{ "uniprot_canonical_ac": "O95843-1", "uniprot_ac": "O95843", "uniprot_id": "GUC1C_HUMAN", "mass": { "chemical_mass": 23822.0, "monoisotopic_mass": 23822.0 }, "refseq": { "ac": "NP_005450", "name": "guanylyl cyclase-activating protein 3 isoform 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005450" }, "gene_names": [ { "name": "GUCA1C", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O95843", "id": "O95843" }, { "name": "GCAP3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005450", "id": "NP_005450" }, { "name": "GCAP3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O95843", "id": "O95843" }, { "name": "GUCA1C", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005450", "id": "NP_005450" }, { "name": "hCG_26941", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O95843", "id": "O95843" } ], "protein_names": [ { "name": "Guanylyl cyclase-activating protein 3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O95843" }, { "name": "GCAP 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95843" }, { "name": "Guanylate cyclase activator 1C", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95843" }, { "name": "guanylyl cyclase-activating protein 3 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005450", "id": "NP_005450" }, { "name": "guanylyl cyclase-activating protein 3; GCAP 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005450", "id": "NP_005450" } ], "function": [ { "annotation": "Molecular Properties of Human Guanylate Cyclase-Activating Protein 3 (GCAP3) and Its Possible Association with Retinitis Pigmentosa. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_005450", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005450" }, { "database": "PubMed", "id": "35328663", "url": "https://glygen.org/publication/PubMed/35328663" } ] }, { "annotation": "Results report the crystal structure of unmyristoylated human guanylate cyclase-activating protein 3 (GCAP3) with calcium bound.", "evidence": [ { "database": "RefSeq", "id": "NP_005450", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005450" }, { "database": "PubMed", "id": "16626734", "url": "https://glygen.org/publication/PubMed/16626734" } ] }, { "annotation": "Role of GUCA1C in Primary Congenital Glaucoma and in the Retina: Functional Evaluation in Zebrafish. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_005450", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005450" }, { "database": "PubMed", "id": "32422965", "url": "https://glygen.org/publication/PubMed/32422965" } ] }, { "annotation": "Stimulates guanylyl cyclase 1 (GC1) and GC2 when free calcium ions concentration is low and inhibits guanylyl cyclases when free calcium ions concentration is elevated. This Ca(2+)-sensitive regulation of guanylyl cyclase (GC) is a key event in recovery of the dark state of rod photoreceptors following light exposure.", "evidence": [ { "database": "UniProtKB", "id": "O95843", "url": "https://www.uniprot.org/uniprot/O95843#function" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "O95843", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95843" } ], "glycoeffect": [], "start_pos": 72, "end_pos": 72, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "V", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "3", "chr_pos": "108920576", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "V72", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] }, { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] }, { "disease_id": "DOID:2531", "recommended_name": { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes." }, "synonyms": [ { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematologic malignancy", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematologic neoplasm", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematological tumors", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "blood cancer", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic and lymphoid system tumor", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic cancer", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic neoplasm", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic tumors", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "malignant hematopoietic neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "35.29", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000138472", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000138472" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "41.27", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000138472", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000138472" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "59.92", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000138472", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000138472" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "17.43", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000138472", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000138472" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "16.94", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000138472", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000138472" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "44.52", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000138472", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000138472" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "18.06", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000138472", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000138472" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "26.57", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000138472", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000138472" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "14.41", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000138472", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000138472" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "20.98", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000138472", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000138472" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O95843", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95843" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O95843", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95843" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O95843", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95843" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O95843", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95843" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O95843", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95843" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O95843", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95843" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O95843", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95843" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O95843", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95843" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95843", "url": "https://www.uniprot.org/uniprot/O95843" } ], "common_name": "Human" } ], "gene": [ { "name": "GUCA1C", "url": "https://www.uniprot.org/uniprot/O95843", "locus": { "chromosome": "3", "start_pos": 108907792, "end_pos": 108953879, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000138472", "url": "https://www.ensembl.org/id/ENSG00000138472" } ] } } ], "crossref": [ { "id": "ENSG00000138472", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000138472", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O95843", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95843", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd00051", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00051", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "GUCA1C", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=GUCA1C", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "9626", "url": "https://www.ncbi.nlm.nih.gov/gene/9626", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "4680", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=4680", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O95843", "url": "https://www.ebi.ac.uk/intact/interactors/id:O95843*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002048", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002048", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011992", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011992", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018247", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018247", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR028846", "url": "https://www.ebi.ac.uk/interpro/entry/IPR028846", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:9626", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9626", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "605128", "url": "http://www.omim.org/entry/605128", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O95843", "url": "https://www.nextprot.org/entry/NX_O95843", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "MHHYYSK", "url": "https://omabrowser.org/oma/group/MHHYYSK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "339700at2759", "url": "http://www.orthodb.org/?query=339700at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23055", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23055", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23055:SF80", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23055:SF80", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2GGZ", "url": "https://www.rcsb.org/structure/2GGZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF13202", "url": "http://pfam.xfam.org/family/PF13202", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13499", "url": "http://pfam.xfam.org/family/PF13499", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O95843", "url": "https://pharos.nih.gov/targets/O95843", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O95843", "url": "http://purl.obolibrary.org/obo/PR_O95843", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_005450", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005450", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "C9J7M7", "url": "https://www.uniprot.org/uniprot/C9J7M7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9J7M7-1", "url": "https://www.uniprot.org/uniprot/C9J7M7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JNI2", "url": "https://www.uniprot.org/uniprot/C9JNI2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JNI2-1", "url": "https://www.uniprot.org/uniprot/C9JNI2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95843", "url": "https://www.uniprot.org/uniprot/O95843", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95843-1", "url": "https://www.uniprot.org/uniprot/O95843-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95843-2", "url": "https://www.uniprot.org/uniprot/O95843-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGNGKSIAGDQKAVPTQETHVWYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQVYNTFDTNKDGFVDFLEFIAAVNLIMQEKMEQKLKWYFKLYDADGNGSIDKNELLDMFMAVQALNGQQTLSPEEFINLVFHKIDINNDGELTLEEFINGMAKDQDLLEIVYKSFDFSNVLRVICNGKQPDMETDSSKSPDKAGLGKVKMK", "length": 209, "header": "sp|O95843-1|GUC1C_HUMAN Isoform 1 of Guanylyl cyclase-activating protein 3 OS=Homo sapiens OX=9606 GN=GUCA1C PE=1 SV=3 CANONICAL=O95843-1" }, "isoforms": [ { "isoform_ac": "C9J7M7-1", "url": "", "sequence": { "sequence": "MGNGKSIAGDQKAVPTQETHVWYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQVYNTFDTNKDGFVDFLEFIAAVNLIMQEKMEQKLKWYFKLYDADGNGSIDKNELLDMFMAVQALNGQQTLSPEEFINLVFHKIDINNDGNGATLYWITFPTK", "length": 161, "header": "tr|C9J7M7-1|C9J7M7_HUMAN Computationally mapped isoform of Guanylate cyclase activator 1C OS=Homo sapiens OX=9606 GN=GUCA1C PE=4 SV=1 CANONICAL=O95843-1" }, "locus": { "chromosome": "3", "start_pos": 108953762, "end_pos": 108916086, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000471108.1", "url": "https://www.ensembl.org/id/ENST00000471108.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000417761.1", "url": "https://www.ensembl.org/id/ENSP00000417761.1" } ] } }, { "isoform_ac": "C9JNI2-1", "url": "", "sequence": { "sequence": "MGNGKSIAGDQKAVPTQETHVWYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQVYNTFDTNKDGFVDFLEFIAAVNLIMQEKMEQKLKWYFKLYDADGNGSIDKNELLDMFMAVQALNGQQTLSPEEFINLVFHKIDINNDGNGATLYWITFPTKGIDFRRIYQWHGKRSGSPGDCLQELRLLQCAESNL", "length": 196, "header": "tr|C9JNI2-1|C9JNI2_HUMAN Computationally mapped isoform of Guanylate cyclase activator 1C OS=Homo sapiens OX=9606 GN=GUCA1C PE=4 SV=1 CANONICAL=O95843-1" }, "locus": { "chromosome": "3", "start_pos": 108953762, "end_pos": 108908104, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000393963.7", "url": "https://www.ensembl.org/id/ENST00000393963.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000377535.3", "url": "https://www.ensembl.org/id/ENSP00000377535.3" } ] } }, { "isoform_ac": "O95843-1", "url": "", "sequence": { "sequence": "MGNGKSIAGDQKAVPTQETHVWYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQVYNTFDTNKDGFVDFLEFIAAVNLIMQEKMEQKLKWYFKLYDADGNGSIDKNELLDMFMAVQALNGQQTLSPEEFINLVFHKIDINNDGELTLEEFINGMAKDQDLLEIVYKSFDFSNVLRVICNGKQPDMETDSSKSPDKAGLGKVKMK", "length": 209, "header": "sp|O95843-1|GUC1C_HUMAN Isoform 1 of Guanylyl cyclase-activating protein 3 OS=Homo sapiens OX=9606 GN=GUCA1C PE=1 SV=3 CANONICAL=O95843-1" }, "locus": { "chromosome": "3", "start_pos": 108953762, "end_pos": 108908025, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000261047.8", "url": "https://www.ensembl.org/id/ENST00000261047.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000261047.3", "url": "https://www.ensembl.org/id/ENSP00000261047.3" } ] } }, { "isoform_ac": "O95843-2", "url": "", "sequence": { "sequence": "MGNGKSIAGDQKAVPTQETHVWYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQVYNTFDTNKDGFVDFLEFIAAVNLIMQEKMEQKLKWYFKLYDADGNGSIDKNELLDMFMAVQALNGQQTLSPEEFINLVFHKIDINNDGNGATLYWITFPTKGIDFRRIYQWHGKRSGSPGDCSQELRLLQCAESNL", "length": 196, "header": "sp|O95843-2|GUC1C_HUMAN Isoform 2 of Guanylyl cyclase-activating protein 3 OS=Homo sapiens OX=9606 GN=GUCA1C PE=1 SV=3 CANONICAL=O95843-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Molecular characterization of a third member of the guanylyl cyclase-activating protein subfamily.", "journal": "J. Biol. Chem.", "date": "1999", "authors": "Haeseleer F, Sokal I, Li N, Pettenati M, Rao N, Bronson D, Wechter R, Baehr W, Palczewski K", "evidence": [ { "database": "UniProtKB", "id": "O95843", "url": "https://www.uniprot.org/uniprot/O95843" }, { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "10037746", "url": "https://glygen.org/publication/PubMed/10037746" } ] }, { "title": "The GTPase activating factor for transducin in rod photoreceptors is the complex between RGS9 and type 5 G protein beta subunit.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Makino ER, Handy JW, Li T, Arshavsky VY", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "10051575", "url": "https://glygen.org/publication/PubMed/10051575" } ] }, { "title": "Structure, alternative splicing, and expression of the human RGS9 gene.", "journal": "Gene", "date": "1999", "authors": "Zhang K, Howes KA, He W, Bronson JD, Pettenati MJ, Chen C, Palczewski K, Wensel TG, Baehr W", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "10564809", "url": "https://glygen.org/publication/PubMed/10564809" } ] }, { "title": "Slowed recovery of rod photoresponse in mice lacking the GTPase accelerating protein RGS9-1.", "journal": "Nature", "date": "2000", "authors": "Chen CK, Burns ME, He W, Wensel TG, Baylor DA, Simon MI", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "10676965", "url": "https://glygen.org/publication/PubMed/10676965" } ] }, { "title": "Phosphorylation of RGS9-1 by an endogenous protein kinase in rod outer segments.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Hu G, Jang GF, Cowan CW, Wensel TG, Palczewski K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "11292825", "url": "https://glygen.org/publication/PubMed/11292825" } ] }, { "title": "Phosphorylation of the regulator of G protein signaling RGS9-1 by protein kinase A is a potential mechanism of light- and Ca2+-mediated regulation of G protein function in photoreceptors.", "journal": "Biochemistry", "date": "2001", "authors": "Balasubramanian N, Levay K, Keren-Raifman T, Faurobert E, Slepak VZ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "11601986", "url": "https://glygen.org/publication/PubMed/11601986" } ] }, { "title": "The crystal structure of human protein farnesyltransferase reveals the basis for inhibition by CaaX tetrapeptides and their mimetics.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Long SB, Hancock PJ, Kral AM, Hellinga HW, Beese LS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "11687658", "url": "https://glygen.org/publication/PubMed/11687658" } ] }, { "title": "Normal light response, photoreceptor integrity, and rhodopsin dephosphorylation in mice lacking both protein phosphatases with EF hands (PPEF-1 and PPEF-2).", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Ramulu P, Kennedy M, Xiong WH, Williams J, Cowan M, Blesh D, Yau KW, Hurley JB, Nathans J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "11713293", "url": "https://glygen.org/publication/PubMed/11713293" } ] }, { "title": "Characterization of human GRK7 as a potential cone opsin kinase.", "journal": "Molecular vision", "date": "2001", "authors": "Chen CK, Zhang K, Church-Kopish J, Huang W, Zhang H, Chen YJ, Frederick JM, Baehr W", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "11754336", "url": "https://glygen.org/publication/PubMed/11754336" } ] }, { "title": "3-Aminopyrrolidinone farnesyltransferase inhibitors: design of macrocyclic compounds with improved pharmacokinetics and excellent cell potency.", "journal": "Journal of medicinal chemistry", "date": "2002", "authors": "Bell IM, Gallicchio SN, Abrams M, Beese LS, Beshore DC, Bhimnathwala H, Bogusky MJ, Buser CA, Culberson JC, Davide J, Ellis-Hutchings M, Fernandes C, Gibbs JB, Graham SL, Hamilton KA, Hartman GD, Heimbrook DC, Homnick CF, Huber HE, Huff JR, Kassahun K, Koblan KS, Kohl NE, Lobell RB, Lynch JJ Jr, Robinson R, Rodrigues AD, Taylor JS, Walsh ES, Williams TM, Zartman CB", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "12036349", "url": "https://glygen.org/publication/PubMed/12036349" } ] }, { "title": "R9AP, a membrane anchor for the photoreceptor GTPase accelerating protein, RGS9-1.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Hu G, Wensel TG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "12119397", "url": "https://glygen.org/publication/PubMed/12119397" } ] }, { "title": "Identification of protein kinase C isozymes responsible for the phosphorylation of photoreceptor-specific RGS9-1 at Ser475.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Sokal I, Hu G, Liang Y, Mao M, Wensel TG, Palczewski K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "12499365", "url": "https://glygen.org/publication/PubMed/12499365" } ] }, { "title": "Dual protein farnesyltransferase-geranylgeranyltransferase-I inhibitors as potential cancer chemotherapeutic agents.", "journal": "Journal of medicinal chemistry", "date": "2003", "authors": "deSolms SJ, Ciccarone TM, MacTough SC, Shaw AW, Buser CA, Ellis-Hutchings M, Fernandes C, Hamilton KA, Huber HE, Kohl NE, Lobell RB, Robinson RG, Tsou NN, Walsh ES, Graham SL, Beese LS, Taylor JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "12825937", "url": "https://glygen.org/publication/PubMed/12825937" } ] }, { "title": "Molecular cloning of a retina-specific membrane guanylyl cyclase.", "journal": "Neuron", "date": "1992", "authors": "Shyjan AW, de Sauvage FJ, Gillett NA, Goeddel DV, Lowe DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "1356371", "url": "https://glygen.org/publication/PubMed/1356371" } ] }, { "title": "Human rod photoreceptor cGMP-gated channel: amino acid sequence, gene structure, and functional expression.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "1992", "authors": "Dhallan RS, Macke JP, Eddy RL, Shows TB, Reed RR, Yau KW, Nathans J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "1379636", "url": "https://glygen.org/publication/PubMed/1379636" } ] }, { "title": "Isolation of human retinal genes: recoverin cDNA and gene.", "journal": "Biochemical and biophysical research communications", "date": "1992", "authors": "Murakami A, Yajima T, Inana G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "1387789", "url": "https://glygen.org/publication/PubMed/1387789" } ] }, { "title": "Lipid modification at the N terminus of photoreceptor G-protein alpha-subunit.", "journal": "Nature", "date": "1992", "authors": "Kokame K, Fukada Y, Yoshizawa T, Takao T, Shimonishi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "1436039", "url": "https://glygen.org/publication/PubMed/1436039" } ] }, { "title": "Defects in RGS9 or its anchor protein R9AP in patients with slow photoreceptor deactivation.", "journal": "Nature", "date": "2004", "authors": "Nishiguchi KM, Sandberg MA, Kooijman AC, Martemyanov KA, Pott JW, Hagstrom SA, Arshavsky VY, Berson EL, Dryja TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "14702087", "url": "https://glygen.org/publication/PubMed/14702087" } ] }, { "title": "Phosphorylation of GRK1 and GRK7 by cAMP-dependent protein kinase attenuates their enzymatic activities.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Horner TJ, Osawa S, Schaller MD, Weiss ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "15946941", "url": "https://glygen.org/publication/PubMed/15946941" } ] }, { "title": "Structural basis for the functional differences between type I and type II human methionine aminopeptidases.", "journal": "Biochemistry", "date": "2005", "authors": "Addlagatta A, Hu X, Liu JO, Matthews BW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "16274222", "url": "https://glygen.org/publication/PubMed/16274222" } ] }, { "title": "The crystal structure of GCAP3 suggests molecular mechanism of GCAP-linked cone dystrophies.", "journal": "J. Mol. Biol.", "date": "2006", "authors": "Stephen R, Palczewski K, Sousa MC", "evidence": [ { "database": "UniProtKB", "id": "O95843", "url": "https://www.uniprot.org/uniprot/O95843" }, { "database": "RefSeq", "id": "NP_005450", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005450" } ], "reference": [ { "type": "PubMed", "id": "16626734", "url": "https://glygen.org/publication/PubMed/16626734" } ] }, { "title": "Transducin subunit stoichiometry and cellular distribution in rod outer segments.", "journal": "Cell biology international", "date": "2006", "authors": "Clack JW, Springmeyer ML, Clark CR, Witzmann FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "16895762", "url": "https://glygen.org/publication/PubMed/16895762" } ] }, { "title": "RGS expression rate-limits recovery of rod photoresponses.", "journal": "Neuron", "date": "2006", "authors": "Krispel CM, Chen D, Melling N, Chen YJ, Martemyanov KA, Quillinan N, Arshavsky VY, Wensel TG, Chen CK, Burns ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "16908407", "url": "https://glygen.org/publication/PubMed/16908407" } ] }, { "title": "Elucidation of the function of type 1 human methionine aminopeptidase during cell cycle progression.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Hu X, Addlagatta A, Lu J, Matthews BW, Liu JO", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "17114291", "url": "https://glygen.org/publication/PubMed/17114291" } ] }, { "title": "Highly potent inhibitors of methionine aminopeptidase-2 based on a 1,2,4-triazole pharmacophore.", "journal": "Journal of medicinal chemistry", "date": "2007", "authors": "Marino JP Jr, Fisher PW, Hofmann GA, Kirkpatrick RB, Janson CA, Johnson RK, Ma C, Mattern M, Meek TD, Ryan MD, Schulz C, Smith WW, Tew DG, Tomazek TA Jr, Veber DF, Xiong WC, Yamamoto Y, Yamashita K, Yang G, Thompson SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "17636946", "url": "https://glygen.org/publication/PubMed/17636946" } ] }, { "title": "Phosphorylation of GRK7 by PKA in cone photoreceptor cells is regulated by light.", "journal": "Journal of neurochemistry", "date": "2008", "authors": "Osawa S, Jo R, Weiss ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "18803695", "url": "https://glygen.org/publication/PubMed/18803695" } ] }, { "title": "Novel mutations and electrophysiologic findings in RGS9- and R9AP-associated retinal dysfunction (Bradyopsia).", "journal": "Ophthalmology", "date": "2010", "authors": "Michaelides M, Li Z, Rana NA, Richardson EC, Hykin PG, Moore AT, Holder GE, Webster AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "19818506", "url": "https://glygen.org/publication/PubMed/19818506" } ] }, { "title": "A photoreceptor calcium binding protein is recognized by autoantibodies obtained from patients with cancer-associated retinopathy.", "journal": "The Journal of cell biology", "date": "1991", "authors": "Polans AS, Buczylko J, Crabb J, Palczewski K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "1999465", "url": "https://glygen.org/publication/PubMed/1999465" } ] }, { "title": "Lessons from photoreceptors: turning off g-protein signaling in living cells.", "journal": "Physiology (Bethesda, Md.)", "date": "2010", "authors": "Burns ME, Pugh EN Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "20430952", "url": "https://glygen.org/publication/PubMed/20430952" } ] }, { "title": "Calmodulin methyltransferase is an evolutionarily conserved enzyme that trimethylates Lys-115 in calmodulin.", "journal": "Nature communications", "date": "2010", "authors": "Magnani R, Dirk LM, Trievel RC, Houtz RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "20975703", "url": "https://glygen.org/publication/PubMed/20975703" } ] }, { "title": "Speed, sensitivity, and stability of the light response in rod and cone photoreceptors: facts and models.", "journal": "Progress in retinal and eye research", "date": "2012", "authors": "Korenbrot JI", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "22658984", "url": "https://glygen.org/publication/PubMed/22658984" } ] }, { "title": "The catalytic subunit of phosphatase 2A dephosphorylates phosphoopsin.", "journal": "Biochemistry", "date": "1989", "authors": "Palczewski K, Hargrave PA, McDowell JH, Ingebritsen TS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "2540796", "url": "https://glygen.org/publication/PubMed/2540796" } ] }, { "title": "Regulation of rhodopsin dephosphorylation by arrestin.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Palczewski K, McDowell JH, Jakes S, Ingebritsen TS, Hargrave PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "2550422", "url": "https://glygen.org/publication/PubMed/2550422" } ] }, { "title": "Interplay of phosphorylation and dephosphorylation in vision: protein phosphatases of bovine rod outer segments.", "journal": "Biochemistry", "date": "1989", "authors": "Fowles C, Akhtar M, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "2558719", "url": "https://glygen.org/publication/PubMed/2558719" } ] }, { "title": "Rous sarcoma virus transforming protein lacking myristic acid phosphorylates known polypeptide substrates without inducing transformation.", "journal": "Cell", "date": "1986", "authors": "Kamps MP, Buss JE, Sefton BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "3006923", "url": "https://glygen.org/publication/PubMed/3006923" } ] }, { "title": "The sequence of human retinal S-antigen reveals similarities with alpha-transducin.", "journal": "FEBS letters", "date": "1988", "authors": "Yamaki K, Tsuda M, Shinohara T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "3164688", "url": "https://glygen.org/publication/PubMed/3164688" } ] }, { "title": "Role of GUCA1C in Primary Congenital Glaucoma and in the Retina: Functional Evaluation in Zebrafish.", "journal": "Genes", "date": "2020", "authors": "Morales-Camara S, Alexandre-Moreno S, Bonet-Fernandez JM, Atienzar-Aroca R, Aroca-Aguilar JD, Ferre-Fernandez JJ, Mendez CD, Morales L, Fernandez-Sanchez L, Cuenca N, Coca-Prados M, Martinez-de-la-Casa JM, Garcia-Feijoo J, Escribano J", "evidence": [ { "database": "RefSeq", "id": "NP_005450", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005450" } ], "reference": [ { "type": "PubMed", "id": "32422965", "url": "https://glygen.org/publication/PubMed/32422965" } ] }, { "title": "Molecular Properties of Human Guanylate Cyclase-Activating Protein 3 (GCAP3) and Its Possible Association with Retinitis Pigmentosa.", "journal": "International journal of molecular sciences", "date": "2022", "authors": "Avesani A, Bielefeld L, Weisschuh N, Marino V, Mazzola P, Stingl K, Haack TB, Koch KW, Dell'Orco D", "evidence": [ { "database": "RefSeq", "id": "NP_005450", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005450" } ], "reference": [ { "type": "PubMed", "id": "35328663", "url": "https://glygen.org/publication/PubMed/35328663" } ] }, { "title": "Kinetics of rhodopsin bleaching in the isolated human retina.", "journal": "The Journal of physiology", "date": "1973", "authors": "Baumann C, Bender S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "4772407", "url": "https://glygen.org/publication/PubMed/4772407" } ] }, { "title": "Flow of information in the light-triggered cyclic nucleotide cascade of vision.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1981", "authors": "Fung BK, Hurley JB, Stryer L", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "6264430", "url": "https://glygen.org/publication/PubMed/6264430" } ] }, { "title": "Interaction of calmodulin with the cyclic GMP-gated channel of rod photoreceptor cells. Modulation of activity, affinity purification, and localization.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Hsu YT, Molday RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "7525588", "url": "https://glygen.org/publication/PubMed/7525588" } ] }, { "title": "Subunit 2 (or beta) of retinal rod cGMP-gated cation channel is a component of the 240-kDa channel-associated protein and mediates Ca(2+)-calmodulin modulation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Chen TY, Illing M, Molday LL, Hsu YT, Yau KW, Molday RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "7526403", "url": "https://glygen.org/publication/PubMed/7526403" } ] }, { "title": "Eukaryotic methionyl aminopeptidases: two classes of cobalt-dependent enzymes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Arfin SM, Kendall RL, Hall L, Weaver LH, Stewart AE, Matthews BW, Bradshaw RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "7644482", "url": "https://glygen.org/publication/PubMed/7644482" } ] }, { "title": "A homozygous 1-base pair deletion in the arrestin gene is a frequent cause of Oguchi disease in Japanese.", "journal": "Nature genetics", "date": "1995", "authors": "Fuchs S, Nakazawa M, Maw M, Tamai M, Oguchi Y, Gal A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "7670478", "url": "https://glygen.org/publication/PubMed/7670478" } ] }, { "title": "Modulation of the cGMP-gated channel of rod photoreceptor cells by calmodulin.", "journal": "Nature", "date": "1993", "authors": "Hsu YT, Molday RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "7678445", "url": "https://glygen.org/publication/PubMed/7678445" } ] }, { "title": "A new subunit of the cyclic nucleotide-gated cation channel in retinal rods.", "journal": "Nature", "date": "1993", "authors": "Chen TY, Peng YW, Dhallan RS, Ahamed B, Reed RR, Yau KW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "7682292", "url": "https://glygen.org/publication/PubMed/7682292" } ] }, { "title": "Cloning and expression of a second photoreceptor-specific membrane retina guanylyl cyclase (RetGC), RetGC-2.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Lowe DG, Dizhoor AM, Liu K, Gu Q, Spencer M, Laura R, Lu L, Hurley JB", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "7777544", "url": "https://glygen.org/publication/PubMed/7777544" } ] }, { "title": "Molecular characterization of human and mouse photoreceptor guanylate cyclase-activating protein (GCAP) and chromosomal localization of the human gene.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Subbaraya I, Ruiz CC, Helekar BS, Zhao X, Gorczyca WA, Pettenati MJ, Rao PN, Palczewski K, Baehr W", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "7983048", "url": "https://glygen.org/publication/PubMed/7983048" } ] }, { "title": "Characterization of recombinant human farnesyl-protein transferase: cloning, expression, farnesyl diphosphate binding, and functional homology with yeast prenyl-protein transferases.", "journal": "Biochemistry", "date": "1993", "authors": "Omer CA, Kral AM, Diehl RE, Prendergast GC, Powers S, Allen CM, Gibbs JB, Kohl NE", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "8494894", "url": "https://glygen.org/publication/PubMed/8494894" } ] }, { "title": "Characterization of the G protein-coupled receptor kinase GRK4. Identification of four splice variants.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Premont RT, Macrae AD, Stoffel RH, Chung N, Pitcher JA, Ambrose C, Inglese J, MacDonald ME, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "8626439", "url": "https://glygen.org/publication/PubMed/8626439" } ] }, { "title": "Calcium-activated opsin phosphatase activity in retinal rod outer segments.", "journal": "European journal of biochemistry", "date": "1996", "authors": "Kutuzov MA, Bennett N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "8706659", "url": "https://glygen.org/publication/PubMed/8706659" } ] }, { "title": "Characterization and chromosomal localization of the gene for human rhodopsin kinase.", "journal": "Genomics", "date": "1996", "authors": "Khani SC, Abitbol M, Yamamoto S, Maravic-Magovcevic I, Dryja TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "8812493", "url": "https://glygen.org/publication/PubMed/8812493" } ] }, { "title": "The human GCAP1 and GCAP2 genes are arranged in a tail-to-tail array on the short arm of chromosome 6 (p21.1).", "journal": "Genomics", "date": "1997", "authors": "Surguchov A, Bronson JD, Banerjee P, Knowles JA, Ruiz C, Subbaraya I, Palczewski K, Baehr W", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "9119368", "url": "https://glygen.org/publication/PubMed/9119368" } ] }, { "title": "Human N-myristoyltransferase amino-terminal domain involved in targeting the enzyme to the ribosomal subcellular fraction.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Glover CJ, Hartman KD, Felsted RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "9353336", "url": "https://glygen.org/publication/PubMed/9353336" } ] }, { "title": "Molecular cloning, expression, and characterization of a novel human serine/threonine protein phosphatase, PP7, that is homologous to Drosophila retinal degeneration C gene product (rdgC).", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Huang X, Honkanen RE", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "9430683", "url": "https://glygen.org/publication/PubMed/9430683" } ] }, { "title": "RGS9, a GTPase accelerator for phototransduction.", "journal": "Neuron", "date": "1998", "authors": "He W, Cowan CW, Wensel TG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "9459445", "url": "https://glygen.org/publication/PubMed/9459445" } ] }, { "title": "A second mammalian N-myristoyltransferase.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Giang DK, Cravatt BF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859" } ], "reference": [ { "type": "PubMed", "id": "9506952", "url": "https://glygen.org/publication/PubMed/9506952" } ] } ], "pathway": [ { "id": "hsa:9626", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9626", "resource": "KEGG Pathway" }, { "id": "R-HSA-2514859", "name": "Inactivation, recovery and regulation of the phototransduction cascade", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859", "resource": "Reactome", "description": "Inactivation, recovery and regulation of the phototransduction cascade" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "calcium ion binding", "id": "GO:0005509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509", "evidence": [ { "database": "UniProtKB", "id": "O95843", "url": "https://www.uniprot.org/uniprot/O95843" } ], "pmid": "" }, { "name": "calcium sensitive guanylate cyclase activator activity", "id": "GO:0008048", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008048", "evidence": [ { "database": "UniProtKB", "id": "O95843", "url": "https://www.uniprot.org/uniprot/O95843" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "O95843", "url": "https://www.uniprot.org/uniprot/O95843" } ], "pmid": "" }, { "name": "visual perception", "id": "GO:0007601", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007601", "evidence": [ { "database": "UniProtKB", "id": "O95843", "url": "https://www.uniprot.org/uniprot/O95843" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "photoreceptor disc membrane", "id": "GO:0097381", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097381", "evidence": [ { "database": "UniProtKB", "id": "O95843", "url": "https://www.uniprot.org/uniprot/O95843" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 105, "end_pos": 107, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [ 72 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 105, "end_pos": 107 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 57 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }