{ "uniprot_canonical_ac": "O95837-1", "uniprot_ac": "O95837", "uniprot_id": "GNA14_HUMAN", "mass": { "chemical_mass": 41571.0, "monoisotopic_mass": 41571.0 }, "refseq": { "ac": "NP_004288", "name": "guanine nucleotide-binding protein subunit alpha-14", "summary": "This gene encodes a member of the guanine nucleotide-binding, or G protein family. G proteins are heterotrimers consisting of alpha, beta and gamma subunits. The encoded protein is a member of the alpha family of G proteins, more specifically the alpha q subfamily of G proteins. The encoded protein may play a role in pertussis-toxin resistant activation of phospholipase C-beta and its downstream effectors.[provided by RefSeq, Feb 2009].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004288" }, "gene_names": [ { "name": "GNA14", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O95837", "id": "O95837" }, { "name": "GNA14", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004288", "id": "NP_004288" }, { "name": "HG1I", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004288", "id": "NP_004288" } ], "protein_names": [ { "name": "Guanine nucleotide-binding protein subunit alpha-14", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O95837" }, { "name": "G alpha-14", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95837" }, { "name": "G-protein subunit alpha-14", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95837" }, { "name": "guanine nucleotide-binding protein 14; guanine nucleotide binding protein (G protein), alpha 14; g alpha-14; heterotrimeric guanine nucleotide-binding protein 1I", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004288", "id": "NP_004288" }, { "name": "guanine nucleotide-binding protein subunit alpha-14", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004288", "id": "NP_004288" } ], "function": [ { "annotation": "GNA14 stimulation of KLF7 promotes malignant growth of endometrial cancer through upregulation of HAS2. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_004288", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004288" }, { "database": "PubMed", "id": "33892667", "url": "https://glygen.org/publication/PubMed/33892667" } ] }, { "annotation": "GNA14's interaction with RACK1 inhibits hepatocellular carcinoma progression through reducing MAPK/JNK and PI3K/AKT signaling pathway.", "evidence": [ { "database": "RefSeq", "id": "NP_004288", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004288" }, { "database": "PubMed", "id": "34657150", "url": "https://glygen.org/publication/PubMed/34657150" } ] }, { "annotation": "Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.", "evidence": [ { "database": "UniProtKB", "id": "O95837", "url": "https://www.uniprot.org/uniprot/O95837#function" } ] }, { "annotation": "Hypermethylation of GNA14 and its tumor-suppressive role in hepatitis B virus-related hepatocellular carcinoma. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_004288", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004288" }, { "database": "PubMed", "id": "33500727", "url": "https://glygen.org/publication/PubMed/33500727" } ] }, { "annotation": "Our study demonstrated recurrent GNA14/GNAQ/GNA11 mutations were present in the majority of cherry hemangiomas and established its neoplastic nature", "evidence": [ { "database": "RefSeq", "id": "NP_004288", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004288" }, { "database": "PubMed", "id": "31189994", "url": "https://glygen.org/publication/PubMed/31189994" } ] }, { "annotation": "This gene encodes a member of the guanine nucleotide-binding, or G protein family. G proteins are heterotrimers consisting of alpha, beta and gamma subunits. The encoded protein is a member of the alpha family of G proteins, more specifically the alpha q subfamily of G proteins. The encoded protein may play a role in pertussis-toxin resistant activation of phospholipase C-beta and its downstream effectors.[provided by RefSeq, Feb 2009].", "evidence": [ { "database": "RefSeq", "id": "NP_004288", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004288" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "O95837", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95837" } ], "glycoeffect": [], "start_pos": 206, "end_pos": 206, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "Q", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "9", "chr_pos": "77429013", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "R206", "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] }, { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "73.76", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000156049", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156049" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "57.35", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000156049", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156049" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "69.26", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000156049", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156049" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "71.28", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000156049", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156049" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "72.84", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000156049", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156049" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "80.93", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000156049", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156049" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "70.54", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000156049", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156049" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "79.37", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000156049", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156049" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "84.24", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000156049", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156049" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "76.9", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000156049", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156049" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "72.41", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000156049", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156049" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "76.31", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000156049", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156049" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "72.27", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000156049", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156049" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O95837", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95837" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O95837", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95837" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O95837", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95837" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O95837", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95837" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O95837", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95837" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O95837", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95837" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O95837", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95837" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O95837", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95837" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O95837", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95837" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O95837", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95837" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O95837", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95837" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O95837", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95837" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95837", "url": "https://www.uniprot.org/uniprot/O95837" } ], "common_name": "Human" } ], "gene": [ { "name": "GNA14", "url": "https://www.uniprot.org/uniprot/O95837", "locus": { "chromosome": "9", "start_pos": 77423079, "end_pos": 77648322, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000156049", "url": "https://www.ensembl.org/id/ENSG00000156049" } ] } } ], "crossref": [ { "id": "ENSG00000156049", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156049", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O95837", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95837", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd00066", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00066", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "GNA14", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=GNA14", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "9630", "url": "https://www.ncbi.nlm.nih.gov/gene/9630", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "4382", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=4382", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O95837", "url": "https://www.ebi.ac.uk/intact/interactors/id:O95837*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000654", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000654", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001019", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001019", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011025", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011025", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:9630", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9630", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "604397", "url": "http://www.omim.org/entry/604397", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O95837", "url": "https://www.nextprot.org/entry/NX_O95837", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "CCVSAED", "url": "https://omabrowser.org/oma/group/CCVSAED/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2897309at2759", "url": "http://www.orthodb.org/?query=2897309at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10218", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10218", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10218:SF213", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10218:SF213", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00503", "url": "http://pfam.xfam.org/family/PF00503", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O95837", "url": "https://pharos.nih.gov/targets/O95837", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O95837", "url": "http://purl.obolibrary.org/obo/PR_O95837", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-112043", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-112043", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-202040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202040", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-399997", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399997", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-418592", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418592", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-428930", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-428930", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-434316", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-434316", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-456926", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-456926", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6814122", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6814122", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_004288", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004288", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "O95837", "url": "https://www.uniprot.org/uniprot/O95837", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95837-1", "url": "https://www.uniprot.org/uniprot/O95837-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAGCCCLSAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIQYVCEQNKENAQIIREVEVDKVSMLSREQVEAIKQLWQDPGIQECYDRRREYQLSDSAKYYLTDIDRIATPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKALFKTIITYPWFLNSSVILFLNKKDLLEEKIMYSHLISYFPEYTGPKQDVRAARDFILKLYQDQNPDKEKVIYSHFTCATDTDNIRFVFAAVKDTILQLNLREFNLV", "length": 355, "header": "sp|O95837-1|GNA14_HUMAN Isoform 1 of Guanine nucleotide-binding protein subunit alpha-14 OS=Homo sapiens OX=9606 GN=GNA14 PE=1 SV=1 CANONICAL=O95837-1" }, "isoforms": [ { "isoform_ac": "O95837-1", "url": "", "sequence": { "sequence": "MAGCCCLSAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIQYVCEQNKENAQIIREVEVDKVSMLSREQVEAIKQLWQDPGIQECYDRRREYQLSDSAKYYLTDIDRIATPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKALFKTIITYPWFLNSSVILFLNKKDLLEEKIMYSHLISYFPEYTGPKQDVRAARDFILKLYQDQNPDKEKVIYSHFTCATDTDNIRFVFAAVKDTILQLNLREFNLV", "length": 355, "header": "sp|O95837-1|GNA14_HUMAN Isoform 1 of Guanine nucleotide-binding protein subunit alpha-14 OS=Homo sapiens OX=9606 GN=GNA14 PE=1 SV=1 CANONICAL=O95837-1" }, "locus": { "chromosome": "9", "start_pos": 77647793, "end_pos": 77423982, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000341700.7", "url": "https://www.ensembl.org/id/ENST00000341700.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000365807.4", "url": "https://www.ensembl.org/id/ENSP00000365807.4" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Genomic organization of the human G-alpha-14 and G-alpha-Q genes and mutation analysis in chorea-acanthocytosis (CHAC).", "journal": "Genomics", "date": "1999", "authors": "Rubio JP, Levy ER, Dobson-Stone C, Monaco AP", "evidence": [ { "database": "UniProtKB", "id": "O95837", "url": "https://www.uniprot.org/uniprot/O95837" }, { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "10191087", "url": "https://glygen.org/publication/PubMed/10191087" } ] }, { "title": "Nonselective coupling of the human mu-opioid receptor to multiple inhibitory G-protein isoforms.", "journal": "European journal of biochemistry", "date": "1999", "authors": "Gaibelet G, Meilhoc E, Riond J, Saves I, Exner T, Liaubet L, Nurnberg B, Masson JM, Emorine LJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202040" } ], "reference": [ { "type": "PubMed", "id": "10215864", "url": "https://glygen.org/publication/PubMed/10215864" } ] }, { "title": "Selective regulation of Galpha(q/11) by an RGS domain in the G protein-coupled receptor kinase, GRK2.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Carman CV, Parent JL, Day PW, Pronin AN, Sternweis PM, Wedegaertner PB, Gilman AG, Benovic JL, Kozasa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "10567430", "url": "https://glygen.org/publication/PubMed/10567430" } ] }, { "title": "Selective regulation of Gq signaling by G protein-coupled receptor kinase 2: direct interaction of kinase N terminus with activated galphaq.", "journal": "Molecular pharmacology", "date": "2000", "authors": "Sallese M, Mariggio S, D'Urbano E, Iacovelli L, De Blasi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "10727532", "url": "https://glygen.org/publication/PubMed/10727532" } ] }, { "title": "The P2Y1 receptor mediates ADP-induced p38 kinase-activating factor generation in human platelets.", "journal": "European journal of biochemistry", "date": "2000", "authors": "Dangelmaier C, Jin J, Daniel JL, Smith JB, Kunapuli SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-418592", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418592" } ], "reference": [ { "type": "PubMed", "id": "10759852", "url": "https://glygen.org/publication/PubMed/10759852" } ] }, { "title": "G protein-coupled receptor kinase-5 regulates thrombin-activated signaling in endothelial cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Tiruppathi C, Yan W, Sandoval R, Naqvi T, Pronin AN, Benovic JL, Malik AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "10861009", "url": "https://glygen.org/publication/PubMed/10861009" } ] }, { "title": "Structure, function, and control of phosphoinositide-specific phospholipase C.", "journal": "Physiological reviews", "date": "2000", "authors": "Rebecchi MJ, Pentyala SN", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "11015615", "url": "https://glygen.org/publication/PubMed/11015615" } ] }, { "title": "Cloning and characterization of the human phosphoinositide-specific phospholipase C-beta 1 (PLC beta 1).", "journal": "Biochimica et biophysica acta", "date": "2000", "authors": "Caricasole A, Sala C, Roncarati R, Formenti E, Terstappen GC", "evidence": [ { "database": "Reactome", "id": "R-HSA-112043", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-112043" } ], "reference": [ { "type": "PubMed", "id": "11118617", "url": "https://glygen.org/publication/PubMed/11118617" } ] }, { "title": "Mechanisms and physiological significance of the cholinergic control of pancreatic beta-cell function.", "journal": "Endocrine reviews", "date": "2001", "authors": "Gilon P, Henquin JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-399997", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399997" } ], "reference": [ { "type": "PubMed", "id": "11588141", "url": "https://glygen.org/publication/PubMed/11588141" } ] }, { "title": "Competing modes of self-association in the regulatory domains of Bruton's tyrosine kinase: intramolecular contact versus asymmetric homodimerization.", "journal": "Protein science : a publication of the Protein Society", "date": "2002", "authors": "Laederach A, Cradic KW, Brazin KN, Zamoon J, Fulton DB, Huang XY, Andreotti AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "11742120", "url": "https://glygen.org/publication/PubMed/11742120" } ] }, { "title": "A unique fold of phospholipase C-beta mediates dimerization and interaction with G alpha q.", "journal": "Nature structural biology", "date": "2002", "authors": "Singer AU, Waldo GL, Harden TK, Sondek J", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "11753430", "url": "https://glygen.org/publication/PubMed/11753430" } ] }, { "title": "Mu and Delta opioid receptors activate the same G proteins in human neuroblastoma SH-SY5Y cells.", "journal": "British journal of pharmacology", "date": "2002", "authors": "Alt A, Clark MJ, Woods JH, Traynor JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-202040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202040" } ], "reference": [ { "type": "PubMed", "id": "11786497", "url": "https://glygen.org/publication/PubMed/11786497" } ] }, { "title": "Regulators of G-protein signalling as new central nervous system drug targets.", "journal": "Nature reviews. Drug discovery", "date": "2002", "authors": "Neubig RR, Siderovski DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "12120503", "url": "https://glygen.org/publication/PubMed/12120503" } ] }, { "title": "Antisense co-suppression of G(alpha)(q) and G(alpha)(11) demonstrates that both isoforms mediate M(3)-receptor-activated Ca(2+) signalling in intact epithelial cells.", "journal": "Pflugers Archiv : European journal of physiology", "date": "2002", "authors": "Cummins MM, O'Mullane LM, Barden JA, Cook DI, Poronnik P", "evidence": [ { "database": "Reactome", "id": "R-HSA-399997", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399997" } ], "reference": [ { "type": "PubMed", "id": "12194018", "url": "https://glygen.org/publication/PubMed/12194018" } ] }, { "title": "The orphan G protein-coupled receptor GPR40 is activated by medium and long chain fatty acids.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Briscoe CP, Tadayyon M, Andrews JL, Benson WG, Chambers JK, Eilert MM, Ellis C, Elshourbagy NA, Goetz AS, Minnick DT, Murdock PR, Sauls HR Jr, Shabon U, Spinage LD, Strum JC, Szekeres PG, Tan KB, Way JM, Ignar DM, Wilson S, Muir AI", "evidence": [ { "database": "Reactome", "id": "R-HSA-434316", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-434316" } ], "reference": [ { "type": "PubMed", "id": "12496284", "url": "https://glygen.org/publication/PubMed/12496284" } ] }, { "title": "A human cell surface receptor activated by free fatty acids and thiazolidinedione drugs.", "journal": "Biochemical and biophysical research communications", "date": "2003", "authors": "Kotarsky K, Nilsson NE, Flodgren E, Owman C, Olde B", "evidence": [ { "database": "Reactome", "id": "R-HSA-434316", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-434316" } ], "reference": [ { "type": "PubMed", "id": "12565875", "url": "https://glygen.org/publication/PubMed/12565875" } ] }, { "title": "Free fatty acids regulate insulin secretion from pancreatic beta cells through GPR40.", "journal": "Nature", "date": "2003", "authors": "Itoh Y, Kawamata Y, Harada M, Kobayashi M, Fujii R, Fukusumi S, Ogi K, Hosoya M, Tanaka Y, Uejima H, Tanaka H, Maruyama M, Satoh R, Okubo S, Kizawa H, Komatsu H, Matsumura F, Noguchi Y, Shinohara T, Hinuma S, Fujisawa Y, Fujino M", "evidence": [ { "database": "Reactome", "id": "R-HSA-434316", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-434316" } ], "reference": [ { "type": "PubMed", "id": "12629551", "url": "https://glygen.org/publication/PubMed/12629551" } ] }, { "title": "Phospholipase C-beta 1 is a GTPase-activating protein for Gq/11, its physiologic regulator.", "journal": "Cell", "date": "1992", "authors": "Berstein G, Blank JL, Jhon DY, Exton JH, Rhee SG, Ross EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-112043", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-112043" } ], "reference": [ { "type": "PubMed", "id": "1322796", "url": "https://glygen.org/publication/PubMed/1322796" } ] }, { "title": "Agonist binding and Gq-stimulating activities of the purified human P2Y1 receptor.", "journal": "Molecular pharmacology", "date": "2004", "authors": "Waldo GL, Harden TK", "evidence": [ { "database": "Reactome", "id": "R-HSA-418592", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418592" } ], "reference": [ { "type": "PubMed", "id": "14742685", "url": "https://glygen.org/publication/PubMed/14742685" } ] }, { "title": "Glucose-induced phosphorylation of myristoylated alanine-rich C kinase substrate (MARCKS) in isolated rat pancreatic islets.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Calle R, Ganesan S, Smallwood JI, Rasmussen H", "evidence": [ { "database": "Reactome", "id": "R-HSA-399997", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399997" } ], "reference": [ { "type": "PubMed", "id": "1527003", "url": "https://glygen.org/publication/PubMed/1527003" } ] }, { "title": "Receptor-mediated reversible translocation of the G protein betagamma complex from the plasma membrane to the Golgi complex.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Akgoz M, Kalyanaraman V, Gautam N", "evidence": [ { "database": "Reactome", "id": "R-HSA-434316", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-434316" } ], "reference": [ { "type": "PubMed", "id": "15448129", "url": "https://glygen.org/publication/PubMed/15448129" } ] }, { "title": "Phosducin-like protein acts as a molecular chaperone for G protein betagamma dimer assembly.", "journal": "The EMBO journal", "date": "2005", "authors": "Lukov GL, Hu T, McLaughlin JN, Hamm HE, Willardson BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6814122", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6814122" } ], "reference": [ { "type": "PubMed", "id": "15889144", "url": "https://glygen.org/publication/PubMed/15889144" } ] }, { "title": "Oleic acid interacts with GPR40 to induce Ca2+ signaling in rat islet beta-cells: mediation by PLC and L-type Ca2+ channel and link to insulin release.", "journal": "American journal of physiology. Endocrinology and metabolism", "date": "2005", "authors": "Fujiwara K, Maekawa F, Yada T", "evidence": [ { "database": "Reactome", "id": "R-HSA-434316", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-434316" } ], "reference": [ { "type": "PubMed", "id": "15914509", "url": "https://glygen.org/publication/PubMed/15914509" } ] }, { "title": "The GAPs, GEFs, and GDIs of heterotrimeric G-protein alpha subunits.", "journal": "International journal of biological sciences", "date": "2005", "authors": "Siderovski DP, Willard FS", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "15951850", "url": "https://glygen.org/publication/PubMed/15951850" } ] }, { "title": "Role of GPR40 in fatty acid action on the beta cell line INS-1E.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Shapiro H, Shachar S, Sekler I, Hershfinkel M, Walker MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-434316", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-434316" } ], "reference": [ { "type": "PubMed", "id": "16081037", "url": "https://glygen.org/publication/PubMed/16081037" } ] }, { "title": "Protease-activated receptors in hemostasis, thrombosis and vascular biology.", "journal": "Journal of thrombosis and haemostasis : JTH", "date": "2005", "authors": "Coughlin SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-456926", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-456926" } ], "reference": [ { "type": "PubMed", "id": "16102047", "url": "https://glygen.org/publication/PubMed/16102047" } ] }, { "title": "Cell signalling diversity of the Gqalpha family of heterotrimeric G proteins.", "journal": "Cellular signalling", "date": "2006", "authors": "Hubbard KB, Hepler JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "16182515", "url": "https://glygen.org/publication/PubMed/16182515" } ] }, { "title": "Coupling interaction between thromboxane A2 receptor and alpha-13 subunit of guanine nucleotide-binding protein.", "journal": "Journal of proteome research", "date": "2005", "authors": "Chou KC", "evidence": [ { "database": "Reactome", "id": "R-HSA-428930", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-428930" } ], "reference": [ { "type": "PubMed", "id": "16212421", "url": "https://glygen.org/publication/PubMed/16212421" } ] }, { "title": "G protein betagamma11 complex translocation is induced by Gi, Gq and Gs coupling receptors and is regulated by the alpha subunit type.", "journal": "Cellular signalling", "date": "2006", "authors": "Azpiazu I, Akgoz M, Kalyanaraman V, Gautam N", "evidence": [ { "database": "Reactome", "id": "R-HSA-434316", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-434316" } ], "reference": [ { "type": "PubMed", "id": "16242307", "url": "https://glygen.org/publication/PubMed/16242307" } ] }, { "title": "Galphaq binds to p110alpha/p85alpha phosphoinositide 3-kinase and displaces Ras.", "journal": "The Biochemical journal", "date": "2006", "authors": "Ballou LM, Chattopadhyay M, Li Y, Scarlata S, Lin RZ", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "16268778", "url": "https://glygen.org/publication/PubMed/16268778" } ] }, { "title": "GPR40 gene expression in human pancreas and insulinoma.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Tomita T, Masuzaki H, Noguchi M, Iwakura H, Fujikura J, Tanaka T, Ebihara K, Kawamura J, Komoto I, Kawaguchi Y, Fujimoto K, Doi R, Shimada Y, Hosoda K, Imamura M, Nakao K", "evidence": [ { "database": "Reactome", "id": "R-HSA-434316", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-434316" } ], "reference": [ { "type": "PubMed", "id": "16289108", "url": "https://glygen.org/publication/PubMed/16289108" } ] }, { "title": "Snapshot of activated G proteins at the membrane: the Galphaq-GRK2-Gbetagamma complex.", "journal": "Science (New York, N.Y.)", "date": "2005", "authors": "Tesmer VM, Kawano T, Shankaranarayanan A, Kozasa T, Tesmer JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "16339447", "url": "https://glygen.org/publication/PubMed/16339447" } ] }, { "title": "Differential activation of G-proteins by mu-opioid receptor agonists.", "journal": "British journal of pharmacology", "date": "2006", "authors": "Saidak Z, Blake-Palmer K, Hay DL, Northup JK, Glass M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202040" } ], "reference": [ { "type": "PubMed", "id": "16415903", "url": "https://glygen.org/publication/PubMed/16415903" } ] }, { "title": "The G12 family of G proteins as a reporter of thromboxane A2 receptor activity.", "journal": "Molecular pharmacology", "date": "2006", "authors": "Zhang L, DiLizio C, Kim D, Smyth EM, Manning DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-428930", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-428930" } ], "reference": [ { "type": "PubMed", "id": "16418336", "url": "https://glygen.org/publication/PubMed/16418336" } ] }, { "title": "Opposing effects of beta-arrestin1 and beta-arrestin2 on activation and degradation of Src induced by protease-activated receptor 1.", "journal": "Cellular signalling", "date": "2006", "authors": "Kuo FT, Lu TL, Fu HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-456926", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-456926" } ], "reference": [ { "type": "PubMed", "id": "16580177", "url": "https://glygen.org/publication/PubMed/16580177" } ] }, { "title": "Role of the chaperonin CCT/TRiC complex in G protein betagamma-dimer assembly.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Wells CA, Dingus J, Hildebrandt JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6814122", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6814122" } ], "reference": [ { "type": "PubMed", "id": "16702223", "url": "https://glygen.org/publication/PubMed/16702223" } ] }, { "title": "Mechanism of assembly of G protein betagamma subunits by protein kinase CK2-phosphorylated phosducin-like protein and the cytosolic chaperonin complex.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Lukov GL, Baker CM, Ludtke PJ, Hu T, Carter MD, Hackett RA, Thulin CD, Willardson BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6814122", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6814122" } ], "reference": [ { "type": "PubMed", "id": "16717095", "url": "https://glygen.org/publication/PubMed/16717095" } ] }, { "title": "Molecular cloning of a functional thrombin receptor reveals a novel proteolytic mechanism of receptor activation.", "journal": "Cell", "date": "1991", "authors": "Vu TK, Hung DT, Wheaton VI, Coughlin SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-456926", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-456926" } ], "reference": [ { "type": "PubMed", "id": "1672265", "url": "https://glygen.org/publication/PubMed/1672265" } ] }, { "title": "A critical role for beta cell M3 muscarinic acetylcholine receptors in regulating insulin release and blood glucose homeostasis in vivo.", "journal": "Cell metabolism", "date": "2006", "authors": "Gautam D, Han SJ, Hamdan FF, Jeon J, Li B, Li JH, Cui Y, Mears D, Lu H, Deng C, Heard T, Wess J", "evidence": [ { "database": "Reactome", "id": "R-HSA-399997", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399997" } ], "reference": [ { "type": "PubMed", "id": "16753580", "url": "https://glygen.org/publication/PubMed/16753580" } ] }, { "title": "Stable association between G alpha(q) and phospholipase C beta 1 in living cells.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Dowal L, Provitera P, Scarlata S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "16754659", "url": "https://glygen.org/publication/PubMed/16754659" } ] }, { "title": "Differential effects of volatile anesthetics on M3 muscarinic receptor coupling to the Galphaq heterotrimeric G protein.", "journal": "Anesthesiology", "date": "2006", "authors": "Nakayama T, Penheiter AR, Penheiter SG, Chini EN, Thompson M, Warner DO, Jones KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-399997", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399997" } ], "reference": [ { "type": "PubMed", "id": "16871065", "url": "https://glygen.org/publication/PubMed/16871065" } ] }, { "title": "Mechanism of the receptor-catalyzed activation of heterotrimeric G proteins.", "journal": "Nature structural & molecular biology", "date": "2006", "authors": "Oldham WM, Van Eps N, Preininger AM, Hubbell WL, Hamm HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-202040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202040" } ], "reference": [ { "type": "PubMed", "id": "16892066", "url": "https://glygen.org/publication/PubMed/16892066" } ] }, { "title": "Structural basis of function in heterotrimeric G proteins.", "journal": "Quarterly reviews of biophysics", "date": "2006", "authors": "Oldham WM, Hamm HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "16923326", "url": "https://glygen.org/publication/PubMed/16923326" } ] }, { "title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.", "journal": "Cell", "date": "2006", "authors": "Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M", "evidence": [ { "database": "Reactome", "id": "R-HSA-399997", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399997" } ], "reference": [ { "type": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ] }, { "title": "Some G protein heterotrimers physically dissociate in living cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Digby GJ, Lober RM, Sethi PR, Lambert NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-434316", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-434316" } ], "reference": [ { "type": "PubMed", "id": "17095603", "url": "https://glygen.org/publication/PubMed/17095603" } ] }, { "title": "Free fatty acids increase cytosolic free calcium and stimulate insulin secretion from beta-cells through activation of GPR40.", "journal": "Molecular and cellular endocrinology", "date": "2007", "authors": "Schnell S, Schaefer M, Schofl C", "evidence": [ { "database": "Reactome", "id": "R-HSA-434316", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-434316" } ], "reference": [ { "type": "PubMed", "id": "17101212", "url": "https://glygen.org/publication/PubMed/17101212" } ] }, { "title": "Fatty acid signaling in the beta-cell and insulin secretion.", "journal": "Diabetes", "date": "2006", "authors": "Nolan CJ, Madiraju MS, Delghingaro-Augusto V, Peyot ML, Prentki M", "evidence": [ { "database": "Reactome", "id": "R-HSA-434316", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-434316" } ], "reference": [ { "type": "PubMed", "id": "17130640", "url": "https://glygen.org/publication/PubMed/17130640" } ] }, { "title": "GPR40 is necessary but not sufficient for fatty acid stimulation of insulin secretion in vivo.", "journal": "Diabetes", "date": "2007", "authors": "Latour MG, Alquier T, Oseid E, Tremblay C, Jetton TL, Luo J, Lin DC, Poitout V", "evidence": [ { "database": "Reactome", "id": "R-HSA-434316", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-434316" } ], "reference": [ { "type": "PubMed", "id": "17395749", "url": "https://glygen.org/publication/PubMed/17395749" } ] }, { "title": "G-protein-coupled receptors and islet function-implications for treatment of type 2 diabetes.", "journal": "Pharmacology & therapeutics", "date": "2007", "authors": "Winzell MS, Ahren B", "evidence": [ { "database": "Reactome", "id": "R-HSA-399997", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399997" } ], "reference": [ { "type": "PubMed", "id": "17900700", "url": "https://glygen.org/publication/PubMed/17900700" } ] }, { "title": "Role of the M3 muscarinic acetylcholine receptor in beta-cell function and glucose homeostasis.", "journal": "Diabetes, obesity & metabolism", "date": "2007", "authors": "Gautam D, Han SJ, Duttaroy A, Mears D, Hamdan FF, Li JH, Cui Y, Jeon J, Wess J", "evidence": [ { "database": "Reactome", "id": "R-HSA-399997", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399997" } ], "reference": [ { "type": "PubMed", "id": "17919190", "url": "https://glygen.org/publication/PubMed/17919190" } ] }, { "title": "Galpha Gbetagamma dissociation may be due to retraction of a buried lysine and disruption of an aromatic cluster by a GTP-sensing Arg Trp pair.", "journal": "Protein science : a publication of the Protein Society", "date": "2007", "authors": "Neuwald AF", "evidence": [ { "database": "Reactome", "id": "R-HSA-434316", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-434316" } ], "reference": [ { "type": "PubMed", "id": "17962409", "url": "https://glygen.org/publication/PubMed/17962409" } ] }, { "title": "Cloning and expression of cDNA for a human thromboxane A2 receptor.", "journal": "Nature", "date": "1991", "authors": "Hirata M, Hayashi Y, Ushikubi F, Yokota Y, Kageyama R, Nakanishi S, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-428930", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-428930" } ], "reference": [ { "type": "PubMed", "id": "1825698", "url": "https://glygen.org/publication/PubMed/1825698" } ] }, { "title": "Peptide fragment of the m3 muscarinic acetylcholine receptor activates G(q) but not G(i2).", "journal": "Journal of peptide science : an official publication of the European Peptide Society", "date": "2008", "authors": "Kubota M, Wakamatsu K", "evidence": [ { "database": "Reactome", "id": "R-HSA-399997", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399997" } ], "reference": [ { "type": "PubMed", "id": "18383439", "url": "https://glygen.org/publication/PubMed/18383439" } ] }, { "title": "Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Soundararajan M, Willard FS, Kimple AJ, Turnbull AP, Ball LJ, Schoch GA, Gileadi C, Fedorov OY, Dowler EF, Higman VA, Hutsell SQ, Sundstrom M, Doyle DA, Siderovski DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "18434541", "url": "https://glygen.org/publication/PubMed/18434541" } ] }, { "title": "Regulation of polyphosphoinositide-specific phospholipase C activity by purified Gq.", "journal": "Science (New York, N.Y.)", "date": "1991", "authors": "Smrcka AV, Hepler JR, Brown KO, Sternweis PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-434316", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-434316" } ], "reference": [ { "type": "PubMed", "id": "1846707", "url": "https://glygen.org/publication/PubMed/1846707" } ] }, { "title": "The G protein coupled to the thromboxane A2 receptor in human platelets is a member of the novel Gq family.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Shenker A, Goldsmith P, Unson CG, Spiegel AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-428930", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-428930" } ], "reference": [ { "type": "PubMed", "id": "1851174", "url": "https://glygen.org/publication/PubMed/1851174" } ] }, { "title": "Galphaq binds two effectors separately in cells: evidence for predetermined signaling pathways.", "journal": "Biophysical journal", "date": "2008", "authors": "Golebiewska U, Scarlata S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "18515384", "url": "https://glygen.org/publication/PubMed/18515384" } ] }, { "title": "Dissociation of heterotrimeric g proteins in cells.", "journal": "Science signaling", "date": "2008", "authors": "Lambert NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-456926", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-456926" } ], "reference": [ { "type": "PubMed", "id": "18577758", "url": "https://glygen.org/publication/PubMed/18577758" } ] }, { "title": "Glycerolipid metabolism and signaling in health and disease.", "journal": "Endocrine reviews", "date": "2008", "authors": "Prentki M, Madiraju SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-434316", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-434316" } ], "reference": [ { "type": "PubMed", "id": "18606873", "url": "https://glygen.org/publication/PubMed/18606873" } ] }, { "title": "Free fatty acid receptors and drug discovery.", "journal": "Biological & pharmaceutical bulletin", "date": "2008", "authors": "Hirasawa A, Hara T, Katsuma S, Adachi T, Tsujimoto G", "evidence": [ { "database": "Reactome", "id": "R-HSA-434316", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-434316" } ], "reference": [ { "type": "PubMed", "id": "18827341", "url": "https://glygen.org/publication/PubMed/18827341" } ] }, { "title": "Assembly of high order G alpha q-effector complexes with RGS proteins.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Shankaranarayanan A, Thal DM, Tesmer VM, Roman DL, Neubig RR, Kozasa T, Tesmer JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "18936096", "url": "https://glygen.org/publication/PubMed/18936096" } ] }, { "title": "G alpha 16, a G protein alpha subunit specifically expressed in hematopoietic cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1991", "authors": "Amatruda TT 3rd, Steele DA, Slepak VZ, Simon MI", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "1905813", "url": "https://glygen.org/publication/PubMed/1905813" } ] }, { "title": "Structural determinants involved in the formation and activation of G protein betagamma dimers.", "journal": "Neuro-Signals", "date": "2009", "authors": "McIntire WE", "evidence": [ { "database": "Reactome", "id": "R-HSA-434316", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-434316" } ], "reference": [ { "type": "PubMed", "id": "19212142", "url": "https://glygen.org/publication/PubMed/19212142" } ] }, { "title": "Role of molecular chaperones in G protein beta5/regulator of G protein signaling dimer assembly and G protein betagamma dimer specificity.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Howlett AC, Gray AJ, Hunter JM, Willardson BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6814122", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6814122" } ], "reference": [ { "type": "PubMed", "id": "19376773", "url": "https://glygen.org/publication/PubMed/19376773" } ] }, { "title": "The action and mode of binding of thiazolidinedione ligands at free fatty acid receptor 1.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Smith NJ, Stoddart LA, Devine NM, Jenkins L, Milligan G", "evidence": [ { "database": "Reactome", "id": "R-HSA-434316", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-434316" } ], "reference": [ { "type": "PubMed", "id": "19398560", "url": "https://glygen.org/publication/PubMed/19398560" } ] }, { "title": "Overexpression of GPR40 in pancreatic beta-cells augments glucose-stimulated insulin secretion and improves glucose tolerance in normal and diabetic mice.", "journal": "Diabetes", "date": "2009", "authors": "Nagasumi K, Esaki R, Iwachidow K, Yasuhara Y, Ogi K, Tanaka H, Nakata M, Yano T, Shimakawa K, Taketomi S, Takeuchi K, Odaka H, Kaisho Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-434316", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-434316" } ], "reference": [ { "type": "PubMed", "id": "19401434", "url": "https://glygen.org/publication/PubMed/19401434" } ] }, { "title": "SCH 530348: a novel oral thrombin receptor antagonist.", "journal": "Future cardiology", "date": "2009", "authors": "Bonaca MP, Morrow DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-456926", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-456926" } ], "reference": [ { "type": "PubMed", "id": "19715408", "url": "https://glygen.org/publication/PubMed/19715408" } ] }, { "title": "G-protein-coupled receptor 40 (GPR40) expression and its regulation in human pancreatic islets: the role of type 2 diabetes and fatty acids.", "journal": "Nutrition, metabolism, and cardiovascular diseases : NMCD", "date": "2010", "authors": "Del Guerra S, Bugliani M, D'Aleo V, Del Prato S, Boggi U, Mosca F, Filipponi F, Lupi R", "evidence": [ { "database": "Reactome", "id": "R-HSA-434316", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-434316" } ], "reference": [ { "type": "PubMed", "id": "19758793", "url": "https://glygen.org/publication/PubMed/19758793" } ] }, { "title": "Mechanism of action and clinical development of platelet thrombin receptor antagonists.", "journal": "Expert review of cardiovascular therapy", "date": "2010", "authors": "Ueno M, Ferreiro JL, Angiolillo DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-456926", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-456926" } ], "reference": [ { "type": "PubMed", "id": "20670195", "url": "https://glygen.org/publication/PubMed/20670195" } ] }, { "title": "Interaction of angio-associated migratory cell protein with the TPalpha and TPbeta isoforms of the human thromboxane A(2) receptor.", "journal": "Cellular signalling", "date": "2011", "authors": "Reid HM, Wikstrom K, Kavanagh DJ, Mulvaney EP, Kinsella BT", "evidence": [ { "database": "Reactome", "id": "R-HSA-428930", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-428930" } ], "reference": [ { "type": "PubMed", "id": "21172430", "url": "https://glygen.org/publication/PubMed/21172430" } ] }, { "title": "Phosducin-like protein 1 is essential for G-protein assembly and signaling in retinal rod photoreceptors.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2013", "authors": "Lai CW, Kolesnikov AV, Frederick JM, Blake DR, Jiang L, Stewart JS, Chen CK, Barrow JR, Baehr W, Kefalov VJ, Willardson BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6814122", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6814122" } ], "reference": [ { "type": "PubMed", "id": "23637185", "url": "https://glygen.org/publication/PubMed/23637185" } ] }, { "title": "A novel antidiabetic drug, fasiglifam/TAK-875, acts as an ago-allosteric modulator of FFAR1.", "journal": "PloS one", "date": "2013", "authors": "Yabuki C, Komatsu H, Tsujihata Y, Maeda R, Ito R, Matsuda-Nagasumi K, Sakuma K, Miyawaki K, Kikuchi N, Takeuchi K, Habata Y, Mori M", "evidence": [ { "database": "Reactome", "id": "R-HSA-434316", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-434316" } ], "reference": [ { "type": "PubMed", "id": "24130766", "url": "https://glygen.org/publication/PubMed/24130766" } ] }, { "title": "Retinal cone photoreceptors require phosducin-like protein 1 for G protein complex assembly and signaling.", "journal": "PloS one", "date": "2015", "authors": "Tracy CM, Kolesnikov AV, Blake DR, Chen CK, Baehr W, Kefalov VJ, Willardson BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6814122", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6814122" } ], "reference": [ { "type": "PubMed", "id": "25659125", "url": "https://glygen.org/publication/PubMed/25659125" } ] }, { "title": "Structures of the Gbeta-CCT and PhLP1-Gbeta-CCT complexes reveal a mechanism for G-protein beta-subunit folding and Gbetagamma dimer assembly.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2015", "authors": "Plimpton RL, Cuellar J, Lai CW, Aoba T, Makaju A, Franklin S, Mathis AD, Prince JT, Carrascosa JL, Valpuesta JM, Willardson BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6814122", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6814122" } ], "reference": [ { "type": "PubMed", "id": "25675501", "url": "https://glygen.org/publication/PubMed/25675501" } ] }, { "title": "Purification and characterization of membrane-bound phospholipase C specific for phosphoinositides from human platelets.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Banno Y, Yada Y, Nozawa Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "2841328", "url": "https://glygen.org/publication/PubMed/2841328" } ] }, { "title": "The influence of bound GDP on the kinetics of guanine nucleotide binding to G proteins.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Ferguson KM, Higashijima T, Smigel MD, Gilman AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "3086311", "url": "https://glygen.org/publication/PubMed/3086311" } ] }, { "title": "High frequency of GNA14, GNAQ, and GNA11 mutations in cherry hemangioma: a histopathological and molecular study of 85 cases indicating GNA14 as the most commonly mutated gene in vascular neoplasms.", "journal": "Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc", "date": "2019", "authors": "Liau JY, Lee JC, Tsai JH, Chen CC, Chung YC, Wang YH", "evidence": [ { "database": "RefSeq", "id": "NP_004288", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004288" } ], "reference": [ { "type": "PubMed", "id": "31189994", "url": "https://glygen.org/publication/PubMed/31189994" } ] }, { "title": "Proteinase-activated receptor 1: A target for repurposing in the treatment of COVID-19?", "journal": "British journal of pharmacology", "date": "2020", "authors": "Sriram K, Insel PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-456926", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-456926" } ], "reference": [ { "type": "PubMed", "id": "32639031", "url": "https://glygen.org/publication/PubMed/32639031" } ] }, { "title": "Hypermethylation of GNA14 and its tumor-suppressive role in hepatitis B virus-related hepatocellular carcinoma.", "journal": "Theranostics", "date": "2021", "authors": "Song G, Zhu X, Xuan Z, Zhao L, Dong H, Chen J, Li Z, Song W, Jin C, Zhou M, Xie H, Zheng S, Song P", "evidence": [ { "database": "RefSeq", "id": "NP_004288", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004288" } ], "reference": [ { "type": "PubMed", "id": "33500727", "url": "https://glygen.org/publication/PubMed/33500727" } ] }, { "title": "GNA14 stimulation of KLF7 promotes malignant growth of endometrial cancer through upregulation of HAS2.", "journal": "BMC cancer", "date": "2021", "authors": "Wang J, Teng F, Chai H, Zhang C, Liang X, Yang Y", "evidence": [ { "database": "RefSeq", "id": "NP_004288", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004288" } ], "reference": [ { "type": "PubMed", "id": "33892667", "url": "https://glygen.org/publication/PubMed/33892667" } ] }, { "title": "GNA14's interaction with RACK1 inhibits hepatocellular carcinoma progression through reducing MAPK/JNK and PI3K/AKT signaling pathway.", "journal": "Carcinogenesis", "date": "2021", "authors": "Xu C, Li YM, Sun B, Zhong FJ, Yang LY", "evidence": [ { "database": "RefSeq", "id": "NP_004288", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004288" } ], "reference": [ { "type": "PubMed", "id": "34657150", "url": "https://glygen.org/publication/PubMed/34657150" } ] }, { "title": "Mechanism of GTP hydrolysis by G-protein alpha subunits.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Kleuss C, Raw AS, Lee E, Sprang SR, Gilman AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "7937899", "url": "https://glygen.org/publication/PubMed/7937899" } ] }, { "title": "Specificity of the high affinity interaction of protein kinase C with a physiological substrate, myristoylated alanine-rich protein kinase C substrate.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Fujise A, Mizuno K, Ueda Y, Osada S, Hirai S, Takayanagi A, Shimizu N, Owada MK, Nakajima H, Ohno S", "evidence": [ { "database": "Reactome", "id": "R-HSA-399997", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399997" } ], "reference": [ { "type": "PubMed", "id": "7989336", "url": "https://glygen.org/publication/PubMed/7989336" } ] }, { "title": "Structures of active conformations of Gi alpha 1 and the mechanism of GTP hydrolysis.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Coleman DE, Berghuis AM, Lee E, Linder ME, Gilman AG, Sprang SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-202040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202040" } ], "reference": [ { "type": "PubMed", "id": "8073283", "url": "https://glygen.org/publication/PubMed/8073283" } ] }, { "title": "Protein kinase C-mediated phosphorylation and calmodulin binding of recombinant myristoylated alanine-rich C kinase substrate (MARCKS) and MARCKS-related protein.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Verghese GM, Johnson JD, Vasulka C, Haupt DM, Stumpo DJ, Blackshear PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-399997", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399997" } ], "reference": [ { "type": "PubMed", "id": "8132675", "url": "https://glygen.org/publication/PubMed/8132675" } ] }, { "title": "Transfected muscarinic acetylcholine receptors selectively couple to Gi-type G proteins and Gq/11.", "journal": "Molecular pharmacology", "date": "1994", "authors": "Offermanns S, Wieland T, Homann D, Sandmann J, Bombien E, Spicher K, Schultz G, Jakobs KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-399997", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399997" } ], "reference": [ { "type": "PubMed", "id": "8190105", "url": "https://glygen.org/publication/PubMed/8190105" } ] }, { "title": "Structural determinants for activation of the alpha-subunit of a heterotrimeric G protein.", "journal": "Nature", "date": "1994", "authors": "Lambright DG, Noel JP, Hamm HE, Sigler PB", "evidence": [ { "database": "Reactome", "id": "R-HSA-202040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202040" } ], "reference": [ { "type": "PubMed", "id": "8208289", "url": "https://glygen.org/publication/PubMed/8208289" } ] }, { "title": "G proteins of the G12 family are activated via thromboxane A2 and thrombin receptors in human platelets.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Offermanns S, Laugwitz KL, Spicher K, Schultz G", "evidence": [ { "database": "Reactome", "id": "R-HSA-456926", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-456926" } ], "reference": [ { "type": "PubMed", "id": "8290554", "url": "https://glygen.org/publication/PubMed/8290554" } ] }, { "title": "The structure of the G protein heterotrimer Gi alpha 1 beta 1 gamma 2.", "journal": "Cell", "date": "1995", "authors": "Wall MA, Coleman DE, Lee E, Iniguez-Lluhi JA, Posner BA, Gilman AG, Sprang SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-202040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202040" } ], "reference": [ { "type": "PubMed", "id": "8521505", "url": "https://glygen.org/publication/PubMed/8521505" } ] }, { "title": "Human G(alpha q): cDNA and tissue distribution.", "journal": "Biochimica et biophysica acta", "date": "1996", "authors": "Chen B, Leverette RD, Schwinn DA, Kwatra MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "8664309", "url": "https://glygen.org/publication/PubMed/8664309" } ] }, { "title": "Second messenger cascade specificity and pharmacological selectivity of the human P2Y1-purinoceptor.", "journal": "British journal of pharmacology", "date": "1996", "authors": "Schachter JB, Li Q, Boyer JL, Nicholas RA, Harden TK", "evidence": [ { "database": "Reactome", "id": "R-HSA-418592", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418592" } ], "reference": [ { "type": "PubMed", "id": "8733591", "url": "https://glygen.org/publication/PubMed/8733591" } ] }, { "title": "p38 mitogen-activated protein kinase phosphorylates cytosolic phospholipase A2 (cPLA2) in thrombin-stimulated platelets. Evidence that proline-directed phosphorylation is not required for mobilization of arachidonic acid by cPLA2.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Kramer RM, Roberts EF, Um SL, Borsch-Haubold AG, Watson SP, Fisher MJ, Jakubowski JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-418592", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418592" } ], "reference": [ { "type": "PubMed", "id": "8910365", "url": "https://glygen.org/publication/PubMed/8910365" } ] }, { "title": "Direct evidence for two distinct G proteins coupling with thrombin receptors in human neuroblastoma SH-EP cells.", "journal": "European journal of pharmacology", "date": "1996", "authors": "Ogino Y, Tanaka K, Shimizu N", "evidence": [ { "database": "Reactome", "id": "R-HSA-456926", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-456926" } ], "reference": [ { "type": "PubMed", "id": "8982657", "url": "https://glygen.org/publication/PubMed/8982657" } ] }, { "title": "Protease-activated receptor 3 is a second thrombin receptor in humans.", "journal": "Nature", "date": "1997", "authors": "Ishihara H, Connolly AJ, Zeng D, Kahn ML, Zheng YW, Timmons C, Tram T, Coughlin SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-456926", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-456926" } ], "reference": [ { "type": "PubMed", "id": "9087410", "url": "https://glygen.org/publication/PubMed/9087410" } ] }, { "title": "The human thromboxane A2 receptor alpha isoform (TP alpha) functionally couples to the G proteins Gq and G11 in vivo and is activated by the isoprostane 8-epi prostaglandin F2 alpha.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "1997", "authors": "Kinsella BT, O'Mahony DJ, Fitzgerald GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-428930", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-428930" } ], "reference": [ { "type": "PubMed", "id": "9152406", "url": "https://glygen.org/publication/PubMed/9152406" } ] }, { "title": "Cytoplasmic chaperonin containing TCP-1: structural and functional characterization.", "journal": "Biochemistry", "date": "1997", "authors": "Melki R, Batelier G, Soulie S, Williams RC Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-6814122", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6814122" } ], "reference": [ { "type": "PubMed", "id": "9153422", "url": "https://glygen.org/publication/PubMed/9153422" } ] }, { "title": "Direct stimulation of Bruton's tyrosine kinase by G(q)-protein alpha-subunit.", "journal": "Nature", "date": "1997", "authors": "Bence K, Ma W, Kozasa T, Huang XY", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "9305846", "url": "https://glygen.org/publication/PubMed/9305846" } ] }, { "title": "Specific G protein activation and mu-opioid receptor internalization caused by morphine, DAMGO and endomorphin I.", "journal": "European journal of pharmacology", "date": "1998", "authors": "Burford NT, Tolbert LM, Sadee W", "evidence": [ { "database": "Reactome", "id": "R-HSA-202040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202040" } ], "reference": [ { "type": "PubMed", "id": "9544801", "url": "https://glygen.org/publication/PubMed/9544801" } ] }, { "title": "Cloning and characterization of human protease-activated receptor 4.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Xu WF, Andersen H, Whitmore TE, Presnell SR, Yee DP, Ching A, Gilbert T, Davie EW, Foster DC", "evidence": [ { "database": "Reactome", "id": "R-HSA-456926", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-456926" } ], "reference": [ { "type": "PubMed", "id": "9618465", "url": "https://glygen.org/publication/PubMed/9618465" } ] }, { "title": "Identification of the binding site for Gqalpha on its effector Bruton's tyrosine kinase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Ma YC, Huang XY", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "9770463", "url": "https://glygen.org/publication/PubMed/9770463" } ] }, { "title": "The antibody specific for myristoylated alanine-rich C kinase substrate phosphorylated by protein kinase C: activation of protein kinase C in smooth muscle cells in human coronary arteries.", "journal": "Archives of biochemistry and biophysics", "date": "1998", "authors": "Yamamoto H, Matsumura T, Kugiyama K, Oishi Y, Ogata N, Yasue H, Miyamoto E", "evidence": [ { "database": "Reactome", "id": "R-HSA-399997", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399997" } ], "reference": [ { "type": "PubMed", "id": "9808756", "url": "https://glygen.org/publication/PubMed/9808756" } ] }, { "title": "Beta-arrestin-dependent formation of beta2 adrenergic receptor-Src protein kinase complexes.", "journal": "Science (New York, N.Y.)", "date": "1999", "authors": "Luttrell LM, Ferguson SS, Daaka Y, Miller WE, Maudsley S, Della Rocca GJ, Lin F, Kawakatsu H, Owada K, Luttrell DK, Caron MG, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-456926", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-456926" } ], "reference": [ { "type": "PubMed", "id": "9924018", "url": "https://glygen.org/publication/PubMed/9924018" } ] } ], "pathway": [ { "id": "hsa:9630", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9630", "resource": "KEGG Pathway" }, { "id": "R-HSA-112043", "name": "PLC beta mediated events", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-112043", "resource": "Reactome", "description": "PLC beta mediated events" }, { "id": "R-HSA-202040", "name": "G-protein activation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202040", "resource": "Reactome", "description": "G-protein activation" }, { "id": "R-HSA-399997", "name": "Acetylcholine regulates insulin secretion", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399997", "resource": "Reactome", "description": "Acetylcholine regulates insulin secretion" }, { "id": "R-HSA-416476", "name": "G alpha (q) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476", "resource": "Reactome", "description": "G alpha (q) signalling events" }, { "id": "R-HSA-418592", "name": "ADP signalling through P2Y purinoceptor 1", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418592", "resource": "Reactome", "description": "ADP signalling through P2Y purinoceptor 1" }, { "id": "R-HSA-428930", "name": "Thromboxane signalling through TP receptor", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-428930", "resource": "Reactome", "description": "Thromboxane signalling through TP receptor" }, { "id": "R-HSA-434316", "name": "Fatty Acids bound to GPR40 (FFAR1) regulate insulin secretion", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-434316", "resource": "Reactome", "description": "Fatty Acids bound to GPR40 (FFAR1) regulate insulin secretion" }, { "id": "R-HSA-456926", "name": "Thrombin signalling through proteinase activated receptors (PARs)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-456926", "resource": "Reactome", "description": "Thrombin signalling through proteinase activated receptors (PARs)" }, { "id": "R-HSA-6814122", "name": "Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6814122", "resource": "Reactome", "description": "Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A8J8XRQ3-1", "protein_name": "G protein subunit alpha 14", "gene_name": "Gna14", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAGCCCLSAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIQYTCEQNKENAQIIREVEVDKVSAISRDQVAAIKQLWLDPGIQECYDRRREYQLSDSAKYYLTDIDRIAMPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKALFKTIITYPWFLNSSVILFLNKKDLLEEKIMYSHLISYFPEYTGPKQDVKAARDFILKLYQDQNPDKEKVIYSHFTCATDTENIRFVFAAVKDTILQLNLREFNLV", "length": 356 }, "evidence": [ { "id": "O95837", "url": "https://omabrowser.org/oma/group/O95837/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P30677-1", "protein_name": "Guanine nucleotide-binding protein subunit alpha-14", "gene_name": "Gna14", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAGCCCLSAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIQYMCEQNKENAQIIREVEVDKVTALSRDQVAAIKQLWLDPGIQECYDRRREYQLSDSAKYYLTDIERIAMPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKALFRTIITYPWFLNSSVILFLNKKDLLEEKIMYSHLISYFPEYTGPKQDVKAARDFILKLYQDQNPDKEKVIYSHFTCATDTENIRFVFAAVKDTILQLNLREFNLV", "length": 355 }, "evidence": [ { "id": "45927310", "url": "http://www.informatics.jax.org/homology/45927310", "database": "MGI" }, { "id": "O95837", "url": "https://omabrowser.org/oma/group/O95837/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "phospholipase C-activating dopamine receptor signaling pathway", "id": "GO:0060158", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060158", "evidence": [ { "database": "UniProtKB", "id": "O95837", "url": "https://www.uniprot.org/uniprot/O95837" } ], "pmid": "" }, { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "O95837", "url": "https://www.uniprot.org/uniprot/O95837" } ], "pmid": "" }, { "name": "action potential", "id": "GO:0001508", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001508", "evidence": [ { "database": "UniProtKB", "id": "O95837", "url": "https://www.uniprot.org/uniprot/O95837" } ], "pmid": "" }, { "name": "adenylate cyclase-modulating G protein-coupled receptor signaling pathway", "id": "GO:0007188", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007188", "evidence": [ { "database": "UniProtKB", "id": "O95837", "url": "https://www.uniprot.org/uniprot/O95837" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "GTPase activity", "id": "GO:0003924", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003924", "evidence": [ { "database": "UniProtKB", "id": "O95837", "url": "https://www.uniprot.org/uniprot/O95837" } ], "pmid": "" }, { "name": "GTP binding", "id": "GO:0005525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005525", "evidence": [ { "database": "UniProtKB", "id": "O95837", "url": "https://www.uniprot.org/uniprot/O95837" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "O95837", "url": "https://www.uniprot.org/uniprot/O95837" } ], "pmid": "" }, { "name": "G protein-coupled receptor binding", "id": "GO:0001664", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001664", "evidence": [ { "database": "UniProtKB", "id": "O95837", "url": "https://www.uniprot.org/uniprot/O95837" } ], "pmid": "" }, { "name": "G-protein beta/gamma-subunit complex binding", "id": "GO:0031683", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031683", "evidence": [ { "database": "UniProtKB", "id": "O95837", "url": "https://www.uniprot.org/uniprot/O95837" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "O95837", "url": "https://www.uniprot.org/uniprot/O95837" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "O95837", "url": "https://www.uniprot.org/uniprot/O95837" } ], "pmid": "" }, { "name": "heterotrimeric G-protein complex", "id": "GO:0005834", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005834", "evidence": [ { "database": "UniProtKB", "id": "O95837", "url": "https://www.uniprot.org/uniprot/O95837" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 262, "end_pos": 264, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [ 206 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 262, "end_pos": 264 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 102 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }