobotzki N, Nyberg T, Helm D, Borodkin VS, van Aalten DM, Agnew B, Kuster B", "evidence": [ { "database": "O-GlcNAc Database", "id": "O95999", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95999" } ], "reference": [ { "type": "PubMed", "id": "23301498", "url": "https://glygen.org/publication/PubMed/23301498" } ] }, { "title": "Structural architecture of the CARMA1/Bcl10/MALT1 signalosome: nucleation-induced filamentous assembly.", "journal": "Molecular cell", "date": "2013", "authors": "Qiao Q, Yang C, Zheng C, Fontan L, David L, Yu X, Bracken C, Rosen M, Melnick A, Egelman EH, Wu H", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" }, { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "24074955", "url": "https://glygen.org/publication/PubMed/24074955" } ] }, { "title": "Distinct modes of ubiquitination of peroxisome-targeting signal type 1 (PTS1) receptor Pex5p regulate PTS1 protein import.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Okumoto K, Noda H, Fujiki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "24662292", "url": "https://glygen.org/publication/PubMed/24662292" } ] }, { "title": "BCL10 regulates RNF8/RNF168-mediated ubiquitination in the DNA damage response.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2014", "authors": "Zhao H, Zhu M, Dou G, Zhao H, Zhu B, Li J, Liao J, Xu X", "evidence": [ { "database": "iPTMnet", "id": "O95999", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95999" } ], "reference": [ { "type": "PubMed", "id": "24732096", "url": "https://glygen.org/publication/PubMed/24732096" } ] }, { "title": "A high-coverage shRNA screen identifies TMEM129 as an E3 ligase involved in ER-associated protein degradation.", "journal": "Nature communications", "date": "2014", "authors": "van de Weijer ML, Bassik MC, Luteijn RD, Voorburg CM, Lohuis MA, Kremmer E, Hoeben RC, LeProust EM, Chen S, Hoelen H, Ressing ME, Patena W, Weissman JS, McManus MT, Wiertz EJ, Lebbink RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "24807418", "url": "https://glygen.org/publication/PubMed/24807418" } ] }, { "title": "RNF144A, an E3 ubiquitin ligase for DNA-PKcs, promotes apoptosis during DNA damage.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014", "authors": "Ho SR, Mahanic CS, Lee YJ, Lin WC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "24979766", "url": "https://glygen.org/publication/PubMed/24979766" } ] }, { "title": "TMEM129 is a Derlin-1 associated ERAD E3 ligase essential for virus-induced degradation of MHC-I.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014", "authors": "van den Boomen DJ, Timms RT, Grice GL, Stagg HR, Skodt K, Dougan G, Nathan JA, Lehner PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "25030448", "url": "https://glygen.org/publication/PubMed/25030448" } ] }, { "title": "Arsenite binds to the RING finger domains of RNF20-RNF40 histone E3 ubiquitin ligase and inhibits DNA double-strand break repair.", "journal": "Journal of the American Chemical Society", "date": "2014", "authors": "Zhang F, Paramasivam M, Cai Q, Dai X, Wang P, Lin K, Song J, Seidman MM, Wang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "25170678", "url": "https://glygen.org/publication/PubMed/25170678" } ] }, { "title": "Inherited BCL10 deficiency impairs hematopoietic and nonhematopoietic immunity.", "journal": "The Journal of clinical investigation", "date": "2014", "authors": "Torres JM, Martinez-Barricarte R, Garcia-Gomez S, Mazariegos MS, Itan Y, Boisson B, Rholvarez R, Jimenez-Reinoso A, del Pino L, Rodriguez-Pena R, Ferreira A, Hernandez-Jimenez E, Toledano V, Cubillos-Zapata C, Diaz-Almiron M, Lopez-Collazo E, Unzueta-Roch JL, Sanchez-Ramon S, Regueiro JR, Lopez-Granados E, Casanova JL, Perez de Diego R", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "reference": [ { "type": "PubMed", "id": "25365219", "url": "https://glygen.org/publication/PubMed/25365219" } ] }, { "title": "The ubiquitination of rag A GTPase by RNF152 negatively regulates mTORC1 activation.", "journal": "Molecular cell", "date": "2015", "authors": "Deng L, Jiang C, Chen L, Jin J, Wei J, Zhao L, Chen M, Pan W, Xu Y, Chu H, Wang X, Ge X, Li D, Liao L, Liu M, Li L, Wang P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "25936802", "url": "https://glygen.org/publication/PubMed/25936802" } ] }, { "title": "Systems-wide analysis of BCR signalosomes and downstream phosphorylation and ubiquitylation.", "journal": "Molecular systems biology", "date": "2015", "authors": "Satpathy S, Wagner SA, Beli P, Gupta R, Kristiansen TA, Malinova D, Francavilla C, Tolar P, Bishop GA, Hostager BS, Choudhary C", "evidence": [ { "database": "iPTMnet", "id": "O95999", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95999" } ], "reference": [ { "type": "PubMed", "id": "26038114", "url": "https://glygen.org/publication/PubMed/26038114" } ] }, { "title": "Export-deficient monoubiquitinated PEX5 triggers peroxisome removal in SV40 large T antigen-transformed mouse embryonic fibroblasts.", "journal": "Autophagy", "date": "2015", "authors": "Nordgren M, Francisco T, Lismont C, Hennebel L, Brees C, Wang B, Van Veldhoven PP, Azevedo JE, Fransen M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "26086376", "url": "https://glygen.org/publication/PubMed/26086376" } ] }, { "title": "Identifying the ERAD ubiquitin E3 ligases for viral and cellular targeting of MHC class I.", "journal": "Molecular immunology", "date": "2015", "authors": "van den Boomen DJ, Lehner PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "26210183", "url": "https://glygen.org/publication/PubMed/26210183" } ] }, { "title": "Regulation of RNF144A E3 Ubiquitin Ligase Activity by Self-association through Its Transmembrane Domain.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Ho SR, Lee YJ, Lin WC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "26216882", "url": "https://glygen.org/publication/PubMed/26216882" } ] }, { "title": "ATM functions at the peroxisome to induce pexophagy in response to ROS.", "journal": "Nature cell biology", "date": "2015", "authors": "Zhang J, Tripathi DN, Jing J, Alexander A, Kim J, Powell RT, Dere R, Tait-Mulder J, Lee JH, Paull TT, Pandita RK, Charaka VK, Pandita TK, Kastan MB, Walker CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "26344566", "url": "https://glygen.org/publication/PubMed/26344566" } ] }, { "title": "Human HLTF mediates postreplication repair by its HIRAN domain-dependent replication fork remodelling.", "journal": "Nucleic acids research", "date": "2015", "authors": "Achar YJ, Balogh D, Neculai D, Juhasz S, Morocz M, Gali H, Dhe-Paganon S, Venclovas C, Haracska L", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "26350214", "url": "https://glygen.org/publication/PubMed/26350214" } ] }, { "title": "Ubiquitin Ligase TRIM62 Regulates CARD9-Mediated Anti-fungal Immunity and Intestinal Inflammation.", "journal": "Immunity", "date": "2015", "authors": "Cao Z, Conway KL, Heath RJ, Rush JS, Leshchiner ES, Ramirez-Ortiz ZG, Nedelsky NB, Huang H, Ng A, Gardet A, Cheng SC, Shamji AF, Rioux JD, Wijmenga C, Netea MG, Means TK, Daly MJ, Xavier RJ", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "reference": [ { "type": "PubMed", "id": "26488816", "url": "https://glygen.org/publication/PubMed/26488816" } ] }, { "title": "Negative Regulation of CARD11 Signaling and Lymphoma Cell Survival by the E3 Ubiquitin Ligase RNF181.", "journal": "Molecular and cellular biology", "date": "2015", "authors": "Pedersen SM, Chan W, Jattani RP, Mackie dS, Pomerantz JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "26711259", "url": "https://glygen.org/publication/PubMed/26711259" } ] }, { "title": "The paracaspase MALT1 mediates CARD14-induced signaling in keratinocytes.", "journal": "EMBO Rep.", "date": "2016", "authors": "Afonina IS, Van Nuffel E, Baudelet G, Driege Y, Kreike M, Staal J, Beyaert R", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "reference": [ { "type": "PubMed", "id": "27113748", "url": "https://glygen.org/publication/PubMed/27113748" } ] }, { "title": "Structure and Function of the RING Domains of RNF20 and RNF40, Dimeric E3 Ligases that Monoubiquitylate Histone H2B.", "journal": "Journal of molecular biology", "date": "2016", "authors": "Foglizzo M, Middleton AJ, Day CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "27569044", "url": "https://glygen.org/publication/PubMed/27569044" } ] }, { "title": "PEX2 is the E3 ubiquitin ligase required for pexophagy during starvation.", "journal": "The Journal of cell biology", "date": "2016", "authors": "Sargent G, van Zutphen T, Shatseva T, Zhang L, Di Giovanni V, Bandsma R, Kim PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "27597759", "url": "https://glygen.org/publication/PubMed/27597759" } ] }, { "title": "Molecular Determinants of Scaffold-induced Linear Ubiquitinylation of B Cell Lymphoma/Leukemia 10 (Bcl10) during T Cell Receptor and Oncogenic Caspase Recruitment Domain-containing Protein 11 (CARD11) Signaling.", "journal": "The Journal of biological chemistry", "date": "2016", "authors": "Yang YK, Yang C, Chan W, Wang Z, Deibel KE, Pomerantz JL", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "reference": [ { "type": "PubMed", "id": "27777308", "url": "https://glygen.org/publication/PubMed/27777308" } ] }, { "title": "The RING finger domain E3 ubiquitin ligases BRCA1 and the RNF20/RNF40 complex in global loss of the chromatin mark histone H2B monoubiquitination (H2Bub1) in cell line models and primary high-grade serous ovarian cancer.", "journal": "Human molecular genetics", "date": "2016", "authors": "Dickson KA, Cole AJ, Gill AJ, Clarkson A, Gard GB, Chou A, Kennedy CJ, Henderson BR, Fereday S, Traficante N, Alsop K, Bowtell DD, deFazio A, Clifton-Bligh R, Marsh DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "27798111", "url": "https://glygen.org/publication/PubMed/27798111" } ] }, { "title": "Germline hypomorphic CARD11 mutations in severe atopic disease.", "journal": "Nat. Genet.", "date": "2017", "authors": "Ma CA, Stinson JR, Zhang Y, Abbott JK, Weinreich MA, Hauk PJ, Reynolds PR, Lyons JJ, Nelson CG, Ruffo E, Dorjbal B, Glauzy S, Yamakawa N, Arjunaraja S, Voss K, Stoddard J, Niemela J, Zhang Y, Rosenzweig SD, McElwee JJ, DiMaggio T, Matthews HF, Jones N, Stone KD, Palma A, Oleastro M, Prieto E, Bernasconi AR, Dubra G, Danielian S, Zaiat J, Marti MA, Kim B, Cooper MA, Romberg N, Meffre E, Gelfand EW, Snow AL, Milner JD", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "reference": [ { "type": "PubMed", "id": "28628108", "url": "https://glygen.org/publication/PubMed/28628108" } ] }, { "title": "A triarylphosphine-trimethylpiperidine reagent for the one-step derivatization and enrichment of protein post-translational modifications and identification by mass spectrometry.", "journal": "Chemical communications (Cambridge, England)", "date": "2018", "authors": "Huo B, Zhang W, Zhao X, Dong H, Yu Y, Wang J, Qian X, Qin W", "evidence": [ { "database": "O-GlcNAc Database", "id": "O95999", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95999" } ], "reference": [ { "type": "PubMed", "id": "30379171", "url": "https://glygen.org/publication/PubMed/30379171" } ] }, { "title": "Activation of DNA-binding activity in an apparently cytoplasmic precursor of the NF-kappa B transcription factor.", "journal": "Cell", "date": "1988", "authors": "Baeuerle PA, Baltimore D", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "3129195", "url": "https://glygen.org/publication/PubMed/3129195" } ] }, { "title": "Structures of autoinhibited and polymerized forms of CARD9 reveal mechanisms of CARD9 and CARD11 activation.", "journal": "Nat. Commun.", "date": "2019", "authors": "Holliday MJ, Witt A, Rodriguez Gama A, Walters BT, Arthur CP, Halfmann R, Rohou A, Dueber EC, Fairbrother WJ", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "reference": [ { "type": "PubMed", "id": "31296852", "url": "https://glygen.org/publication/PubMed/31296852" } ] }, { "title": "BCL10 Mutations Define Distinct Dependencies Guiding Precision Therapy for DLBCL.", "journal": "Cancer discovery", "date": "2022", "authors": "Xia M, David L, Teater M, Gutierrez J, Wang X, Meydan C, Lytle A, Slack GW, Scott DW, Morin RD, Onder O, Elenitoba-Johnson KSJ, Zamponi N, Cerchietti L, Lu T, Philippar U, Fontan L, Wu H, Melnick AM", "evidence": [ { "database": "RefSeq", "id": "NP_003912", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003912" } ], "reference": [ { "type": "PubMed", "id": "35658124", "url": "https://glygen.org/publication/PubMed/35658124" } ] }, { "title": "A nucleation barrier spring-loads the CBM signalosome for binary activation.", "journal": "eLife", "date": "2022", "authors": "Rodriguez Gama A, Miller T, Lange JJ, Unruh JR, Halfmann R", "evidence": [ { "database": "RefSeq", "id": "NP_003912", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003912" } ], "reference": [ { "type": "PubMed", "id": "35727133", "url": "https://glygen.org/publication/PubMed/35727133" } ] }, { "title": "BCL10 loss-of-function novel mutation leading to atypical severe combined immunodeficiency.", "journal": "Clinical immunology (Orlando, Fla.)", "date": "2022", "authors": "Al-Tamemi S, Alhinai Z, Al-Rahbi N, Al-Abdawani R, Al-Yazidi L, Al-Shekaili J, Al-Kindi M, Al-Maawali A", "evidence": [ { "database": "RefSeq", "id": "NP_003912", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003912" } ], "reference": [ { "type": "PubMed", "id": "35750252", "url": "https://glygen.org/publication/PubMed/35750252" } ] }, { "title": "A transposable element into the human long noncoding RNA CARMEN is a switch for cardiac precursor cell specification.", "journal": "Cardiovascular research", "date": "2022-12-20", "authors": "Plaisance Isabelle, Chouvardas Panagiotis, Sun Yuliangzi, Nemir Mohamed, Aghagolzadeh Parisa, Aminfar Farhang, Shen Sophie, Shim Woo Jun, Rochais Francesca, Johnson Rory, Palpant Nathan, Pedrazzini Thierry", "evidence": [ { "database": "RefSeq", "id": "NP_003912", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003912" } ], "reference": [ { "type": "PubMed", "id": "36537036", "url": "https://glygen.org/publication/PubMed/36537036" } ] }, { "title": "Regulatory roles of CARD9-BCL10-Rac1 (CBR) signalome in islet \u03b2-cell function in health and metabolic stress: Is there room for MALT1?", "journal": "Biochemical pharmacology", "date": "2023-12", "authors": "Kowluru Anjaneyulu", "evidence": [ { "database": "RefSeq", "id": "NP_003912", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003912" } ], "reference": [ { "type": "PubMed", "id": "37991197", "url": "https://glygen.org/publication/PubMed/37991197" } ] }, { "title": "Stimulation-dependent I kappa B alpha phosphorylation marks the NF-kappa B inhibitor for degradation via the ubiquitin-proteasome pathway.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Alkalay I, Yaron A, Hatzubai A, Orian A, Ciechanover A, Ben-Neriah Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "7479848", "url": "https://glygen.org/publication/PubMed/7479848" } ] }, { "title": "Signal-induced degradation of I kappa B alpha requires site-specific ubiquitination.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Scherer DC, Brockman JA, Chen Z, Maniatis T, Ballard DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "7479976", "url": "https://glygen.org/publication/PubMed/7479976" } ] }, { "title": "Protein kinase C: structure, function, and regulation.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Newton AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "7499357", "url": "https://glygen.org/publication/PubMed/7499357" } ] }, { "title": "Inactivation of NF-kappa B inhibitor I kappa B alpha: ubiquitin-dependent proteolysis and its degradation product.", "journal": "Biochemical and biophysical research communications", "date": "1995", "authors": "Li CC, Dai RM, Longo DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "7575604", "url": "https://glygen.org/publication/PubMed/7575604" } ] }, { "title": "Significance of PIP2 hydrolysis and regulation of phospholipase C isozymes.", "journal": "Current opinion in cell biology", "date": "1995", "authors": "Lee SB, Rhee SG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "7612269", "url": "https://glygen.org/publication/PubMed/7612269" } ] }, { "title": "Signal-induced site-specific phosphorylation targets I kappa B alpha to the ubiquitin-proteasome pathway.", "journal": "Genes & development", "date": "1995", "authors": "Chen Z, Hagler J, Palombella VJ, Melandri F, Scherer D, Ballard D, Maniatis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "7628694", "url": "https://glygen.org/publication/PubMed/7628694" } ] }, { "title": "Tumor necrosis factor alpha-induced phosphorylation of I kappa B alpha is a signal for its degradation but not dissociation from NF-kappa B.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Miyamoto S, Maki M, Schmitt MJ, Hatanaka M, Verma IM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "7809113", "url": "https://glygen.org/publication/PubMed/7809113" } ] }, { "title": "Activation of NF-kappa B requires proteolysis of the inhibitor I kappa B-alpha: signal-induced phosphorylation of I kappa B-alpha alone does not release active NF-kappa B.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Lin YC, Brown K, Siebenlist U", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "7831327", "url": "https://glygen.org/publication/PubMed/7831327" } ] }, { "title": "Phosphorylation of I kappa B alpha precedes but is not sufficient for its dissociation from NF-kappa B.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "DiDonato JA, Mercurio F, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "7862124", "url": "https://glygen.org/publication/PubMed/7862124" } ] }, { "title": "A proteasome inhibitor prevents activation of NF-kappa B and stabilizes a newly phosphorylated form of I kappa B-alpha that is still bound to NF-kappa B.", "journal": "The EMBO journal", "date": "1994", "authors": "Traenckner EB, Wilk S, Baeuerle PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "7957109", "url": "https://glygen.org/publication/PubMed/7957109" } ] }, { "title": "Activation of purified human protein kinase C alpha and beta I isoenzymes in vitro by Ca2+, phosphatidylinositol and phosphatidylinositol 4,5-bisphosphate.", "journal": "The Biochemical journal", "date": "1993", "authors": "Kochs G, Hummel R, Fiebich B, Sarre TF, Marme D, Hug H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "8387275", "url": "https://glygen.org/publication/PubMed/8387275" } ] }, { "title": "Critical role for lysines 21 and 22 in signal-induced, ubiquitin-mediated proteolysis of I kappa B-alpha.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Baldi L, Brown K, Franzoso G, Siebenlist U", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "8550590", "url": "https://glygen.org/publication/PubMed/8550590" } ] }, { "title": "Site-specific phosphorylation of IkappaBalpha by a novel ubiquitination-dependent protein kinase activity.", "journal": "Cell", "date": "1996", "authors": "Chen ZJ, Parent L, Maniatis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "8601309", "url": "https://glygen.org/publication/PubMed/8601309" } ] }, { "title": "The human cytomegalovirus US11 gene product dislocates MHC class I heavy chains from the endoplasmic reticulum to the cytosol.", "journal": "Cell", "date": "1996", "authors": "Wiertz EJ, Jones TR, Sun L, Bogyo M, Geuze HJ, Ploegh HL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "8625414", "url": "https://glygen.org/publication/PubMed/8625414" } ] }, { "title": "Immunodeficiency in protein kinase cbeta-deficient mice.", "journal": "Science (New York, N.Y.)", "date": "1996", "authors": "Leitges M, Schmedt C, Guinamard R, Davoust J, Schaal S, Stabel S, Tarakhovsky A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "8670417", "url": "https://glygen.org/publication/PubMed/8670417" } ] }, { "title": "Tyrosine phosphorylation and translocation of phospholipase C-gamma 2 in polymorphonuclear leukocytes treated with pervanadate.", "journal": "Biochimica et biophysica acta", "date": "1996", "authors": "Kawakami N, Shimohama S, Hayakawa T, Sumida Y, Fujimoto S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "8972730", "url": "https://glygen.org/publication/PubMed/8972730" } ] }, { "title": "Multiple PEX genes are required for proper subcellular distribution and stability of Pex5p, the PTS1 receptor: evidence that PTS1 protein import is mediated by a cycling receptor.", "journal": "The Journal of cell biology", "date": "1996", "authors": "Dodt G, Gould SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654" } ], "reference": [ { "type": "PubMed", "id": "8991089", "url": "https://glygen.org/publication/PubMed/8991089" } ] }, { "title": "I kappa B epsilon, a novel member of the I kappa B family, controls RelA and cRel NF-kappa B activity.", "journal": "The EMBO journal", "date": "1997", "authors": "Whiteside ST, Epinat JC, Rice NR, Israel A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "9135156", "url": "https://glygen.org/publication/PubMed/9135156" } ] }, { "title": "A cytokine-responsive IkappaB kinase that activates the transcription factor NF-kappaB.", "journal": "Nature", "date": "1997", "authors": "DiDonato JA, Hayakawa M, Rothwarf DM, Zandi E, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "9252186", "url": "https://glygen.org/publication/PubMed/9252186" } ] }, { "title": "A new member of the I kappaB protein family, I kappaB epsilon, inhibits RelA (p65)-mediated NF-kappaB transcription.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Li Z, Nabel GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "9315679", "url": "https://glygen.org/publication/PubMed/9315679" } ] }, { "title": "The carboxy-terminus of I kappaB alpha determines susceptibility to degradation by the catalytic core of the proteasome.", "journal": "Oncogene", "date": "1997", "authors": "Kroll M, Conconi M, Desterro MJ, Marin A, Thomas D, Friguet B, Hay RT, Virelizier JL, Arenzana-Seisdedos F, Rodriguez MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "9362451", "url": "https://glygen.org/publication/PubMed/9362451" } ] }, { "title": "T cell receptor (TCR) interacting molecule (TRIM), a novel disulfide-linked dimer associated with the TCR-CD3-zeta complex, recruits intracellular signaling proteins to the plasma membrane.", "journal": "The Journal of experimental medicine", "date": "1998", "authors": "Bruyns E, Marie-Cardine A, Kirchgessner H, Sagolla K, Shevchenko A, Mann M, Autschbach F, Bensussan A, Meuer S, Schraven B", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "9687533", "url": "https://glygen.org/publication/PubMed/9687533" } ] }, { "title": "Direct phosphorylation of IkappaB by IKKalpha and IKKbeta: discrimination between free and NF-kappaB-bound substrate.", "journal": "Science (New York, N.Y.)", "date": "1998", "authors": "Zandi E, Chen Y, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "9721103", "url": "https://glygen.org/publication/PubMed/9721103" } ] }, { "title": "Identification of the receptor component of the IkappaBalpha-ubiquitin ligase.", "journal": "Nature", "date": "1998", "authors": "Yaron A, Hatzubai A, Davis M, Lavon I, Amit S, Manning AM, Andersen JS, Mann M, Mercurio F, Ben-Neriah Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "9859996", "url": "https://glygen.org/publication/PubMed/9859996" } ] }, { "title": "All three IkappaB isoforms and most Rel family members are stably associated with the IkappaB kinase 1/2 complex.", "journal": "European journal of biochemistry", "date": "1999", "authors": "Heilker R, Freuler F, Pulfer R, Di Padova F, Eder J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "9914500", "url": "https://glygen.org/publication/PubMed/9914500" } ] }, { "title": "Bcl10 is involved in t(1;14)(p22;q32) of MALT B cell lymphoma and mutated in multiple tumor types.", "journal": "Cell", "date": "1999", "authors": "Willis TG, Jadayel DM, Du MQ, Peng H, Perry AR, Abdul-Rauf M, Price H, Karran L, Majekodunmi O, Wlodarska I, Pan L, Crook T, Hamoudi R, Isaacson PG, Dyer MJ", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "reference": [ { "type": "PubMed", "id": "9989495", "url": "https://glygen.org/publication/PubMed/9989495" } ] }, { "title": "The SCFbeta-TRCP-ubiquitin ligase complex associates specifically with phosphorylated destruction motifs in IkappaBalpha and beta-catenin and stimulates IkappaBalpha ubiquitination in vitro.", "journal": "Genes & development", "date": "1999", "authors": "Winston JT, Strack P, Beer-Romero P, Chu CY, Elledge SJ, Harper JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "9990852", "url": "https://glygen.org/publication/PubMed/9990852" } ] }, { "title": "Signal-induced ubiquitination of IkappaBalpha by the F-box protein Slimb/beta-TrCP.", "journal": "Genes & development", "date": "1999", "authors": "Spencer E, Jiang J, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "9990853", "url": "https://glygen.org/publication/PubMed/9990853" } ] } ], "pathway": [ { "id": "hsa:8915", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8915", "resource": "KEGG Pathway" }, { "id": "R-HSA-1169091", "name": "Activation of NF-kappaB in B cells", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091", "resource": "Reactome", "description": "Activation of NF-kappaB in B cells" }, { "id": "R-HSA-202424", "name": "Downstream TCR signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424", "resource": "Reactome", "description": "Downstream TCR signaling" }, { "id": "R-HSA-2871837", "name": "FCERI mediated NF-kB activation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837", "resource": "Reactome", "description": "FCERI mediated NF-kB activation" }, { "id": "R-HSA-5607764", "name": "CLEC7A (Dectin-1) signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764", "resource": "Reactome", "description": "CLEC7A (Dectin-1) signaling" }, { "id": "R-HSA-8866654", "name": "E3 ubiquitin ligases ubiquitinate target proteins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866654", "resource": "Reactome", "description": "E3 ubiquitin ligases ubiquitinate target proteins" } ], "orthologs": [ { "uniprot_canonical_ac": "Q9QYN5-1", "protein_name": "B-cell lymphoma/leukemia 10", "gene_name": "Bcl10", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MEAPAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTSSRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLKCSSCEPFAAGATNNLSRSNSDESNFSEKQRPSTVIYHPEGESSTAPFFSTESSLNLPVLEVGRLENSSFSSASLPRPGDPGAPPLPPDLRLEEGGSCGNSSEMFLPLRSRALSRQ", "length": 233 }, "evidence": [ { "id": "45922814", "url": "http://www.informatics.jax.org/homology/45922814", "database": "MGI" }, { "id": "O95999", "url": "https://omabrowser.org/oma/group/O95999/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9Z0H7-1", "protein_name": "B-cell lymphoma/leukemia 10", "gene_name": "Bcl10", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MEAPAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTSSRKRAGKLLDYLQENPRGLDTLVESIRREKTQSFLIQKITDEVLKLRNIKLEHLKGLKCSSCEPFAAGATNNLSRCNSDESNLSEKQRASTVMYHPEGESSTAPFFSMASSLNLPVLEVGRTENSSFSSATLPRPGDPGAPPLPPDLRLEEGGSCGNSSEMFLPLRSRALSRQ", "length": 233 }, "evidence": [ { "id": "45922814", "url": "http://www.informatics.jax.org/homology/45922814", "database": "MGI" }, { "id": "O95999", "url": "https://omabrowser.org/oma/group/O95999/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 10, "go_terms": [ { "name": "protease binding", "id": "GO:0002020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002020", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "transcription coactivator activity", "id": "GO:0003713", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003713", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "ubiquitin protein ligase binding", "id": "GO:0031625", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031625", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "protein self-association", "id": "GO:0043621", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043621", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "protein-containing complex binding", "id": "GO:0044877", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044877", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "NF-kappaB binding", "id": "GO:0051059", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051059", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "protein kinase B binding", "id": "GO:0043422", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043422", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "CARD domain binding", "id": "GO:0050700", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050700", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "general transcription initiation factor binding", "id": "GO:0140296", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140296", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 11, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "membrane raft", "id": "GO:0045121", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045121", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "perinuclear region of cytoplasm", "id": "GO:0048471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "lysosome", "id": "GO:0005764", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005764", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "cytoplasmic microtubule", "id": "GO:0005881", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005881", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "protein-containing complex", "id": "GO:0032991", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032991", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "immunological synapse", "id": "GO:0001772", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001772", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "CBM complex", "id": "GO:0032449", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032449", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "polkadots", "id": "GO:0002096", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002096", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 34, "go_terms": [ { "name": "positive regulation of apoptotic process", "id": "GO:0043065", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043065", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "positive regulation of cysteine-type endopeptidase activity involved in apoptotic process", "id": "GO:0043280", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043280", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "innate immune response", "id": "GO:0045087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "positive regulation of NF-kappaB transcription factor activity", "id": "GO:0051092", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051092", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "protein homooligomerization", "id": "GO:0051260", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051260", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "cellular defense response", "id": "GO:0006968", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006968", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "response to food", "id": "GO:0032094", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032094", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "positive regulation of interleukin-6 production", "id": "GO:0032755", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032755", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "T cell receptor signaling pathway", "id": "GO:0050852", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050852", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "cellular response to lipopolysaccharide", "id": "GO:0071222", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071222", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "negative regulation of mature B cell apoptotic process", "id": "GO:0002906", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002906", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "positive regulation of canonical NF-kappaB signal transduction", "id": "GO:0043123", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043123", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "positive regulation of T cell receptor signaling pathway", "id": "GO:0050862", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050862", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "neural tube closure", "id": "GO:0001843", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001843", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "adaptive immune response", "id": "GO:0002250", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002250", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "positive regulation of extrinsic apoptotic signaling pathway", "id": "GO:2001238", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001238", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "positive regulation of protein ubiquitination", "id": "GO:0031398", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031398", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "positive regulation of phosphorylation", "id": "GO:0042327", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042327", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "cellular response to mechanical stimulus", "id": "GO:0071260", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071260", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "positive regulation of interleukin-8 production", "id": "GO:0032757", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032757", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "canonical NF-kappaB signal transduction", "id": "GO:0007249", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007249", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "lipopolysaccharide-mediated signaling pathway", "id": "GO:0031663", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031663", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "toll-like receptor signaling pathway", "id": "GO:0002224", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002224", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "positive regulation of T cell activation", "id": "GO:0050870", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050870", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "B cell apoptotic process", "id": "GO:0001783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001783", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "immunoglobulin mediated immune response", "id": "GO:0016064", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016064", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "positive regulation of mast cell cytokine production", "id": "GO:0032765", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032765", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "T cell apoptotic process", "id": "GO:0070231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070231", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "antifungal innate immune response", "id": "GO:0061760", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061760", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "programmed cell death", "id": "GO:0012501", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0012501", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "positive regulation of lymphotoxin A production", "id": "GO:0032761", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032761", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "apoptotic process", "id": "GO:0006915", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006915", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" }, { "name": "regulation of apoptotic process", "id": "GO:0042981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042981", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 132, "end_pos": 134, "annotation": "n_glycosylation_sequon" }, { "start_pos": 142, "end_pos": 144, "annotation": "n_glycosylation_sequon" }, { "start_pos": 169, "end_pos": 171, "annotation": "n_glycosylation_sequon" }, { "start_pos": 217, "end_pos": 219, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylated. Phosphorylation results in dissociation from TRAF2 and binding to BIRC2/c-IAP2 (PubMed:11466612). Phosphorylated by IKBKB/IKKB (PubMed:17213322).", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" }, { "database": "PubMed", "id": "17213322", "url": "https://glygen.org/publication/PubMed/17213322" }, { "database": "PubMed", "id": "11466612", "url": "https://glygen.org/publication/PubMed/11466612" } ] }, { "annotation": "Proteolytically cleaved by MALT1; required for T-cell activation.", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" }, { "database": "PubMed", "id": "18264101", "url": "https://glygen.org/publication/PubMed/18264101" } ] }, { "annotation": "Ubiquitinated via both 'Lys-63'-linked and linear ('Met-1'-linked) polyubiquitin chains in response to T-cell receptor (TCR) activation (PubMed:18287044, PubMed:27777308). Ubiquitination is recognized by IKBKG/NEMO, the regulatory subunit of I-kappa-B kinase (IKK), and is required for TCR-induced NF-kappa-B activation (PubMed:18287044, PubMed:27777308). Linear ubiquitination at Lys-17, Lys-31 and Lys-63 is mediated by RNF31/HOIP; linear ubiquitination is recognized with much higher affinity than 'Lys-63'-linked ubiquitin by IKBKG/NEMO (PubMed:27777308). CARD11 is required for linear ubiquitination by HOIP by promoting the targeting of BCL10 to RNF31/HOIP (PubMed:27777308).", "evidence": [ { "database": "UniProtKB", "id": "O95999", "url": "https://www.uniprot.org/uniprot/O95999" }, { "database": "PubMed", "id": "18287044", "url": "https://glygen.org/publication/PubMed/18287044" }, { "database": "PubMed", "id": "27777308", "url": "https://glygen.org/publication/PubMed/27777308" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 91, 138, 171, 218, 231 ], "sequon_annotation_sites": [ { "start_pos": 132, "end_pos": 134 }, { "start_pos": 142, "end_pos": 144 }, { "start_pos": 169, "end_pos": 171 }, { "start_pos": 217, "end_pos": 219 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 179 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }