{ "uniprot_canonical_ac": "O95714-1", "uniprot_ac": "O95714", "uniprot_id": "HERC2_HUMAN", "mass": { "chemical_mass": 527228.0, "monoisotopic_mass": 527228.0 }, "refseq": { "ac": "NP_004658", "name": "E3 ubiquitin-protein ligase HERC2", "summary": "This gene belongs to the HERC gene family that encodes a group of unusually large proteins, which contain multiple structural domains. All members have at least 1 copy of an N-terminal region showing homology to the cell cycle regulator RCC1 and a C-terminal HECT (homologous to E6-AP C terminus) domain found in a number of E3 ubiquitin protein ligases. Genetic variations in this gene are associated with skin/hair/eye pigmentation variability. Multiple pseudogenes of this gene are located on chromosomes 15 and 16. [provided by RefSeq, Mar 2012].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004658" }, "gene_names": [ { "name": "HERC2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O95714", "id": "O95714" }, { "name": "D15F37S1; jdf2; MRT38; p528; SHEP1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004658", "id": "NP_004658" }, { "name": "HERC2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004658", "id": "NP_004658" } ], "protein_names": [ { "name": "E3 ubiquitin-protein ligase HERC2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O95714" }, { "name": "2.3.2.26", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95714" }, { "name": "E3 ubiquitin-protein ligase HERC2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004658", "id": "NP_004658" }, { "name": "HECT domain and RCC1-like domain-containing protein 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95714" }, { "name": "HECT-type E3 ubiquitin transferase HERC2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95714" }, { "name": "probable E3 ubiquitin-protein ligase HERC2; hect domain and RCC1-like domain-containing protein 2; hect domain and RLD 2; HECT-type E3 ubiquitin transferase HERC2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004658", "id": "NP_004658" } ], "function": [ { "annotation": "Common genetic variants associated with melanoma risk or naevus count in patients with wildtype MC1R melanoma.", "evidence": [ { "database": "RefSeq", "id": "NP_004658", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004658" }, { "database": "PubMed", "id": "35701387", "url": "https://glygen.org/publication/PubMed/35701387" } ] }, { "annotation": "E3 ubiquitin-protein ligase that regulates ubiquitin-dependent retention of repair proteins on damaged chromosomes. Recruited to sites of DNA damage in response to ionizing radiation (IR) and facilitates the assembly of UBE2N and RNF8 promoting DNA damage-induced formation of 'Lys-63'-linked ubiquitin chains. Acts as a mediator of binding specificity between UBE2N and RNF8. Involved in the maintenance of RNF168 levels. E3 ubiquitin-protein ligase that promotes the ubiquitination and proteasomal degradation of XPA which influences the circadian oscillation of DNA excision repair activity. By controlling the steady-state expression of the IGF1R receptor, indirectly regulates the insulin-like growth factor receptor signaling pathway (PubMed:26692333). Modulates also iron metabolism by regulating the basal turnover of FBXL5 (PubMed:24778179).", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714#function" }, { "database": "PubMed", "id": "22508508", "url": "https://glygen.org/publication/PubMed/22508508" }, { "database": "PubMed", "id": "20023648", "url": "https://glygen.org/publication/PubMed/20023648" }, { "database": "PubMed", "id": "20304803", "url": "https://glygen.org/publication/PubMed/20304803" }, { "database": "PubMed", "id": "26692333", "url": "https://glygen.org/publication/PubMed/26692333" }, { "database": "PubMed", "id": "24778179", "url": "https://glygen.org/publication/PubMed/24778179" } ] }, { "annotation": "EHD1 promotes CP110 ubiquitination by centriolar satellite delivery of HERC2 to the mother centriole.", "evidence": [ { "database": "RefSeq", "id": "NP_004658", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004658" }, { "database": "PubMed", "id": "37074924", "url": "https://glygen.org/publication/PubMed/37074924" } ] }, { "annotation": "HERC2 deficiency activates C-RAF/MKK3/p38 signalling pathway altering the cellular response to oxidative stress. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_004658", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004658" }, { "database": "PubMed", "id": "36241744", "url": "https://glygen.org/publication/PubMed/36241744" } ] }, { "annotation": "HERC2 promotes inflammation-driven cancer stemness and immune evasion in hepatocellular carcinoma by activating STAT3 pathway. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_004658", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004658" }, { "database": "PubMed", "id": "36721234", "url": "https://glygen.org/publication/PubMed/36721234" } ] }, { "annotation": "Mechanism of orphan subunit recognition during assembly quality control.", "evidence": [ { "database": "RefSeq", "id": "NP_004658", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004658" }, { "database": "PubMed", "id": "37480851", "url": "https://glygen.org/publication/PubMed/37480851" } ] }, { "annotation": "This gene belongs to the HERC gene family that encodes a group of unusually large proteins, which contain multiple structural domains. All members have at least 1 copy of an N-terminal region showing homology to the cell cycle regulator RCC1 and a C-terminal HECT (homologous to E6-AP C terminus) domain found in a number of E3 ubiquitin protein ligases. Genetic variations in this gene are associated with skin/hair/eye pigmentation variability. Multiple pseudogenes of this gene are located on chromosomes 15 and 16. [provided by RefSeq, Mar 2012].", "evidence": [ { "database": "RefSeq", "id": "NP_004658", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004658" } ] } ], "disease": [ { "disease_id": "DOID:0081203", "recommended_name": { "id": "DOID:0081203", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0081203", "name": "autosomal recessive intellectual developmental disorder 38", "description": "An autosomal recessive intellectual developmental disorder that has_material_basis_in homozygous mutation in the HERC2 gene on chromosome 15q13." }, "synonyms": [ { "id": "MONDO:0014224", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014224", "name": "developmental delay with autism spectrum disorder and gait instability", "description": "Developmental delay with autism spectrum disorder and gait instability is a rare, genetic, neurological disorder characterized by infant hypotonia and feeding difficulties, global development delay, mild to moderated intellectual disability, delayed independent ambulation, broad-based gait with arms upheld and flexed at the elbow with brisk walking or running, and limited language skills. Behavior patterns are highly variable and range from sociable and affectionate to autistic behavior." }, { "id": "MONDO:0014224", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014224", "name": "developmental delay with ASD and gait instability", "description": "" }, { "id": "MONDO:0014224", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014224", "name": "intellectual developmental disorder, autosomal recessive 38", "description": "" }, { "id": "MONDO:0014224", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014224", "name": "intellectual disability, autosomal recessive type 38", "description": "" }, { "id": "MONDO:0014224", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014224", "name": "mental retardation, autosomal recessive type 38", "description": "" }, { "id": "MONDO:0014224", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014224", "name": "MRT38", "description": "" }, { "id": "MONDO:0014224", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014224", "name": "intellectual disability, autosomal recessive 38", "description": "" }, { "id": "MONDO:0014224", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014224", "name": "mental retardation, autosomal recessive 38", "description": "" }, { "id": "MIM:615516", "resource": "MIM", "url": "https://www.omim.org/entry/615516", "name": "Intellectual developmental disorder, autosomal recessive 38", "description": "Intellectual developmental disorder, autosomal recessive 38" } ], "evidence": [ { "id": "615516", "database": "MIM", "url": "https://www.omim.org/entry/615516" } ] }, { "disease_id": "MONDO:0044255", "recommended_name": { "id": "MONDO:0044255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0044255", "name": "obsolete skin/hair/eye pigmentation, variation in, 1", "description": "OBSOLETE. Multiple genes influence normal human skin, hair, and/or eye pigmentation. Pigmentation phenotypes influenced by variation in the OCA2 gene are termed SHEP1. The SHEP2 association (OMIM:266300) is determined by variation at the MC1R locus (OMIM:155555) and describes a phenotype predominantly characterized by red hair and fair skin. SHEP3 (OMIM:601800) encompasses pigment variation influenced by the TYR gene (OMIM:606933); SHEP4 (OMIM:113750), that influenced by the SLC24A5 gene (OMIM:609802). Variation in the SLC45A2 (OMIM:606202) and SLC24A4 (OMIM:609840) genes result in the phenotypic associations SHEP5 (OMIM:227240) and SHEP6 (OMIM:210750), respectively. Sequence variation thought to affect expression of KITLG (OMIM:184745) results in the SHEP7 (OMIM:611664) phenotypic association. SHEP8 (OMIM:611724) is associated with variation in the IRF4 gene (OMIM:601900). Polymorphism in the 3-prime untranslated region of the ASIP gene (OMIM:600201) influences the SHEP9 association (OMIM:611742). The SHEP10 association (OMIM:612267) comprises variation in the TPCN2 gene (OMIM:612163), and SHEP11 (OMIM:612271) is associated with polymorphism near the TYRP1 gene (OMIM:115501)." }, "synonyms": [ { "id": "MONDO:0044255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0044255", "name": "skin/hair/eye pigmentation 1, blond/brown hair", "description": "" }, { "id": "MONDO:0044255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0044255", "name": "skin/hair/eye pigmentation 1, blue/nonblue eyes", "description": "" }, { "id": "MONDO:0044255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0044255", "name": "Brown eye color 2", "description": "" }, { "id": "MONDO:0044255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0044255", "name": "SHEP1", "description": "" }, { "id": "MONDO:0044255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0044255", "name": "eye color 3", "description": "" }, { "id": "MONDO:0044255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0044255", "name": "eye color, Brown/blue", "description": "" }, { "id": "MONDO:0044255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0044255", "name": "eye color, blue/Nonblue", "description": "" }, { "id": "MONDO:0044255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0044255", "name": "hair color 3", "description": "" }, { "id": "MONDO:0044255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0044255", "name": "skin/hair/eye pigmentation 1, Blond/Brown hair", "description": "" }, { "id": "MONDO:0044255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0044255", "name": "skin/hair/eye pigmentation 1, blue/Brown eyes", "description": "" }, { "id": "MONDO:0044255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0044255", "name": "skin/hair/eye pigmentation 1, blue/Nonblue eyes", "description": "" }, { "id": "MONDO:0044255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0044255", "name": "skin/hair/eye pigmentation, variation IN, 1", "description": "" } ], "evidence": [ { "id": "227220", "database": "MIM", "url": "https://www.omim.org/entry/227220" } ] } ], "snv": [ { "evidence": [ { "id": "O95714", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95714" }, { "id": "rs778601927", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778601927" }, { "id": "rs778601927", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778601927" }, { "id": "rs778601927", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778601927" }, { "id": "rs778601927", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs778601927#frequency_tab" }, { "id": "rs778601927", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778601927" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1020, "end_pos": 1020, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "A", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NIA->NIS).", "chr_id": "15", "chr_pos": "28248729", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "A1020", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs749601788", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749601788" }, { "id": "rs749601788", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749601788" }, { "id": "rs749601788", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749601788" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 1048, "end_pos": 1048, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SAS->NAS).", "chr_id": "15", "chr_pos": "28142939", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1048", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O95714", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95714" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1076, "end_pos": 1076, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DIS->NIS).", "chr_id": "15", "chr_pos": "28248561", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "D1076", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1376931206", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1376931206" }, { "id": "rs1376931206", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1376931206" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1150, "end_pos": 1150, "sequence_org": "G", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NAG->NAS).", "chr_id": "15", "chr_pos": "28246010", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "G1150", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1596284273", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1596284273" }, { "id": "rs1596284273", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1596284273" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1771, "end_pos": 1771, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NEN->NET).", "chr_id": "15", "chr_pos": "28228370", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N1771", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs756054844", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756054844" }, { "id": "rs756054844", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756054844" }, { "id": "rs756054844", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs756054844" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1772, "end_pos": 1772, "sequence_org": "P", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NPS->NLS).", "chr_id": "15", "chr_pos": "28228367", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P1772", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs148787940", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs148787940" }, { "id": "rs148787940", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs148787940" }, { "id": "rs148787940", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs148787940" }, { "id": "rs148787940", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs148787940#frequency_tab" }, { "id": "rs148787940", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs148787940" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1772, "end_pos": 1772, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NPS->NSS).", "chr_id": "15", "chr_pos": "28228368", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "P1772", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O95714", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95714" } ], "glycoeffect": [], "start_pos": 1784, "end_pos": 1784, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "L", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "15", "chr_pos": "28228331", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "R1784", "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] }, { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] }, { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs148005149", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs148005149" }, { "id": "rs148005149", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs148005149" }, { "id": "rs148005149", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs148005149" }, { "id": "rs148005149", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs148005149#frequency_tab" }, { "id": "rs148005149", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs148005149" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 179, "end_pos": 179, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KKS->NKS).", "chr_id": "15", "chr_pos": "28280073", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "K179", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1191505026", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1191505026" }, { "id": "rs1191505026", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1191505026" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1809, "end_pos": 1809, "sequence_org": "G", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSG->NSS).", "chr_id": "15", "chr_pos": "28228257", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "G1809", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1263914415", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1263914415" }, { "id": "rs1263914415", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1263914415" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1851, "end_pos": 1851, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "15", "chr_pos": "28222129", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1851", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs749025739", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749025739" }, { "id": "rs749025739", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749025739" }, { "id": "rs749025739", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs749025739#frequency_tab" }, { "id": "rs749025739", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749025739" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1851, "end_pos": 1851, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->M).", "chr_id": "15", "chr_pos": "28222128", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1851", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O95714", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95714" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 2085, "end_pos": 2085, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DKT->NKT).", "chr_id": "15", "chr_pos": "28214760", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "D2085", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "O95714", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95714" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 2232, "end_pos": 2232, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (TVT->NVT).", "chr_id": "15", "chr_pos": "28213833", "ref_nt": "G", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "T2232", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1207256292", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1207256292" }, { "id": "rs1207256292", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1207256292" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 2274, "end_pos": 2274, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NLP->NLS).", "chr_id": "15", "chr_pos": "28212550", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P2274", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs978465712", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs978465712" }, { "id": "rs978465712", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs978465712#frequency_tab" }, { "id": "rs978465712", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs978465712" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 2290, "end_pos": 2290, "sequence_org": "A", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NLA->NLS).", "chr_id": "15", "chr_pos": "28212502", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A2290", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs978465712", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs978465712" }, { "id": "rs978465712", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs978465712#frequency_tab" }, { "id": "rs978465712", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs978465712" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 2290, "end_pos": 2290, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NLA->NLT).", "chr_id": "15", "chr_pos": "28212502", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A2290", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs779041581", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779041581" }, { "id": "rs779041581", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779041581" }, { "id": "rs779041581", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs779041581#frequency_tab" }, { "id": "rs779041581", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs779041581" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 2300, "end_pos": 2300, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KKS->NKS).", "chr_id": "15", "chr_pos": "28212470", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K2300", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs769326690", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769326690" }, { "id": "rs769326690", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769326690" }, { "id": "rs769326690", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs769326690" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 242, "end_pos": 242, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DES->NES).", "chr_id": "15", "chr_pos": "28274367", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D242", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O95714", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95714" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 2792, "end_pos": 2792, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "L", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVS->NVL).", "chr_id": "15", "chr_pos": "28192037", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "S2792", "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "O95714", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95714" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 2798, "end_pos": 2798, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "A", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NQA->NQT).", "chr_id": "15", "chr_pos": "28192020", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "A2798", "disease": [ { "disease_id": "DOID:2531", "recommended_name": { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes." }, "synonyms": [ { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematologic malignancy", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematologic neoplasm", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematological tumors", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "blood cancer", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic and lymphoid system tumor", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic cancer", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic neoplasm", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic tumors", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "malignant hematopoietic neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1353995088", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1353995088" }, { "id": "rs1353995088", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1353995088" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 2841, "end_pos": 2841, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DSS->NSS).", "chr_id": "15", "chr_pos": "28191175", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D2841", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs767335178", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767335178" }, { "id": "rs767335178", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767335178" }, { "id": "rs767335178", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs767335178#frequency_tab" }, { "id": "rs767335178", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767335178" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 2861, "end_pos": 2861, "sequence_org": "I", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NLI->NLT).", "chr_id": "15", "chr_pos": "28191032", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I2861", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1284541506", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1284541506" }, { "id": "rs1284541506", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1284541506" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 2870, "end_pos": 2870, "sequence_org": "P", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NPS->NLS).", "chr_id": "15", "chr_pos": "28191005", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P2870", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O95714", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95714" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2928, "end_pos": 2928, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "L", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "15", "chr_pos": "28186619", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "S2928", "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] }, { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs201973387", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201973387" }, { "id": "rs201973387", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201973387" }, { "id": "rs201973387", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201973387" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 3030, "end_pos": 3030, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SGT->NGT).", "chr_id": "15", "chr_pos": "28178961", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S3030", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O95714", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95714" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 3310, "end_pos": 3310, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "K", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (KIT->NIT).", "chr_id": "15", "chr_pos": "28174522", "ref_nt": "C", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "K3310", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "O95714", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95714" }, { "id": "rs763806394", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763806394" }, { "id": "rs763806394", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763806394" }, { "id": "rs763806394", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763806394" }, { "id": "rs763806394", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs763806394#frequency_tab" }, { "id": "rs763806394", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763806394" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 3438, "end_pos": 3438, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DAS->NAS).", "chr_id": "15", "chr_pos": "28168508", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "D3438", "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs148150960", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs148150960" }, { "id": "rs148150960", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs148150960" }, { "id": "rs148150960", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs148150960" }, { "id": "rs148150960", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs148150960#frequency_tab" }, { "id": "rs148150960", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs148150960" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 3475, "end_pos": 3475, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).", "chr_id": "15", "chr_pos": "28167817", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "S3475", "disease": [ { "disease_id": "DOID:11983", "recommended_name": { "id": "DOID:11983", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11983", "name": "Prader-Willi syndrome", "description": "A chromosomal disease that is characterized by weak muscle tone, feeding difficulties, poor growth, and delayed development. Beginning in childhood, affected individuals develop an insatiable appetite, which leads to chronic overeating and obesity." }, "synonyms": [ { "id": "DOID:11983", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11983", "name": "Prader Willi syndrome", "description": "" }, { "id": "MONDO:0008300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008300", "name": "Prader-Willi syndrome", "description": "Prader-Willi syndrome is a rare genetic disorder characterized by hypothalamic-pituitary abnormalities with severe hypotonia during the neonatal period and first two years of life and the onset of hyperphagia with a risk of morbid obesity during infancy and adulthood, learning difficulties and behavioral problems or severe psychiatric problems." }, { "id": "MONDO:0008300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008300", "name": "Prader Willi syndrome", "description": "" }, { "id": "MONDO:0008300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008300", "name": "Prader-Labhart-Willi syndrome", "description": "" }, { "id": "MONDO:0008300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008300", "name": "Prader-Willi syndrome", "description": "" }, { "id": "MONDO:0008300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008300", "name": "Prader-Willi-Labhart syndrome", "description": "" }, { "id": "MONDO:0008300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008300", "name": "Willi-Prader syndrome", "description": "" }, { "id": "MONDO:0008300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008300", "name": "PWS", "description": "" }, { "id": "MONDO:0008300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008300", "name": "Prader-Willi syndrome chromosome region", "description": "" }, { "id": "MONDO:0008300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008300", "name": "Prader-Willi-like syndrome associated with chromosome 6", "description": "" }, { "id": "MONDO:0008300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008300", "name": "obesity, muscular hypotonia, intellectual disability, short stature, hypogonadotropic hypogonadism, and small hands and feet", "description": "" }, { "id": "MONDO:0008300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008300", "name": "obesity, muscular hypotonia, mental retardation, short stature, hypogonadotropic hypogonadism, and small hands and feet", "description": "" } ] } ], "keywords": [ "ebi", "germline", "disease" ] }, { "evidence": [ { "id": "rs146303265", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs146303265" }, { "id": "rs146303265", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs146303265" }, { "id": "rs146303265", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs146303265#frequency_tab" }, { "id": "rs146303265", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs146303265" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 3487, "end_pos": 3487, "sequence_org": "S", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->L).", "chr_id": "15", "chr_pos": "28167781", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S3487", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs772814784", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772814784" }, { "id": "rs772814784", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772814784" }, { "id": "rs772814784", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772814784" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 3487, "end_pos": 3487, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->P).", "chr_id": "15", "chr_pos": "28167782", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S3487", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs765652137", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765652137" }, { "id": "rs765652137", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765652137" }, { "id": "rs765652137", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765652137" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 3526, "end_pos": 3526, "sequence_org": "A", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NKA->NKS).", "chr_id": "15", "chr_pos": "28163264", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A3526", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1289486718", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1289486718" }, { "id": "rs1289486718", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1289486718" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 3544, "end_pos": 3544, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DDT->NDT).", "chr_id": "15", "chr_pos": "28163210", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D3544", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1342080194", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1342080194" }, { "id": "rs1342080194", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1342080194#frequency_tab" }, { "id": "rs1342080194", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1342080194" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 3554, "end_pos": 3554, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KLS->NLS).", "chr_id": "15", "chr_pos": "28163178", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K3554", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O95714", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95714" } ], "glycoeffect": [], "start_pos": 3571, "end_pos": 3571, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "A", "sequence_mut": "V", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "15", "chr_pos": "28163128", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "A3571", "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] }, { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] }, { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1407543642", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1407543642" }, { "id": "rs1407543642", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1407543642#frequency_tab" }, { "id": "rs1407543642", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1407543642" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 3622, "end_pos": 3622, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DDT->NDT).", "chr_id": "15", "chr_pos": "28152713", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D3622", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1047573613", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1047573613" }, { "id": "rs1047573613", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1047573613#frequency_tab" }, { "id": "rs1047573613", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1047573613" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 3623, "end_pos": 3623, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DTS->NTS).", "chr_id": "15", "chr_pos": "28152710", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D3623", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs754991203", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754991203" }, { "id": "rs754991203", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754991203" }, { "id": "rs754991203", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754991203#frequency_tab" }, { "id": "rs754991203", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754991203" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 3675, "end_pos": 3675, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DWS->NWS).", "chr_id": "15", "chr_pos": "28144790", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D3675", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1315814960", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1315814960" }, { "id": "rs1315814960", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1315814960#frequency_tab" }, { "id": "rs1315814960", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1315814960" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 3744, "end_pos": 3744, "sequence_org": "A", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NLA->NLS).", "chr_id": "15", "chr_pos": "28144146", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A3744", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O95714", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95714" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 3744, "end_pos": 3744, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "A", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NLA->NLT).", "chr_id": "15", "chr_pos": "28144146", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "A3744", "disease": [ { "disease_id": "DOID:4362", "recommended_name": { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervical cancer", "description": "A female reproductive organ cancer that is located_in the cervix." }, "synonyms": [ { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervical neoplasm", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervix cancer", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervix uteri cancer", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "neoplasm of uterine cervix", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "tumor of the Cervix Uteri", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "uterine cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical cancer", "description": "A primary or metastatic malignant neoplasm involving the cervix." }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "tumor of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "tumour of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "uterine cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cancer of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical cancer, somatic", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervix cancer", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervix uteri cancer", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "uterine cervix cancer", "description": "" }, { "id": "MIM:603956", "resource": "MIM", "url": "https://www.omim.org/entry/603956", "name": "Cervical cancer", "description": "Cervical cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs114532098", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs114532098" }, { "id": "rs114532098", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs114532098" }, { "id": "rs114532098", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs114532098" }, { "id": "rs114532098", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs114532098#frequency_tab" }, { "id": "rs114532098", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs114532098" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 3746, "end_pos": 3746, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->KRS).", "chr_id": "15", "chr_pos": "28144138", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "0.002995", "site_lbl": "N3746", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1480398247", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1480398247" }, { "id": "rs1480398247", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1480398247" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 3746, "end_pos": 3746, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->TRS).", "chr_id": "15", "chr_pos": "28144139", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N3746", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1250585808", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1250585808" }, { "id": "rs1250585808", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1250585808#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 3748, "end_pos": 3748, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->NRN).", "chr_id": "15", "chr_pos": "28144133", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S3748", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O95714", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95714" }, { "id": "rs1486170977", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1486170977" }, { "id": "rs1486170977", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1486170977" }, { "id": "rs1486170977", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1486170977" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 3793, "end_pos": 3793, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NIN->NIS).", "chr_id": "15", "chr_pos": "28143913", "ref_nt": "T", "alt_nt": "C", "minor_allelic_frequency": "", "site_lbl": "N3793", "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] }, { "disease_id": "DOID:1319", "recommended_name": { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain." }, "synonyms": [ { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "BT - Brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult malignant brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm, adult", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of Brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of adult brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary malignant neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "tumor of the Brain", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "O95714", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95714" } ], "glycoeffect": [], "start_pos": 3906, "end_pos": 3906, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "C", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (4).", "chr_id": "15", "chr_pos": "28141831", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "R3906", "disease": [ { "disease_id": "DOID:1319", "recommended_name": { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain." }, "synonyms": [ { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "BT - Brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult malignant brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm, adult", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of Brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of adult brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary malignant neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "tumor of the Brain", "description": "" } ] }, { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1268524670", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1268524670" }, { "id": "rs1268524670", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1268524670#frequency_tab" }, { "id": "rs1268524670", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1268524670" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 3945, "end_pos": 3945, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TLS->NLS).", "chr_id": "15", "chr_pos": "28141613", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T3945", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs776669434", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776669434" }, { "id": "rs776669434", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776669434" }, { "id": "rs776669434", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs776669434#frequency_tab" }, { "id": "rs776669434", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776669434" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 4283, "end_pos": 4283, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DGT->NGT).", "chr_id": "15", "chr_pos": "28125149", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D4283", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O95714", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95714" }, { "id": "rs1424541635", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1424541635" }, { "id": "rs1424541635", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1424541635" }, { "id": "rs1424541635", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1424541635" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 4374, "end_pos": 4374, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DET->NET).", "chr_id": "15", "chr_pos": "28124105", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "D4374", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "O95714", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95714" }, { "id": "rs953713630", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs953713630" }, { "id": "rs953713630", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs953713630" }, { "id": "rs953713630", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs953713630" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 4438, "end_pos": 4438, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DGT->NGT).", "chr_id": "15", "chr_pos": "28117115", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "D4438", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs200741102", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200741102" }, { "id": "rs200741102", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200741102" }, { "id": "rs200741102", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200741102" }, { "id": "rs200741102", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200741102" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 4628, "end_pos": 4628, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NRA->NRT).", "chr_id": "15", "chr_pos": "28114643", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.000399", "site_lbl": "A4628", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs188787231", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs188787231" }, { "id": "rs188787231", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs188787231" }, { "id": "rs188787231", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs188787231" }, { "id": "rs188787231", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs188787231#frequency_tab" }, { "id": "rs188787231", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs188787231" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 4808, "end_pos": 4808, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DDS->NDS).", "chr_id": "15", "chr_pos": "28111846", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.000599", "site_lbl": "D4808", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs762060698", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762060698" }, { "id": "rs762060698", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762060698" }, { "id": "rs762060698", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762060698" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 4809, "end_pos": 4809, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DSS->NSS).", "chr_id": "15", "chr_pos": "28111843", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D4809", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1466221657", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1466221657" }, { "id": "rs1466221657", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1466221657" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 4812, "end_pos": 4812, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DDS->NDS).", "chr_id": "15", "chr_pos": "28111834", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D4812", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs753784290", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753784290" }, { "id": "rs753784290", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753784290" }, { "id": "rs753784290", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs753784290#frequency_tab" }, { "id": "rs753784290", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs753784290" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 561, "end_pos": 561, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TYS->NYS).", "chr_id": "15", "chr_pos": "28265891", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T561", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs995605135", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs995605135" }, { "id": "rs995605135", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs995605135#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 581, "end_pos": 581, "sequence_org": "G", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NYG->NYS).", "chr_id": "15", "chr_pos": "28265832", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "G581", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs772130478", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772130478" }, { "id": "rs772130478", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772130478" }, { "id": "rs772130478", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772130478" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 796, "end_pos": 796, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SMT->NMT).", "chr_id": "15", "chr_pos": "28163164", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S796", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1258637047", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1258637047" }, { "id": "rs1258637047", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1258637047" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 984, "end_pos": 984, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SRT->NRT).", "chr_id": "15", "chr_pos": "28254439", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S984", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 2708, "end_pos": 2708, "sequence_org": "C", "sequence_mut": "S", "comment": "Abolishes binding to SUMO; when associated with S-2711.", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" }, { "database": "PubMed", "id": "22508508", "url": "https://glygen.org/publication/PubMed/22508508" } ] }, { "start_pos": 2711, "end_pos": 2711, "sequence_org": "C", "sequence_mut": "S", "comment": "Abolishes binding to SUMO; when associated with S-2708.", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" }, { "database": "PubMed", "id": "22508508", "url": "https://glygen.org/publication/PubMed/22508508" } ] }, { "start_pos": 4827, "end_pos": 4827, "sequence_org": "T", "sequence_mut": "A", "comment": "Prevents HERC2 C-terminal fragment binding to endogenous RNF8.", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" }, { "database": "PubMed", "id": "20023648", "url": "https://glygen.org/publication/PubMed/20023648" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "79.79", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000128731", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000128731" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "78.43", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000128731", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000128731" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "81.2", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000128731", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000128731" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "68.75", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000128731", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000128731" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "93.64", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000128731", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000128731" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "89.11", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000128731", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000128731" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "73.01", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000128731", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000128731" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "89.86", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000128731", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000128731" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "92.42", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000128731", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000128731" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "72.32", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000128731", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000128731" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "87.46", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000128731", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000128731" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "92.66", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000128731", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000128731" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "91.29", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000128731", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000128731" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O95714", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95714" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O95714", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95714" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O95714", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95714" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O95714", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95714" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O95714", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95714" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O95714", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95714" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O95714", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95714" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O95714", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95714" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O95714", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95714" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O95714", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95714" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O95714", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95714" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O95714", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95714" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" } ], "common_name": "Human" } ], "gene": [ { "name": "HERC2", "url": "https://www.uniprot.org/uniprot/O95714", "locus": { "chromosome": "HSCHR15_4_CTG8", "start_pos": 244504, "end_pos": 569367, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000276802", "url": "https://www.ensembl.org/id/ENSG00000276802" } ] } } ], "crossref": [ { "id": "ENSG00000128731", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000128731", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O95714", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95714", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd00078", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00078", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd02344", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd02344", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd08664", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd08664", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd14402", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd14402", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "HERC2", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=HERC2", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "8924", "url": "https://www.ncbi.nlm.nih.gov/gene/8924", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "1191", "url": "https://glyconnect.expasy.org/browser/proteins/1191", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "4868", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=4868", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O95714", "url": "https://www.ebi.ac.uk/intact/interactors/id:O95714*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000408", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000408", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000433", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000433", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000569", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000569", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001199", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001199", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR004939", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004939", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006624", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006624", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008979", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008979", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009091", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009091", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR010606", "url": "https://www.ebi.ac.uk/interpro/entry/IPR010606", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014722", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014722", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR021097", "url": "https://www.ebi.ac.uk/interpro/entry/IPR021097", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035983", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035983", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036400", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036400", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037252", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037252", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037976", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037976", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR041987", "url": "https://www.ebi.ac.uk/interpro/entry/IPR041987", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR042469", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042469", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043145", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043145", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:8924", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8924", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "227220", "url": "http://www.omim.org/entry/227220", "database": "MIM", "categories": [ "Other" ] }, { "id": "605837", "url": "http://www.omim.org/entry/605837", "database": "MIM", "categories": [ "Other" ] }, { "id": "615516", "url": "http://www.omim.org/entry/615516", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O95714", "url": "https://www.nextprot.org/entry/NX_O95714", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O95714", "url": "https://oglcnac.org/atlas/detail/O95714", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "O95714", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95714", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "IMEMGFT", "url": "https://omabrowser.org/oma/group/IMEMGFT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5491782at2759", "url": "http://www.orthodb.org/?query=5491782at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR22870", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22870", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR22870:SF398", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22870:SF398", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR22870:SF408", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22870:SF408", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46654", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46654", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46654:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46654:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2KEO", "url": "https://www.rcsb.org/structure/2KEO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KCI", "url": "https://www.rcsb.org/structure/3KCI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4L1M", "url": "https://www.rcsb.org/structure/4L1M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6WW3", "url": "https://www.rcsb.org/structure/6WW3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6WW4", "url": "https://www.rcsb.org/structure/6WW4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7Q40", "url": "https://www.rcsb.org/structure/7Q40", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7Q41", "url": "https://www.rcsb.org/structure/7Q41", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7Q42", "url": "https://www.rcsb.org/structure/7Q42", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7Q43", "url": "https://www.rcsb.org/structure/7Q43", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7Q44", "url": "https://www.rcsb.org/structure/7Q44", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7Q45", "url": "https://www.rcsb.org/structure/7Q45", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7Q46", "url": "https://www.rcsb.org/structure/7Q46", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7RGW", "url": "https://www.rcsb.org/structure/7RGW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00173", "url": "http://pfam.xfam.org/family/PF00173", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00415", "url": "http://pfam.xfam.org/family/PF00415", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00569", "url": "http://pfam.xfam.org/family/PF00569", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00632", "url": "http://pfam.xfam.org/family/PF00632", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF03256", "url": "http://pfam.xfam.org/family/PF03256", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF06701", "url": "http://pfam.xfam.org/family/PF06701", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF11515", "url": "http://pfam.xfam.org/family/PF11515", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O95714", "url": "https://pharos.nih.gov/targets/O95714", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000050928", "url": "https://proconsortium.org/app/entry/PR:000050928", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_O95714", "url": "http://purl.obolibrary.org/obo/PR_O95714", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-69473", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69473", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_004658", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004658", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "O95714", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "A0A0G2JLM1", "url": "https://www.uniprot.org/uniprot/A0A0G2JLM1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JLM1-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JLM1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JPS8", "url": "https://www.uniprot.org/uniprot/A0A0G2JPS8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JPS8-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JPS8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0J9YVP0", "url": "https://www.uniprot.org/uniprot/A0A0J9YVP0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0J9YVP0-1", "url": "https://www.uniprot.org/uniprot/A0A0J9YVP0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0J9YXQ8", "url": "https://www.uniprot.org/uniprot/A0A0J9YXQ8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0J9YXQ8-1", "url": "https://www.uniprot.org/uniprot/A0A0J9YXQ8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3B3IRP6", "url": "https://www.uniprot.org/uniprot/A0A3B3IRP6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3B3IRP6-1", "url": "https://www.uniprot.org/uniprot/A0A3B3IRP6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BRG9", "url": "https://www.uniprot.org/uniprot/H3BRG9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BRG9-1", "url": "https://www.uniprot.org/uniprot/H3BRG9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BUQ1", "url": "https://www.uniprot.org/uniprot/H3BUQ1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BUQ1-1", "url": "https://www.uniprot.org/uniprot/H3BUQ1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95714-1", "url": "https://www.uniprot.org/uniprot/O95714-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPSESFCLAAQARLDSKWLKTDIQLAFTRDGLCGLWNEMVKDGEIVYTGTESTQNGELPPRKDDSVEPSGTKKEDLNDKEKKDEEETPAPIYRAKSILDSWVWGKQPDVNELKECLSVLVKEQQALAVQSATTTLSALRLKQRLVILERYFIALNRTVFQENVKVKWKSSGISLPPVDKKSSRPAGKGVEGLARVGSRAALSFAFAFLRRAWRSGEDADLCSELLQESLDALRALPEASLFDESTVSSVWLEVVERATRFLRSVVTGDVHGTPATKGPGSIPLQDQHLALAILLELAVQRGTLSQMLSAILLLLQLWDSGAQETDNERSAQGTSAPLLPLLQRFQSIICRKDAPHSEGDMHLLSGPLSPNESFLRYLTLPQDNELAIDLRQTAVVVMAHLDRLATPCMPPLCSSPTSHKGSLQEVIGWGLIGWKYYANVIGPIQCEGLANLGVTQIACAEKRFLILSRNGRVYTQAYNSDTLAPQLVQGLASRNIVKIAAHSDGHHYLALAATGEVYSWGCGDGGRLGHGDTVPLEEPKVISAFSGKQAGKHVVHIACGSTYSAAITAEGELYTWGRGNYGRLGHGSSEDEAIPMLVAGLKGLKVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLIEKLQDLDVVKVRCGSQFSIALTKDGQVYSWGKGDNQRLGHGTEEHVRYPKLLEGLQGKKVIDVAAGSTHCLALTEDSEVHSWGSNDQCQHFDTLRVTKPEPAALPGLDTKHIVGIACGPAQSFAWSSCSEWSIGLRVPFVVDICSMTFEQLDLLLRQVSEGMDGSADWPPPQEKECVAVATLNLLRLQLHAAISHQVDPEFLGLGLGSILLNSLKQTVVTLASSAGVLSTVQSAAQAVLQSGWSVLLPTAEERARALSALLPCAVSGNEVNISPGRRFMIDLLVGSLMADGGLESALHAAITAEIQDIEAKKEAQKEKEIDEQEANASTFHRSRTPLDKDLINTGICESSGKQCLPLVQLIQQLLRNIASQTVARLKDVARRISSCLDFEQHSRERSASLDLLLRFQRLLISKLYPGESIGQTSDISSPELMGVGSLLKKYTALLCTHIGDILPVAASIASTSWRHFAEVAYIVEGDFTGVLLPELVVSIVLLLSKNAGLMQEAGAVPLLGGLLEHLDRFNHLAPGKERDDHEELAWPGIMESFFTGQNCRNNEEVTLIRKADLENHNKDGGFWTVIDGKVYDIKDFQTQSLTGNSILAQFAGEDPVVALEAALQFEDTRESMHAFCVGQYLEPDQEIVTIPDLGSLSSPLIDTERNLGLLLGLHASYLAMSTPLSPVEIECAKWLQSSIFSGGLQTSQIHYSYNEEKDEDHCSSPGGTPASKSRLCSHRRALGDHSQAFLQAIADNNIQDHNVKDFLCQIERYCRQCHLTTPIMFPPEHPVEEVGRLLLCCLLKHEDLGHVALSLVHAGALGIEQVKHRTLPKSVVDVCRVVYQAKCSLIKTHQEQGRSYKEVCAPVIERLRFLFNELRPAVCNDLSIMSKFKLLSSLPRWRRIAQKIIRERRKKRVPKKPESTDDEEKIGNEESDLEEACILPHSPINVDKRPIAIKSPKDKWQPLLSTVTGVHKYKWLKQNVQGLYPQSPLLSTIAEFALKEEPVDVEKMRKCLLKQLERAEVRLEGIDTILKLASKNFLLPSVQYAMFCGWQRLIPEGIDIGEPLTDCLKDVDLIPPFNRMLLEVTFGKLYAWAVQNIRNVLMDASAKFKELGIQPVPLQTITNENPSGPSLGTIPQARFLLVMLSMLTLQHGANNLDLLLNSGMLALTQTALRLIGPSCDNVEEDMNASAQGASATVLEETRKETAPVQLPVSGPELAAMMKIGTRVMRGVDWKWGDQDGPPPGLGRVIGELGEDGWIRVQWDTGSTNSYRMGKEGKYDLKLAELPAAAQPSAEDSDTEDDSEAEQTERNIHPTAMMFTSTINLLQTLCLSAGVHAEIMQSEATKTLCGLLRMLVESGTTDKTSSPNRLVYREQHRSWCTLGFVRSIALTPQVCGALSSPQWITLLMKVVEGHAPFTATSLQRQILAVHLLQAVLPSWDKTERARDMKCLVEKLFDFLGSLLTTCSSDVPLLRESTLRRRRVRPQASLTATHSSTLAEEVVALLRTLHSLTQWNGLINKYINSQLRSITHSFVGRPSEGAQLEDYFPDSENPEVGGLMAVLAVIGGIDGRLRLGGQVMHDEFGEGTVTRITPKGKITVQFSDMRTCRVCPLNQLKPLPAVAFNVNNLPFTEPMLSVWAQLVNLAGSKLEKHKIKKSTKQAFAGQVDLDLLRCQQLKLYILKAGRALLSHQDKLRQILSQPAVQETGTVHTDDGAVVSPDLGDMSPEGPQPPMILLQQLLASATQPSPVKAIFDKQELEAAALAVCQCLAVESTHPSSPGFEDCSSSEATTPVAVQHIRPARVKRRKQSPVPALPIVVQLMEMGFSRRNIEFALKSLTGASGNASSLPGVEALVGWLLDHSDIQVTELSDADTVSDEYSDEEVVEDVDDAAYSMSTGAVVTESQTYKKRADFLSNDDYAVYVRENIQVGMMVRCCRAYEEVCEGDVGKVIKLDRDGLHDLNVQCDWQQKGGTYWVRYIHVELIGYPPPSSSSHIKIGDKVRVKASVTTPKYKWGSVTHQSVGVVKAFSANGKDIIVDFPQQSHWTGLLSEMELVPSIHPGVTCDGCQMFPINGSRFKCRNCDDFDFCETCFKTKKHNTRHTFGRINEPGQSAVFCGRSGKQLKRCHSSQPGMLLDSWSRMVKSLNVSSSVNQASRLIDGSEPCWQSSGSQGKHWIRLEIFPDVLVHRLKMIVDPADSSYMPSLVVVSGGNSLNNLIELKTININPSDTTVPLLNDCTEYHRYIEIAIKQCRSSGIDCKIHGLILLGRIRAEEEDLAAVPFLASDNEEEEDEKGNSGSLIRKKAAGLESAATIRTKVFVWGLNDKDQLGGLKGSKIKVPSFSETLSALNVVQVAGGSKSLFAVTVEGKVYACGEATNGRLGLGISSGTVPIPRQITALSSYVVKKVAVHSGGRHATALTVDGKVFSWGEGDDGKLGHFSRMNCDKPRLIEALKTKRIRDIACGSSHSAALTSSGELYTWGLGEYGRLGHGDNTTQLKPKMVKVLLGHRVIQVACGSRDAQTLALTDEGLVFSWGDGDFGKLGRGGSEGCNIPQNIERLNGQGVCQIECGAQFSLALTKSGVVWTWGKGDYFRLGHGSDVHVRKPQVVEGLRGKKIVHVAVGALHCLAVTDSGQVYAWGDNDHGQQGNGTTTVNRKPTLVQGLEGQKITRVACGSSHSVAWTTVDVATPSVHEPVLFQTARDPLGASYLGVPSDADSSAASNKISGASNSKPNRPSLAKILLSLDGNLAKQQALSHILTALQIMYARDAVVGALMPAAMIAPVECPSFSSAAPSDASAMASPMNGEECMLAVDIEDRLSPNPWQEKREIVSSEDAVTPSAVTPSAPSASARPFIPVTDDLGAASIIAETMTKTKEDVESQNKAAGPEPQALDEFTSLLIADDTRVVVDLLKLSVCSRAGDRGRDVLSAVLSGMGTAYPQVADMLLELCVTELEDVATDSQSGRLSSQPVVVESSHPYTDDTSTSGTVKIPGAEGLRVEFDRQCSTERRHDPLTVMDGVNRIVSVRSGREWSDWSSELRIPGDELKWKFISDGSVNGWGWRFTVYPIMPAAGPKELLSDRCVLSCPSMDLVTCLLDFRLNLASNRSIVPRLAASLAACAQLSALAASHRMWALQRLRKLLTTEFGQSININRLLGENDGETRALSFTGSALAALVKGLPEALQRQFEYEDPIVRGGKQLLHSPFFKVLVALACDLELDTLPCCAETHKWAWFRRYCMASRVAVALDKRTPLPRLFLDEVAKKIRELMADSENMDVLHESHDIFKREQDEQLVQWMNRRPDDWTLSAGGSGTIYGWGHNHRGQLGGIEGAKVKVPTPCEALATLRPVQLIGGEQTLFAVTADGKLYATGYGAGGRLGIGGTESVSTPTLLESIQHVFIKKVAVNSGGKHCLALSSEGEVYSWGEAEDGKLGHGNRSPCDRPRVIESLRGIEVVDVAAGGAHSACVTAAGDLYTWGKGRYGRLGHSDSEDQLKPKLVEALQGHRVVDIACGSGDAQTLCLTDDDTVWSWGDGDYGKLGRGGSDGCKVPMKIDSLTGLGVVKVECGSQFSVALTKSGAVYTWGKGDYHRLGHGSDDHVRRPRQVQGLQGKKVIAIATGSLHCVCCTEDGEVYTWGDNDEGQLGDGTTNAIQRPRLVAALQGKKVNRVACGSAHTLAWSTSKPASAGKLPAQVPMEYNHLQEIPIIALRNRLLLLHHLSELFCPCIPMFDLEGSLDETGLGPSVGFDTLRGILISQGKEAAFRKVVQATMVRDRQHGPVVELNRIQVKRSRSKGGLAGPDGTKSVFGQMCAKMSSFGPDSLLLPHRVWKVKFVGESVDDCGGGYSESIAEICEELQNGLTPLLIVTPNGRDESGANRDCYLLSPAARAPVHSSMFRFLGVLLGIAIRTGSPLSLNLAEPVWKQLAGMSLTIADLSEVDKDFIPGLMYIRDNEATSEEFEAMSLPFTVPSASGQDIQLSSKHTHITLDNRAEYVRLAINYRLHEFDEQVAAVREGMARVVPVPLLSLFTGYELETMVCGSPDIPLHLLKSVATYKGIEPSASLIQWFWEVMESFSNTERSLFLRFVWGRTRLPRTIADFRGRDFVIQVLDKYNPPDHFLPESYTCFFLLKLPRYSCKQVLEEKLKYAIHFCKSIDTDDYARIALTGEPAADDSSDDSDNEDVDSFASDSTQDYLTGH", "length": 4834, "header": "sp|O95714-1|HERC2_HUMAN Isoform 1 of E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2 CANONICAL=O95714-1" }, "isoforms": [ { "isoform_ac": "A0A0G2JLM1-1", "url": "", "sequence": { "sequence": "MPSESFCLAAQARLDSKWLKTDIQ", "length": 24, "header": "tr|A0A0G2JLM1-1|HERC2_HUMAN Computationally mapped isoform of E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=1 CANONICAL=O95714-1" }, "locus": { "chromosome": "HSCHR15_1_CTG8", "start_pos": 9393, "end_pos": 9322, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000612410.1", "url": "https://www.ensembl.org/id/ENST00000612410.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000477508.1", "url": "https://www.ensembl.org/id/ENSP00000477508.1" } ] } }, { "isoform_ac": "A0A0G2JPS8-1", "url": "", "sequence": { "sequence": "MVRARVVLPGRSCGRGGGVCRVGRCVCSDTLVLGAAGHITGDMPNGVRQRSRVSTVERPRWQGLPGVHTSRCVTREGPMHGASSSCIRQCRISPTVCFLLRQRPHACLLPPLQVKRSRSKGGLAGPDGTKSVFGQMCAKMSSFGPDSLLLPHRVWKVKFVGESVDDCGGGYSESIAEICEELQNGLTPLLIVTPNGRDESGANRDCYLLSPAARAPVHSSMFRFLGVLLGIAIRTGSPLSLNLAEPVWKQLAGMSLTIADLSEVDKDFIPGLMYIRDNEATSEEFEAMSLPFTVPSASGQDIQLSSKHTHITLDNRAEYVRLAINYRLHEFDEQVAAVREGMARVVPVPLLSLFTGYELETMVCGSPDIPLHLLKSVATYKGIEPSASLIQWFWEVMESFSNTERSLFLRFVWGRTRLPRTIADFRGRDFVIQVLDKYNPPDHFLPESYTCFFLLKLPRYSCKQVLEEKLKYAIHFCKSIDTDDYARIALTGEPAADDSSDDSDNEDVDSFASDSTQDYLTGH", "length": 523, "header": "tr|A0A0G2JPS8-1|HERC2_HUMAN Computationally mapped isoform of E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=1 CANONICAL=O95714-1" }, "locus": { "chromosome": "HSCHR15_4_CTG8", "start_pos": 250959, "end_pos": 245231, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000620983.1", "url": "https://www.ensembl.org/id/ENST00000620983.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000484177.1", "url": "https://www.ensembl.org/id/ENSP00000484177.1" } ] } }, { "isoform_ac": "A0A0J9YVP0-1", "url": "", "sequence": { "sequence": "XQSAVFCGRSGKQLKRCHSSQPGMLLDSWSRMVKSLNVSSSVNQASRLIDGSEPCWQSSGSQGKHWIRLEIFPDVLVHRLKMIVDPADSSYMPSLVVVSGGNSLNNLIELKTININPSDTTVPLLNDCTEYHRYIEIAIKQCRSSGIDCKIHGLILLGRIRAEEEDLAAVPFLASDNEEEEDEKGNSGSLIRKKAAGLESAATIRTKVFVWGLNDKDQLGGLKGSKIKVPSFSETLSALNVVQVAGGSKSLFAVTVEGKVYACGEATNGRLGLGISSGTVPIPRQITALSSYVVKKVAVHSGGRHATALTVDGKVFSWGEGDDGKLGHFSRMNCDKPRLIEALKTKRIRDIACGSSHSAALTSSGELYTWGLGEYGRLGHGDNTTQLKPKMVKVLLGHRVIQVACGSRDAQTLALTDEGLVFSWGDGDFGKLGRGGSEGCNIPQNIERLNGQGVCQIECGAQFSLALTKSGVVWTWGKGDYFRLGHGSDVHVRKPQVVEGLRGKKIVHVAVGALHCLAVTDSGQVYAWGDNDHGQQGNGTTTVNRKPTLVQGLEGQKITRVACGSSHSVAWTTVDVATPSVHEPVLFQTARDPLGASYLGVPSDADSSAASNKISGASNSKPNRPSLAKILLSLDGNLAKQQALSHILTALQIMYARDAVVGALMPAAMIAPVECPSFSSAAPSDASAMASPMNGEECMLAVDIEDRLSPNPWQEKREIVSSEDAVTPSAVTPSAPSASARPFIPVTDDLGAASIIAETMTKTKEDVESQNKAAGPEPQALDEFTSLLIADDTRVVVDLLKLSVCSRAGDRGRDVLSAVLSGMGTAYPQVADMLLELCVTELEDVATDSQSGRLSSQPVVVESSHPYTDDTSTSGTVKIPGAEGLRVEFDRQCSTERRHDPLTVMDGVNRIVSVRSGREWSDWSSELRIPGDELKWKFISDGSVNGWGWRFTVYPIMPAAGPKELLSDRCVLSCPSMDLVTCLLDFRLNLASNRSIVPRLAASLAACAQLSALAASHRMWALQRLRKLLTTEFGQSININRLLGENDGETRALSFTGSALAALVKGLPEALQRQFEYEDPIVRGGKQLLHSPFFKVLVALACDLELDTLPCCAETHKWAWFRRYCMASRVAVALDKRTPLPRLFLDEVAKKIRELMADSENMDVLHESHDIFKREQDEQLVQWMNRRPDDWTLSAGGSGTIYGWGHNHRGQLGGIEGAKVKVPTPCEALATLRPVQLIGGEQTLFAVTADGKLYATGYGAGGRLGIGGTESVSTPTLLESIQHVFIKKVAVNSGGKHCLALSSEGEVYSWGEAEDGKLGHGNRSPCDRPRVIESLRGIEVVDVAAGGAHSACVTAAGDLYTWGKGRYGRLGHSDSEDQLKPKLVEALQGHRVVDIACGSGDAQTLCLTDDDTVWSWGDGDYGKLGRGGSDGCKVPMKIDSLTGLGVVKVECGSQFSVALTKSGAVYTWGKGDYHRLGHGSDDHVRRPRQVQGLQGKKVIAIATGSLHCVCCTEDGEVYTWGDNDEGQLGDGTTNAIQRPRLVAALQGKKVNRVACGSAHTLAWSTSKPASAGKLPAQVPMEYNHLQEIPIIALRNRLLLLHHLSELFCPCIPMFDLEGSLDETGLGPSVGFDTLRGILISQGKEAAFRKVVQATMVRDRQHGPVVELNRIQVKRSRSKGGLAGPDGTKSVFGQMCAKMSSFGPDSLLLPHRVWKVKFVGESVDDCGGGYSESIAEICEELQNGLTPLLIVTPNGRDESGANRDCYLLSPAARAPVHSSMFRFLGVLLGIAIRTGSPLSLNLAEPVWKQLAGMSLTIADLSEVDKDFIPGLMYIRDNEATSEEFEAMSLPFTVPSASGQDIQLSSKHTHITLDNRAEYVRLAINYRLHEFDEQVAAVREGMARVVPVPLLSLFTGYELETMVCGSPDIPLHLLKSVATYKGIEPSASLIQWFWEVMESFSNTERSLFLRFVWGRTRLPRTIADFRGRDFVIQVLDKYNPPDHFLPESYTCFFLLKLPRYSCKQVLEEKLKYAIHFCKSIDTDDYARIALTGEPAADDSSDDSDNEDVDSFASDSTQDYLTGH", "length": 2081, "header": "tr|A0A0J9YVP0-1|A0A0J9YVP0_HUMAN Computationally mapped isoform of E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=1 CANONICAL=O95714-1" }, "locus": { "chromosome": "HSCHR15_4_CTG8", "start_pos": 325592, "end_pos": 245230, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000632916.1", "url": "https://www.ensembl.org/id/ENST00000632916.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000487606.1", "url": "https://www.ensembl.org/id/ENSP00000487606.1" } ] } }, { "isoform_ac": "A0A0J9YXQ8-1", "url": "", "sequence": { "sequence": "MPSESFCLAAQARLDSKWLKTDIQLAFTRDGLCGLWNEMVKDGEIVYTGTESTQNGELPPRKDDSVEPSGTKKEDLNDKEKKDEEETPAPIYRAKSILDSWVWGKQPDVNELKECLSVLVKEQQALAVQSATTTLSALRLKQRLVILERYFIALNRTVFQENVKVKWKSSGISLPPVDKKSSRPAGKGVEGLARVGSRAALSFAFAFLRRAWRSGEDADLCSELLQESLDALRALPEASLFDESTVSSVWLEVVERATRFLRSVVTGDVHGTPATKGPGSIPLQDQHLALAILLELAVQRGTLSQMLSAILLLLQLWDSGAQETDNERSAQGTSAPLLPLLQRFQSIICRKDAPHSEGDMHLLSGPLSPNESFLRYLTLPQDNELAIDLRQTAVVVMAHLDRLATPCMPPLCSSPTSHKGSLQEVIGWGLIGWKYYANVIGPIQCEGLANLGVTQIACAEKRFLILSRNGRVYTQAYNSDTLAPQLVQGLASRNIVKIAAHSDGHHYLALAATGEVYSWGCGDGGRLGHGDTVPLEEPKVISAFSGKQAGKHVVHIACGSTYSAAITAEGELYTWGRGNYGRLGHGSSEDEAIPMLVAGLKGLKVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLIEKLQDLDVVKVRCGSQFSIALTKDGQVYSWGKGDNQRLGHGTEEHVRYPKLLEGLQGKKVIDVAAGSTHCLALTEDSEVHSWGSNDQCQHFDTLRVTKPEPAALPGLDTKHIVGIACGPAQSFAWSSCSEWSIGLRVPFVVDICSMTFEQLDLLLRQVSEGMDGSADWPPPQEKECVAVATLNLLRLQLHAAISHQVDPEFLGLGLGSILLNSLKQTVVTLASSAGVLSTVQSAAQAVLQSGWSVLLPTAEERARALSALLPCAVSGNEVNISPGRRFMIDLLVGSLMADGGLESALHAAITAEIQVW", "length": 959, "header": "tr|A0A0J9YXQ8-1|A0A0J9YXQ8_HUMAN Computationally mapped isoform of E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=1 CANONICAL=O95714-1" }, "locus": { "chromosome": "HSCHR15_4_CTG8", "start_pos": 568657, "end_pos": 503097, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000633685.1", "url": "https://www.ensembl.org/id/ENST00000633685.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000488506.1", "url": "https://www.ensembl.org/id/ENSP00000488506.1" } ] } }, { "isoform_ac": "A0A3B3IRP6-1", "url": "", "sequence": { "sequence": "GKQLKRCHSSQPGMLLDSWSRMVKSLNVSSSVNQASRLIDGSEPCWQSSGSQGKHWIRLEIFPDVLVHRLKMIVDPADSSYMPSLVVVSGGNSLNNLIELKTININPSDTTVPLLNDCTEYHRYIEIAIKQCRSSGIDCKIHGLILLGRIRAEEEDLAAVPFLASDNEEEEDEKGNSGSLIRKKAAGLESAATIRTKVFVWGLNDKDQLGGLKGSKIKVPSFSETLSALNVVQVAGGSKSLFAVTVEGKVYACGEATNGRLGLGISSGTVPIPRQITALSSYVVKKVAVHSGGRHATALTVDGKVFSWGEGDDGKLGHFSRMNCDKPRLIEALKTKRIRDIACGSSHSAALTSSGELYTWGLGEYGRLGHGDNTTQLKPKMVKVLLGHRVIQVACGSRDAQTLALTDEGLVFSWGDGDFGKLGRGGSEGCNIPQNIERLNGQGVCQIECGAQFSLALTKSGVVWTWGKGDYFRLGHGSDVHVRKPQVVEGLRGKKIVHVAVGALHCLAVTDSGQVYAWGDNDHGQQGNGTTTVNRKPTLVQGLEGQKITRVACGSSHSVAWTTVDVATPSVHEPVLFQTARDPLGASYLGVPSDADSSAASNKISGASNSKPNRPSLAKILLSLDGNLAKQQALSHILTALQIMYARDAVVGALMPAAMIAPVECPSFSSAAPSDASAMASPMNGEECMLAVDIEDRLSPNPWQEKREIVSSEDAVTPSAVTPSAPSASARPFIPVTDDLGAASIIAETMTKTKEDVESQNKAAGPEPQALDEFTSLLIADDTRVVVDLLKLSVCSRAGDRGRDVLSAVLSGMGTAYPQVADMLLELCVTELEDVATDSQSGRLSSQPVVVESSHPYTDDTSTSGTVKIPGAEGLRVEFDRQCSTERRHDPLTVMDGVNRIVSVRSGREWSDWSSELRIPGDELKWKFISDGSVNGWGWRFTVYPIMPAAGPKELLSDRCVLSCPSMDLVTCLLDFRLNLASNRSIVPRLAASLAACAQLSALAASHRMWALQRLRKLLTTEFGQSININRLLGENDGETRALSFTGSALAALVKGLPEALQRQFEYEDPIVRGGKQLLHSPFFKVLVALACDLELDTLPCCAETHKWAWFRRYCMASRVAVALDKRTPLPRLFLDEVAKKIRELMADSENMDVLHESHDIFKREQDEQLVQWMNRRPDDWTLSAGGSGTIYGWGHNHRGQLGGIEGAKVKVPTPCEALATLRPVQLIGGEQTLFAVTADGKLYATGYGAGGRLGIGGTESVSTPTLLESIQHVFIKKVAVNSGGKHCLALSSEGEVYSWGEAEDGKLGHGNRSPCDRPRVIESLRGIEVVDVAAGGAHSACVTAAGDLYTWGKGRYGRLGHSDSEDQLKPKLVEALQGHRVVDIACGSGDAQTLCLTDDDTVWSWGDGDYGKLGRGGSDGCKVPMKVRFIHGATMMRDNWETEPPMPSRGLGW", "length": 1454, "header": "tr|A0A3B3IRP6-1|A0A3B3IRP6_HUMAN Computationally mapped isoform of HECT and RLD domain containing E3 ubiquitin protein ligase 2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=1 CANONICAL=O95714-1" }, "locus": { "chromosome": "15", "start_pos": 28192122, "end_pos": 28125113, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000650509.1", "url": "https://www.ensembl.org/id/ENST00000650509.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000496936.1", "url": "https://www.ensembl.org/id/ENSP00000496936.1" } ] } }, { "isoform_ac": "H3BRG9-1", "url": "", "sequence": { "sequence": "MPSESFCLAAQARLDSKWLKTDIQLAFTRDGLCGLWNEMVKDGEIVYTGTESTQNGELPPRKVETGFHRVSQDGLELLTS", "length": 80, "header": "tr|H3BRG9-1|H3BRG9_HUMAN Computationally mapped isoform of HECT and RLD domain containing E3 ubiquitin protein ligase 2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=1 CANONICAL=O95714-1" }, "locus": { "chromosome": "15", "start_pos": 28321433, "end_pos": 28298577, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000564734.5", "url": "https://www.ensembl.org/id/ENST00000564734.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000456237.1", "url": "https://www.ensembl.org/id/ENSP00000456237.1" } ] } }, { "isoform_ac": "H3BUQ1-1", "url": "", "sequence": { "sequence": "XRDPLGASYLGVPSDADSSAASNKISGASNSKPNRPSLAKILLSLDGNLAKQQALSHILTALQIMYARDAVVGALMPAAMIAPVECPSFSSAAPSDASAMASPMNGEECMLAVDIEDRLSPNPWQEKREIVSSEDAVTPSAVTPSAPSASARPFIPVTDDLGAASIIAETMTKTKEVADMLLELCVTELEDVATDSQSGR", "length": 200, "header": "tr|H3BUQ1-1|HERC2_HUMAN Computationally mapped isoform of E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=1 CANONICAL=O95714-1" }, "locus": { "chromosome": "15", "start_pos": 28174423, "end_pos": 28152759, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000569772.1", "url": "https://www.ensembl.org/id/ENST00000569772.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000457745.1", "url": "https://www.ensembl.org/id/ENSP00000457745.1" } ] } }, { "isoform_ac": "O95714-1", "url": "", "sequence": { "sequence": "MPSESFCLAAQARLDSKWLKTDIQLAFTRDGLCGLWNEMVKDGEIVYTGTESTQNGELPPRKDDSVEPSGTKKEDLNDKEKKDEEETPAPIYRAKSILDSWVWGKQPDVNELKECLSVLVKEQQALAVQSATTTLSALRLKQRLVILERYFIALNRTVFQENVKVKWKSSGISLPPVDKKSSRPAGKGVEGLARVGSRAALSFAFAFLRRAWRSGEDADLCSELLQESLDALRALPEASLFDESTVSSVWLEVVERATRFLRSVVTGDVHGTPATKGPGSIPLQDQHLALAILLELAVQRGTLSQMLSAILLLLQLWDSGAQETDNERSAQGTSAPLLPLLQRFQSIICRKDAPHSEGDMHLLSGPLSPNESFLRYLTLPQDNELAIDLRQTAVVVMAHLDRLATPCMPPLCSSPTSHKGSLQEVIGWGLIGWKYYANVIGPIQCEGLANLGVTQIACAEKRFLILSRNGRVYTQAYNSDTLAPQLVQGLASRNIVKIAAHSDGHHYLALAATGEVYSWGCGDGGRLGHGDTVPLEEPKVISAFSGKQAGKHVVHIACGSTYSAAITAEGELYTWGRGNYGRLGHGSSEDEAIPMLVAGLKGLKVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLIEKLQDLDVVKVRCGSQFSIALTKDGQVYSWGKGDNQRLGHGTEEHVRYPKLLEGLQGKKVIDVAAGSTHCLALTEDSEVHSWGSNDQCQHFDTLRVTKPEPAALPGLDTKHIVGIACGPAQSFAWSSCSEWSIGLRVPFVVDICSMTFEQLDLLLRQVSEGMDGSADWPPPQEKECVAVATLNLLRLQLHAAISHQVDPEFLGLGLGSILLNSLKQTVVTLASSAGVLSTVQSAAQAVLQSGWSVLLPTAEERARALSALLPCAVSGNEVNISPGRRFMIDLLVGSLMADGGLESALHAAITAEIQDIEAKKEAQKEKEIDEQEANASTFHRSRTPLDKDLINTGICESSGKQCLPLVQLIQQLLRNIASQTVARLKDVARRISSCLDFEQHSRERSASLDLLLRFQRLLISKLYPGESIGQTSDISSPELMGVGSLLKKYTALLCTHIGDILPVAASIASTSWRHFAEVAYIVEGDFTGVLLPELVVSIVLLLSKNAGLMQEAGAVPLLGGLLEHLDRFNHLAPGKERDDHEELAWPGIMESFFTGQNCRNNEEVTLIRKADLENHNKDGGFWTVIDGKVYDIKDFQTQSLTGNSILAQFAGEDPVVALEAALQFEDTRESMHAFCVGQYLEPDQEIVTIPDLGSLSSPLIDTERNLGLLLGLHASYLAMSTPLSPVEIECAKWLQSSIFSGGLQTSQIHYSYNEEKDEDHCSSPGGTPASKSRLCSHRRALGDHSQAFLQAIADNNIQDHNVKDFLCQIERYCRQCHLTTPIMFPPEHPVEEVGRLLLCCLLKHEDLGHVALSLVHAGALGIEQVKHRTLPKSVVDVCRVVYQAKCSLIKTHQEQGRSYKEVCAPVIERLRFLFNELRPAVCNDLSIMSKFKLLSSLPRWRRIAQKIIRERRKKRVPKKPESTDDEEKIGNEESDLEEACILPHSPINVDKRPIAIKSPKDKWQPLLSTVTGVHKYKWLKQNVQGLYPQSPLLSTIAEFALKEEPVDVEKMRKCLLKQLERAEVRLEGIDTILKLASKNFLLPSVQYAMFCGWQRLIPEGIDIGEPLTDCLKDVDLIPPFNRMLLEVTFGKLYAWAVQNIRNVLMDASAKFKELGIQPVPLQTITNENPSGPSLGTIPQARFLLVMLSMLTLQHGANNLDLLLNSGMLALTQTALRLIGPSCDNVEEDMNASAQGASATVLEETRKETAPVQLPVSGPELAAMMKIGTRVMRGVDWKWGDQDGPPPGLGRVIGELGEDGWIRVQWDTGSTNSYRMGKEGKYDLKLAELPAAAQPSAEDSDTEDDSEAEQTERNIHPTAMMFTSTINLLQTLCLSAGVHAEIMQSEATKTLCGLLRMLVESGTTDKTSSPNRLVYREQHRSWCTLGFVRSIALTPQVCGALSSPQWITLLMKVVEGHAPFTATSLQRQILAVHLLQAVLPSWDKTERARDMKCLVEKLFDFLGSLLTTCSSDVPLLRESTLRRRRVRPQASLTATHSSTLAEEVVALLRTLHSLTQWNGLINKYINSQLRSITHSFVGRPSEGAQLEDYFPDSENPEVGGLMAVLAVIGGIDGRLRLGGQVMHDEFGEGTVTRITPKGKITVQFSDMRTCRVCPLNQLKPLPAVAFNVNNLPFTEPMLSVWAQLVNLAGSKLEKHKIKKSTKQAFAGQVDLDLLRCQQLKLYILKAGRALLSHQDKLRQILSQPAVQETGTVHTDDGAVVSPDLGDMSPEGPQPPMILLQQLLASATQPSPVKAIFDKQELEAAALAVCQCLAVESTHPSSPGFEDCSSSEATTPVAVQHIRPARVKRRKQSPVPALPIVVQLMEMGFSRRNIEFALKSLTGASGNASSLPGVEALVGWLLDHSDIQVTELSDADTVSDEYSDEEVVEDVDDAAYSMSTGAVVTESQTYKKRADFLSNDDYAVYVRENIQVGMMVRCCRAYEEVCEGDVGKVIKLDRDGLHDLNVQCDWQQKGGTYWVRYIHVELIGYPPPSSSSHIKIGDKVRVKASVTTPKYKWGSVTHQSVGVVKAFSANGKDIIVDFPQQSHWTGLLSEMELVPSIHPGVTCDGCQMFPINGSRFKCRNCDDFDFCETCFKTKKHNTRHTFGRINEPGQSAVFCGRSGKQLKRCHSSQPGMLLDSWSRMVKSLNVSSSVNQASRLIDGSEPCWQSSGSQGKHWIRLEIFPDVLVHRLKMIVDPADSSYMPSLVVVSGGNSLNNLIELKTININPSDTTVPLLNDCTEYHRYIEIAIKQCRSSGIDCKIHGLILLGRIRAEEEDLAAVPFLASDNEEEEDEKGNSGSLIRKKAAGLESAATIRTKVFVWGLNDKDQLGGLKGSKIKVPSFSETLSALNVVQVAGGSKSLFAVTVEGKVYACGEATNGRLGLGISSGTVPIPRQITALSSYVVKKVAVHSGGRHATALTVDGKVFSWGEGDDGKLGHFSRMNCDKPRLIEALKTKRIRDIACGSSHSAALTSSGELYTWGLGEYGRLGHGDNTTQLKPKMVKVLLGHRVIQVACGSRDAQTLALTDEGLVFSWGDGDFGKLGRGGSEGCNIPQNIERLNGQGVCQIECGAQFSLALTKSGVVWTWGKGDYFRLGHGSDVHVRKPQVVEGLRGKKIVHVAVGALHCLAVTDSGQVYAWGDNDHGQQGNGTTTVNRKPTLVQGLEGQKITRVACGSSHSVAWTTVDVATPSVHEPVLFQTARDPLGASYLGVPSDADSSAASNKISGASNSKPNRPSLAKILLSLDGNLAKQQALSHILTALQIMYARDAVVGALMPAAMIAPVECPSFSSAAPSDASAMASPMNGEECMLAVDIEDRLSPNPWQEKREIVSSEDAVTPSAVTPSAPSASARPFIPVTDDLGAASIIAETMTKTKEDVESQNKAAGPEPQALDEFTSLLIADDTRVVVDLLKLSVCSRAGDRGRDVLSAVLSGMGTAYPQVADMLLELCVTELEDVATDSQSGRLSSQPVVVESSHPYTDDTSTSGTVKIPGAEGLRVEFDRQCSTERRHDPLTVMDGVNRIVSVRSGREWSDWSSELRIPGDELKWKFISDGSVNGWGWRFTVYPIMPAAGPKELLSDRCVLSCPSMDLVTCLLDFRLNLASNRSIVPRLAASLAACAQLSALAASHRMWALQRLRKLLTTEFGQSININRLLGENDGETRALSFTGSALAALVKGLPEALQRQFEYEDPIVRGGKQLLHSPFFKVLVALACDLELDTLPCCAETHKWAWFRRYCMASRVAVALDKRTPLPRLFLDEVAKKIRELMADSENMDVLHESHDIFKREQDEQLVQWMNRRPDDWTLSAGGSGTIYGWGHNHRGQLGGIEGAKVKVPTPCEALATLRPVQLIGGEQTLFAVTADGKLYATGYGAGGRLGIGGTESVSTPTLLESIQHVFIKKVAVNSGGKHCLALSSEGEVYSWGEAEDGKLGHGNRSPCDRPRVIESLRGIEVVDVAAGGAHSACVTAAGDLYTWGKGRYGRLGHSDSEDQLKPKLVEALQGHRVVDIACGSGDAQTLCLTDDDTVWSWGDGDYGKLGRGGSDGCKVPMKIDSLTGLGVVKVECGSQFSVALTKSGAVYTWGKGDYHRLGHGSDDHVRRPRQVQGLQGKKVIAIATGSLHCVCCTEDGEVYTWGDNDEGQLGDGTTNAIQRPRLVAALQGKKVNRVACGSAHTLAWSTSKPASAGKLPAQVPMEYNHLQEIPIIALRNRLLLLHHLSELFCPCIPMFDLEGSLDETGLGPSVGFDTLRGILISQGKEAAFRKVVQATMVRDRQHGPVVELNRIQVKRSRSKGGLAGPDGTKSVFGQMCAKMSSFGPDSLLLPHRVWKVKFVGESVDDCGGGYSESIAEICEELQNGLTPLLIVTPNGRDESGANRDCYLLSPAARAPVHSSMFRFLGVLLGIAIRTGSPLSLNLAEPVWKQLAGMSLTIADLSEVDKDFIPGLMYIRDNEATSEEFEAMSLPFTVPSASGQDIQLSSKHTHITLDNRAEYVRLAINYRLHEFDEQVAAVREGMARVVPVPLLSLFTGYELETMVCGSPDIPLHLLKSVATYKGIEPSASLIQWFWEVMESFSNTERSLFLRFVWGRTRLPRTIADFRGRDFVIQVLDKYNPPDHFLPESYTCFFLLKLPRYSCKQVLEEKLKYAIHFCKSIDTDDYARIALTGEPAADDSSDDSDNEDVDSFASDSTQDYLTGH", "length": 4834, "header": "sp|O95714-1|HERC2_HUMAN Isoform 1 of E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2 CANONICAL=O95714-1" }, "locus": { "chromosome": "15", "start_pos": 28321433, "end_pos": 28111766, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000261609.13", "url": "https://www.ensembl.org/id/ENST00000261609.13" }, { "database": "Ensembl Peptide", "id": "ENSP00000261609.8", "url": "https://www.ensembl.org/id/ENSP00000261609.8" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1851, "start_aa": "Thr", "end_pos": 1851, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1851", "evidence": [ { "id": "O95714", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95714" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "O95714", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O95714" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 2790, "start_aa": "Asn", "end_pos": 2790, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2790", "evidence": [ { "id": "1191", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1191" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 2790, "start_aa": "Asn", "end_pos": 2790, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2790", "evidence": [ { "id": "O95714", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 3475, "start_aa": "Ser", "end_pos": 3475, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser3475", "evidence": [ { "id": "O95714", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95714" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "O95714", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O95714" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 3487, "start_aa": "Ser", "end_pos": 3487, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser3487", "evidence": [ { "id": "O95714", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95714" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "O95714", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O95714" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3746, "start_aa": "Asn", "end_pos": 3746, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3746", "evidence": [ { "id": "1191", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1191" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 4182, "start_aa": "Ser", "end_pos": 4182, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser4182", "evidence": [ { "id": "O95714", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95714" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "O95714", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O95714" } ] } ], "phosphorylation": [ { "start_pos": 1577, "end_pos": 1577, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" }, { "database": "phospho.ELM", "id": "O95714", "url": "http://phospho.elm.eu.org/byAccession/O95714.html" }, { "database": "iPTMnet", "id": "O95714", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95714" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Ser1577" }, { "start_pos": 1588, "end_pos": 1588, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "O95714", "url": "http://phospho.elm.eu.org/byAccession/O95714.html" }, { "database": "iPTMnet", "id": "O95714", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95714" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Ser1588" }, { "start_pos": 1938, "end_pos": 1938, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95714", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95714" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "phospho.ELM", "id": "O95714", "url": "http://phospho.elm.eu.org/byAccession/O95714.html" } ], "site_lbl": "Ser1938" }, { "start_pos": 1942, "end_pos": 1942, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" }, { "database": "iPTMnet", "id": "O95714", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95714" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "phospho.ELM", "id": "O95714", "url": "http://phospho.elm.eu.org/byAccession/O95714.html" } ], "site_lbl": "Ser1942" }, { "start_pos": 1944, "end_pos": 1944, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "O95714", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95714" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "phospho.ELM", "id": "O95714", "url": "http://phospho.elm.eu.org/byAccession/O95714.html" } ], "site_lbl": "Thr1944" }, { "start_pos": 1948, "end_pos": 1948, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95714", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95714" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "O95714", "url": "http://phospho.elm.eu.org/byAccession/O95714.html" } ], "site_lbl": "Ser1948" }, { "start_pos": 2454, "end_pos": 2454, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "O95714", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95714" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "phospho.ELM", "id": "O95714", "url": "http://phospho.elm.eu.org/byAccession/O95714.html" } ], "site_lbl": "Ser2454" }, { "start_pos": 272, "end_pos": 272, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O95714", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95714" } ], "site_lbl": "Thr272" }, { "start_pos": 2928, "end_pos": 2928, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "O95714", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95714" }, { "database": "PubMed", "id": "17322306", "url": "https://glygen.org/publication/PubMed/17322306" }, { "database": "PubMed", "id": "18491316", "url": "https://glygen.org/publication/PubMed/18491316" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "phospho.ELM", "id": "O95714", "url": "http://phospho.elm.eu.org/byAccession/O95714.html" } ], "site_lbl": "Ser2928" }, { "start_pos": 2942, "end_pos": 2942, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95714", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95714" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "O95714", "url": "http://phospho.elm.eu.org/byAccession/O95714.html" } ], "site_lbl": "Ser2942" }, { "start_pos": 4687, "end_pos": 4687, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95714", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95714" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser4687" }, { "start_pos": 4690, "end_pos": 4690, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95714", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95714" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr4690" }, { "start_pos": 4710, "end_pos": 4710, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95714", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95714" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser4710" }, { "start_pos": 4810, "end_pos": 4810, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "iPTMnet", "id": "O95714", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95714" }, { "database": "phospho.ELM", "id": "O95714", "url": "http://phospho.elm.eu.org/byAccession/O95714.html" } ], "site_lbl": "Ser4810" }, { "start_pos": 4811, "end_pos": 4811, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "iPTMnet", "id": "O95714", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95714" }, { "database": "phospho.ELM", "id": "O95714", "url": "http://phospho.elm.eu.org/byAccession/O95714.html" } ], "site_lbl": "Ser4811" }, { "start_pos": 4814, "end_pos": 4814, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "iPTMnet", "id": "O95714", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95714" }, { "database": "phospho.ELM", "id": "O95714", "url": "http://phospho.elm.eu.org/byAccession/O95714.html" } ], "site_lbl": "Ser4814" }, { "start_pos": 4827, "end_pos": 4827, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" }, { "database": "PubMed", "id": "20023648", "url": "https://glygen.org/publication/PubMed/20023648" }, { "database": "iPTMnet", "id": "O95714", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95714" }, { "database": "PubMed", "id": "22508508", "url": "https://glygen.org/publication/PubMed/22508508" } ], "site_lbl": "Thr4827" }, { "start_pos": 647, "end_pos": 647, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "O95714", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95714" } ], "site_lbl": "Thr647" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Requirement of ATM-dependent phosphorylation of brca1 in the DNA damage response to double-strand breaks.", "journal": "Science (New York, N.Y.)", "date": "1999", "authors": "Cortez D, Wang Y, Qin J, Elledge SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "10550055", "url": "https://glygen.org/publication/PubMed/10550055" } ] }, { "title": "Geometry of a complex formed by double strand break repair proteins at a single DNA end: recruitment of DNA-PKcs induces inward translocation of Ku protein.", "journal": "Nucleic acids research", "date": "1999", "authors": "Yoo S, Dynan WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "10572166", "url": "https://glygen.org/publication/PubMed/10572166" } ] }, { "title": "Cell cycle regulation of PML modification and ND10 composition.", "journal": "Journal of cell science", "date": "1999", "authors": "Everett RD, Lomonte P, Sternsdorf T, van Driel R, Orr A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "10574707", "url": "https://glygen.org/publication/PubMed/10574707" } ] }, { "title": "Structure of the highly conserved HERC2 gene and of multiple partially duplicated paralogs in human.", "journal": "Genome Res.", "date": "2000", "authors": "Ji Y, Rebert N A, Joslin J M, Higgins M J, Schultz R A, Nicholls R D", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" } ], "reference": [ { "type": "PubMed", "id": "10720573", "url": "https://glygen.org/publication/PubMed/10720573" } ] }, { "title": "hCds1-mediated phosphorylation of BRCA1 regulates the DNA damage response.", "journal": "Nature", "date": "2000", "authors": "Lee JS, Collins KM, Brown AL, Lee CH, Chung JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "10724175", "url": "https://glygen.org/publication/PubMed/10724175" } ] }, { "title": "Ku recruits the XRCC4-ligase IV complex to DNA ends.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Nick McElhinny SA, Snowden CM, McCarville J, Ramsden DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "10757784", "url": "https://glygen.org/publication/PubMed/10757784" } ] }, { "title": "ATM phosphorylates p95/nbs1 in an S-phase checkpoint pathway.", "journal": "Nature", "date": "2000", "authors": "Lim DS, Kim ST, Xu B, Maser RS, Lin J, Petrini JH, Kastan MB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "10766245", "url": "https://glygen.org/publication/PubMed/10766245" } ] }, { "title": "ATM-dependent phosphorylation of nibrin in response to radiation exposure.", "journal": "Nature genetics", "date": "2000", "authors": "Gatei M, Young D, Cerosaletti KM, Desai-Mehta A, Spring K, Kozlov S, Lavin MF, Gatti RA, Concannon P, Khanna K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "10802669", "url": "https://glygen.org/publication/PubMed/10802669" } ] }, { "title": "Chk1 is an essential kinase that is regulated by Atr and required for the G(2)/M DNA damage checkpoint.", "journal": "Genes & development", "date": "2000", "authors": "Liu Q, Guntuku S, Cui XS, Matsuoka S, Cortez D, Tamai K, Luo G, Carattini-Rivera S, DeMayo F, Bradley A, Donehower LA, Elledge SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "10859164", "url": "https://glygen.org/publication/PubMed/10859164" } ] }, { "title": "Role for ATM in DNA damage-induced phosphorylation of BRCA1.", "journal": "Cancer research", "date": "2000", "authors": "Gatei M, Scott SP, Filippovitch I, Soronika N, Lavin MF, Weber B, Khanna KK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "10866324", "url": "https://glygen.org/publication/PubMed/10866324" } ] }, { "title": "A critical role for histone H2AX in recruitment of repair factors to nuclear foci after DNA damage.", "journal": "Current biology : CB", "date": "2000", "authors": "Paull TT, Rogakou EP, Yamazaki V, Kirchgessner CU, Gellert M, Bonner WM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "10959836", "url": "https://glygen.org/publication/PubMed/10959836" } ] }, { "title": "Ataxia telangiectasia-mutated phosphorylates Chk2 in vivo and in vitro.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Matsuoka S, Rotman G, Ogawa A, Shiloh Y, Tamai K, Elledge SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "10973490", "url": "https://glygen.org/publication/PubMed/10973490" } ] }, { "title": "Threonine 68 is required for radiation-induced phosphorylation and activation of Cds1.", "journal": "Nature cell biology", "date": "2000", "authors": "Melchionna R, Chen XB, Blasina A, McGowan CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "11025670", "url": "https://glygen.org/publication/PubMed/11025670" } ] }, { "title": "Two new proteases in the MHC class I processing pathway.", "journal": "Nature immunology", "date": "2000", "authors": "Stoltze L, Schirle M, Schwarz G, Schroter C, Thompson MW, Hersh LB, Kalbacher H, Stevanovic S, Rammensee HG, Schild H", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "11062501", "url": "https://glygen.org/publication/PubMed/11062501" } ] }, { "title": "Reconstitution of the strand invasion step of double-strand break repair using human Rad51 Rad52 and RPA proteins.", "journal": "Journal of molecular biology", "date": "2000", "authors": "McIlwraith MJ, Van Dyck E, Masson JY, Stasiak AZ, Stasiak A, West SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "11080452", "url": "https://glygen.org/publication/PubMed/11080452" } ] }, { "title": "Functional interactions between BRCA1 and the checkpoint kinase ATR during genotoxic stress.", "journal": "Genes & development", "date": "2000", "authors": "Tibbetts RS, Cortez D, Brumbaugh KM, Scully R, Livingston D, Elledge SJ, Abraham RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "11114888", "url": "https://glygen.org/publication/PubMed/11114888" } ] }, { "title": "Polarity of human replication protein A binding to DNA.", "journal": "Nucleic acids research", "date": "2001", "authors": "Kolpashchikov DM, Khodyreva SN, Khlimankov DY, Wold MS, Favre A, Lavrik OI", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "11139606", "url": "https://glygen.org/publication/PubMed/11139606" } ] }, { "title": "BACH1, a novel helicase-like protein, interacts directly with BRCA1 and contributes to its DNA repair function.", "journal": "Cell", "date": "2001", "authors": "Cantor SB, Bell DW, Ganesan S, Kass EM, Drapkin R, Grossman S, Wahrer DC, Sgroi DC, Lane WS, Haber DA, Livingston DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "11301010", "url": "https://glygen.org/publication/PubMed/11301010" } ] }, { "title": "26S proteasomes and immunoproteasomes produce mainly N-extended versions of an antigenic peptide.", "journal": "The EMBO journal", "date": "2001", "authors": "Cascio P, Hilton C, Kisselev AF, Rock KL, Goldberg AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "11350924", "url": "https://glygen.org/publication/PubMed/11350924" } ] }, { "title": "Homologous recombinational repair of DNA ensures mammalian chromosome stability.", "journal": "Mutation research", "date": "2001", "authors": "Thompson LH, Schild D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "11376695", "url": "https://glygen.org/publication/PubMed/11376695" } ] }, { "title": "The hCds1 (Chk2)-FHA domain is essential for a chain of phosphorylation events on hCds1 that is induced by ionizing radiation.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Lee CH, Chung JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "11390408", "url": "https://glygen.org/publication/PubMed/11390408" } ] }, { "title": "ATR-mediated checkpoint pathways regulate phosphorylation and activation of human Chk1.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Zhao H, Piwnica-Worms H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "11390642", "url": "https://glygen.org/publication/PubMed/11390642" } ] }, { "title": "Structure of the Ku heterodimer bound to DNA and its implications for double-strand break repair.", "journal": "Nature", "date": "2001", "authors": "Walker JR, Corpina RA, Goldberg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "11493912", "url": "https://glygen.org/publication/PubMed/11493912" } ] }, { "title": "ATM phosphorylates histone H2AX in response to DNA double-strand breaks.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Burma S, Chen BP, Murphy M, Kurimasa A, Chen DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "11571274", "url": "https://glygen.org/publication/PubMed/11571274" } ] }, { "title": "Structure of a BRCA1-BARD1 heterodimeric RING-RING complex.", "journal": "Nature structural biology", "date": "2001", "authors": "Brzovic PS, Rajagopal P, Hoyt DW, King MC, Klevit RE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "11573085", "url": "https://glygen.org/publication/PubMed/11573085" } ] }, { "title": "Computational approach for determining the spectrum of DNA damage induced by ionizing radiation.", "journal": "Radiation research", "date": "2001", "authors": "Nikjoo H, O'Neill P, Wilson WE, Goodhead DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "11604075", "url": "https://glygen.org/publication/PubMed/11604075" } ] }, { "title": "Crystal structure of an Xrcc4-DNA ligase IV complex.", "journal": "Nature structural biology", "date": "2001", "authors": "Sibanda BL, Critchlow SE, Begun J, Pei XY, Jackson SP, Blundell TL, Pellegrini L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "11702069", "url": "https://glygen.org/publication/PubMed/11702069" } ] }, { "title": "The nucleoporin RanBP2 has SUMO1 E3 ligase activity.", "journal": "Cell", "date": "2002", "authors": "Pichler A, Gast A, Seeler JS, Dejean A, Melchior F", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "11792325", "url": "https://glygen.org/publication/PubMed/11792325" } ] }, { "title": "Modification of the human thymine-DNA glycosylase by ubiquitin-like proteins facilitates enzymatic turnover.", "journal": "The EMBO journal", "date": "2002", "authors": "Hardeland U, Steinacher R, Jiricny J, Schar P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "11889051", "url": "https://glygen.org/publication/PubMed/11889051" } ] }, { "title": "Histone H2A variants H2AX and H2AZ.", "journal": "Current opinion in genetics & development", "date": "2002", "authors": "Redon C, Pilch D, Rogakou E, Sedelnikova O, Newrock K, Bonner W", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "11893489", "url": "https://glygen.org/publication/PubMed/11893489" } ] }, { "title": "Autoubiquitination of the BRCA1*BARD1 RING ubiquitin ligase.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Chen A, Kleiman FE, Manley JL, Ouchi T, Pan ZQ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "11927591", "url": "https://glygen.org/publication/PubMed/11927591" } ] }, { "title": "Genomic instability in mice lacking histone H2AX.", "journal": "Science (New York, N.Y.)", "date": "2002", "authors": "Celeste A, Petersen S, Romanienko PJ, Fernandez-Capetillo O, Chen HT, Sedelnikova OA, Reina-San-Martin B, Coppola V, Meffre E, Difilippantonio MJ, Redon C, Pilch DR, Olaru A, Eckhaus M, Camerini-Otero RD, Tessarollo L, Livak F, Manova K, Bonner WM, Nussenzweig MC, Nussenzweig A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "11934988", "url": "https://glygen.org/publication/PubMed/11934988" } ] }, { "title": "Hairpin opening and overhang processing by an Artemis/DNA-dependent protein kinase complex in nonhomologous end joining and V(D)J recombination.", "journal": "Cell", "date": "2002", "authors": "Ma Y, Pannicke U, Schwarz K, Lieber MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "11955432", "url": "https://glygen.org/publication/PubMed/11955432" } ] }, { "title": "Conversion of phosphoglycolate to phosphate termini on 3' overhangs of DNA double strand breaks by the human tyrosyl-DNA phosphodiesterase hTdp1.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Inamdar KV, Pouliot JJ, Zhou T, Lees-Miller SP, Rasouli-Nia A, Povirk LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "12023295", "url": "https://glygen.org/publication/PubMed/12023295" } ] }, { "title": "Association of DNA polymerase mu (pol mu) with Ku and ligase IV: role for pol mu in end-joining double-strand break repair.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Mahajan KN, Nick McElhinny SA, Mitchell BS, Ramsden DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "12077346", "url": "https://glygen.org/publication/PubMed/12077346" } ] }, { "title": "The Rad50 zinc-hook is a structure joining Mre11 complexes in DNA recombination and repair.", "journal": "Nature", "date": "2002", "authors": "Hopfner KP, Craig L, Moncalian G, Zinkel RA, Usui T, Owen BA, Karcher A, Henderson B, Bodmer JL, McMurray CT, Carney JP, Petrini JH, Tainer JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "12152085", "url": "https://glygen.org/publication/PubMed/12152085" } ] }, { "title": "Identification of in vitro and in vivo phosphorylation sites in the catalytic subunit of the DNA-dependent protein kinase.", "journal": "The Biochemical journal", "date": "2002", "authors": "Douglas P, Sapkota GP, Morrice N, Yu Y, Goodarzi AA, Merkle D, Meek K, Alessi DR, Lees-Miller SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "12186630", "url": "https://glygen.org/publication/PubMed/12186630" } ] }, { "title": "Autophosphorylation of the DNA-dependent protein kinase catalytic subunit is required for rejoining of DNA double-strand breaks.", "journal": "Genes & development", "date": "2002", "authors": "Chan DW, Chen BP, Prithivirajsingh S, Kurimasa A, Story MD, Qin J, Chen DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "12231622", "url": "https://glygen.org/publication/PubMed/12231622" } ] }, { "title": "53BP1, a mediator of the DNA damage checkpoint.", "journal": "Science (New York, N.Y.)", "date": "2002", "authors": "Wang B, Matsuoka S, Carpenter PB, Elledge SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "12364621", "url": "https://glygen.org/publication/PubMed/12364621" } ] }, { "title": "DNA damage-induced G2-M checkpoint activation by histone H2AX and 53BP1.", "journal": "Nature cell biology", "date": "2002", "authors": "Fernandez-Capetillo O, Chen HT, Celeste A, Ward I, Romanienko PJ, Morales JC, Naka K, Xia Z, Camerini-Otero RD, Motoyama N, Carpenter PB, Bonner WM, Chen J, Nussenzweig A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "12447390", "url": "https://glygen.org/publication/PubMed/12447390" } ] }, { "title": "Activation of the E3 ligase function of the BRCA1/BARD1 complex by polyubiquitin chains.", "journal": "The EMBO journal", "date": "2002", "authors": "Mallery DL, Vandenberg CJ, Hiom K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "12485996", "url": "https://glygen.org/publication/PubMed/12485996" } ] }, { "title": "Defining interactions between DNA-PK and ligase IV/XRCC4.", "journal": "DNA repair", "date": "2002", "authors": "Hsu HL, Yannone SM, Chen DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "12509254", "url": "https://glygen.org/publication/PubMed/12509254" } ] }, { "title": "Repeated phosphopeptide motifs in Claspin mediate the regulated binding of Chk1.", "journal": "Nature cell biology", "date": "2003", "authors": "Kumagai A, Dunphy WG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "12545175", "url": "https://glygen.org/publication/PubMed/12545175" } ] }, { "title": "Loading of the human 9-1-1 checkpoint complex onto DNA by the checkpoint clamp loader hRad17-replication factor C complex in vitro.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Bermudez VP, Lindsey-Boltz LA, Cesare AJ, Maniwa Y, Griffith JD, Hurwitz J, Sancar A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "12578958", "url": "https://glygen.org/publication/PubMed/12578958" } ] }, { "title": "MDC1 is required for the intra-S-phase DNA damage checkpoint.", "journal": "Nature", "date": "2003", "authors": "Goldberg M, Stucki M, Falck J, D'Amours D, Rahman D, Pappin D, Bartek J, Jackson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "12607003", "url": "https://glygen.org/publication/PubMed/12607003" } ] }, { "title": "MDC1 is a mediator of the mammalian DNA damage checkpoint.", "journal": "Nature", "date": "2003", "authors": "Stewart GS, Wang B, Bignell CR, Taylor AM, Elledge SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "12607005", "url": "https://glygen.org/publication/PubMed/12607005" } ] }, { "title": "U-box proteins as a new family of ubiquitin ligases.", "journal": "Biochemical and biophysical research communications", "date": "2003", "authors": "Hatakeyama S, Nakayama KI", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "12646216", "url": "https://glygen.org/publication/PubMed/12646216" } ] }, { "title": "Accumulation of checkpoint protein 53BP1 at DNA breaks involves its binding to phosphorylated histone H2AX.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Ward IM, Minn K, Jorda KG, Chen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "12697768", "url": "https://glygen.org/publication/PubMed/12697768" } ] }, { "title": "A subset of ATM- and ATR-dependent phosphorylation events requires the BRCA1 protein.", "journal": "The EMBO journal", "date": "2003", "authors": "Foray N, Marot D, Gabriel A, Randrianarison V, Carr AM, Perricaudet M, Ashworth A, Jeggo P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "12773400", "url": "https://glygen.org/publication/PubMed/12773400" } ] }, { "title": "Sensing DNA damage through ATRIP recognition of RPA-ssDNA complexes.", "journal": "Science (New York, N.Y.)", "date": "2003", "authors": "Zou L, Elledge SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "12791985", "url": "https://glygen.org/publication/PubMed/12791985" } ] }, { "title": "Histone H2AX phosphorylation is dispensable for the initial recognition of DNA breaks.", "journal": "Nature cell biology", "date": "2003", "authors": "Celeste A, Fernandez-Capetillo O, Kruhlak MJ, Pilch DR, Staudt DW, Lee A, Bonner RF, Bonner WM, Nussenzweig A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "12792649", "url": "https://glygen.org/publication/PubMed/12792649" } ] }, { "title": "Loss of Bard1, the heterodimeric partner of the Brca1 tumor suppressor, results in early embryonic lethality and chromosomal instability.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "McCarthy EE, Celebi JT, Baer R, Ludwig T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "12832489", "url": "https://glygen.org/publication/PubMed/12832489" } ] }, { "title": "The BRCA1/BARD1 heterodimer assembles polyubiquitin chains through an unconventional linkage involving lysine residue K6 of ubiquitin.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Wu-Baer F, Lagrazon K, Yuan W, Baer R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "12890688", "url": "https://glygen.org/publication/PubMed/12890688" } ] }, { "title": "Autophosphorylation of the catalytic subunit of the DNA-dependent protein kinase is required for efficient end processing during DNA double-strand break repair.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Ding Q, Reddy YV, Wang W, Woods T, Douglas P, Ramsden DA, Lees-Miller SP, Meek K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "12897153", "url": "https://glygen.org/publication/PubMed/12897153" } ] }, { "title": "Regulation and mechanisms of mammalian double-strand break repair.", "journal": "Oncogene", "date": "2003", "authors": "Valerie K, Povirk LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "12947387", "url": "https://glygen.org/publication/PubMed/12947387" } ] }, { "title": "BARD1 participates with BRCA1 in homology-directed repair of chromosome breaks.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Westermark UK, Reyngold M, Olshen AB, Baer R, Jasin M, Moynahan ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "14560035", "url": "https://glygen.org/publication/PubMed/14560035" } ] }, { "title": "Implication of DNA polymerase lambda in alignment-based gap filling for nonhomologous DNA end joining in human nuclear extracts.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Lee JW, Blanco L, Zhou T, Garcia-Diaz M, Bebenek K, Kunkel TA, Wang Z, Povirk LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "14561766", "url": "https://glygen.org/publication/PubMed/14561766" } ] }, { "title": "The BRCT domain is a phospho-protein binding domain.", "journal": "Science (New York, N.Y.)", "date": "2003", "authors": "Yu X, Chini CC, He M, Mer G, Chen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "14576433", "url": "https://glygen.org/publication/PubMed/14576433" } ] }, { "title": "Proteasome and peptidase function in MHC-class-I-mediated antigen presentation.", "journal": "Current opinion in immunology", "date": "2004", "authors": "Kloetzel PM, Ossendorp F", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "14734113", "url": "https://glygen.org/publication/PubMed/14734113" } ] }, { "title": "Direct activation of the ATM protein kinase by the Mre11/Rad50/Nbs1 complex.", "journal": "Science (New York, N.Y.)", "date": "2004", "authors": "Lee JH, Paull TT", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "15064416", "url": "https://glygen.org/publication/PubMed/15064416" } ] }, { "title": "A proteomic study of SUMO-2 target proteins.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Vertegaal AC, Ogg SC, Jaffray E, Rodriguez MS, Hay RT, Andersen JS, Mann M, Lamond AI", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "15175327", "url": "https://glygen.org/publication/PubMed/15175327" } ] }, { "title": "Identification of DNA-PKcs phosphorylation sites in XRCC4 and effects of mutations at these sites on DNA end joining in a cell-free system.", "journal": "DNA repair", "date": "2004", "authors": "Lee KJ, Jovanovic M, Udayakumar D, Bladen CL, Dynan WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "15177042", "url": "https://glygen.org/publication/PubMed/15177042" } ] }, { "title": "Molecular mechanisms of mammalian DNA repair and the DNA damage checkpoints.", "journal": "Annual review of biochemistry", "date": "2004", "authors": "Sancar A, Lindsey-Boltz LA, Unsal-Kacmaz K, Linn S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "15189136", "url": "https://glygen.org/publication/PubMed/15189136" } ] }, { "title": "ATR, Claspin and the Rad9-Rad1-Hus1 complex regulate Chk1 and Cdc25A in the absence of DNA damage.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2004", "authors": "Sorensen CS, Syljuasen RG, Lukas J, Bartek J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "15190204", "url": "https://glygen.org/publication/PubMed/15190204" } ] }, { "title": "Mdc1 couples DNA double-strand break recognition by Nbs1 with its H2AX-dependent chromatin retention.", "journal": "The EMBO journal", "date": "2004", "authors": "Lukas C, Melander F, Stucki M, Falck J, Bekker-Jensen S, Goldberg M, Lerenthal Y, Jackson SP, Bartek J, Lukas J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "15201865", "url": "https://glygen.org/publication/PubMed/15201865" } ] }, { "title": "Generation of major histocompatibility complex class I antigens: functional interplay between proteasomes and TPPII.", "journal": "Nature immunology", "date": "2004", "authors": "Kloetzel PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "15224091", "url": "https://glygen.org/publication/PubMed/15224091" } ] }, { "title": "Post-proteasomal antigen processing for major histocompatibility complex class I presentation.", "journal": "Nature immunology", "date": "2004", "authors": "Rock KL, York IA, Goldberg AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "15224092", "url": "https://glygen.org/publication/PubMed/15224092" } ] }, { "title": "H2AX: the histone guardian of the genome.", "journal": "DNA repair", "date": "2004", "authors": "Fernandez-Capetillo O, Lee A, Nussenzweig M, Nussenzweig A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "15279782", "url": "https://glygen.org/publication/PubMed/15279782" } ] }, { "title": "p14 Arf promotes small ubiquitin-like modifier conjugation of Werners helicase.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Woods YL, Xirodimas DP, Prescott AR, Sparks A, Lane DP, Saville MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "15355988", "url": "https://glygen.org/publication/PubMed/15355988" } ] }, { "title": "DNA polymerase lambda can elongate on DNA substrates mimicking non-homologous end joining and interact with XRCC4-ligase IV complex.", "journal": "Biochemical and biophysical research communications", "date": "2004", "authors": "Fan W, Wu X", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "15451442", "url": "https://glygen.org/publication/PubMed/15451442" } ] }, { "title": "Phosphorylation of Artemis following irradiation-induced DNA damage.", "journal": "European journal of immunology", "date": "2004", "authors": "Poinsignon C, de Chasseval R, Soubeyrand S, Moshous D, Fischer A, Hache RJ, de Villartay JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "15468306", "url": "https://glygen.org/publication/PubMed/15468306" } ] }, { "title": "The proteasome and MHC class I antigen processing.", "journal": "Biochimica et biophysica acta", "date": "2004", "authors": "Kloetzel PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "15571818", "url": "https://glygen.org/publication/PubMed/15571818" } ] }, { "title": "A pathway of double-strand break rejoining dependent upon ATM, Artemis, and proteins locating to gamma-H2AX foci.", "journal": "Molecular cell", "date": "2004", "authors": "Riballo E, Kuhne M, Rief N, Doherty A, Smith GC, Recio MJ, Reis C, Dahm K, Fricke A, Krempler A, Parker AR, Jackson SP, Gennery A, Jeggo PA, Lobrich M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "15574327", "url": "https://glygen.org/publication/PubMed/15574327" } ] }, { "title": "Unique binding interactions among Ubc9, SUMO and RanBP2 reveal a mechanism for SUMO paralog selection.", "journal": "Nature structural & molecular biology", "date": "2005", "authors": "Tatham MH, Kim S, Jaffray E, Song J, Chen Y, Hay RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "15608651", "url": "https://glygen.org/publication/PubMed/15608651" } ] }, { "title": "DNA-dependent phosphorylation of Chk1 and Claspin in a human cell-free system.", "journal": "The Biochemical journal", "date": "2005", "authors": "Clarke CA, Clarke PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "15707391", "url": "https://glygen.org/publication/PubMed/15707391" } ] }, { "title": "Ataxia-telangiectasia-mutated dependent phosphorylation of Artemis in response to DNA damage.", "journal": "Cancer science", "date": "2005", "authors": "Chen L, Morio T, Minegishi Y, Nakada S, Nagasawa M, Komatsu K, Chessa L, Villa A, Lecis D, Delia D, Mizutani S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "15723659", "url": "https://glygen.org/publication/PubMed/15723659" } ] }, { "title": "Functionality of human thymine DNA glycosylase requires SUMO-regulated changes in protein conformation.", "journal": "Current biology : CB", "date": "2005", "authors": "Steinacher R, Schar P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "15823533", "url": "https://glygen.org/publication/PubMed/15823533" } ] }, { "title": "Intra-nuclear trafficking of the BLM helicase to DNA damage-induced foci is regulated by SUMO modification.", "journal": "Human molecular genetics", "date": "2005", "authors": "Eladad S, Ye TZ, Hu P, Leversha M, Beresten S, Matunis MJ, Ellis NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "15829507", "url": "https://glygen.org/publication/PubMed/15829507" } ] }, { "title": "Stabilization of PML nuclear localization by conjugation and oligomerization of SUMO-3.", "journal": "Oncogene", "date": "2005", "authors": "Fu C, Ahmed K, Ding H, Ding X, Lan J, Yang Z, Miao Y, Zhu Y, Shi Y, Zhu J, Huang H, Yao X", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "15940266", "url": "https://glygen.org/publication/PubMed/15940266" } ] }, { "title": "Crystal structure of thymine DNA glycosylase conjugated to SUMO-1.", "journal": "Nature", "date": "2005", "authors": "Baba D, Maita N, Jee JG, Uchimura Y, Saitoh H, Sugasawa K, Hanaoka F, Tochio H, Hiroaki H, Shirakawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "15959518", "url": "https://glygen.org/publication/PubMed/15959518" } ] }, { "title": "DNA repair factor XPC is modified by SUMO-1 and ubiquitin following UV irradiation.", "journal": "Nucleic acids research", "date": "2005", "authors": "Wang QE, Zhu Q, Wani G, El-Mahdy MA, Li J, Wani AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "16030353", "url": "https://glygen.org/publication/PubMed/16030353" } ] }, { "title": "A gradient of template dependence defines distinct biological roles for family X polymerases in nonhomologous end joining.", "journal": "Molecular cell", "date": "2005", "authors": "Nick McElhinny SA, Havener JM, Garcia-Diaz M, Juarez R, Bebenek K, Kee BL, Blanco L, Kunkel TA, Ramsden DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "16061182", "url": "https://glygen.org/publication/PubMed/16061182" } ] }, { "title": "The DNA-dependent protein kinase catalytic subunit phosphorylation sites in human Artemis.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Ma Y, Pannicke U, Lu H, Niewolik D, Schwarz K, Lieber MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "16093244", "url": "https://glygen.org/publication/PubMed/16093244" } ] }, { "title": "Roles of replication fork-interacting and Chk1-activating domains from Claspin in a DNA replication checkpoint response.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Lee J, Gold DA, Shevchenko A, Shevchenko A, Dunphy WG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "16148040", "url": "https://glygen.org/publication/PubMed/16148040" } ] }, { "title": "DNA damage regulates Chk2 association with chromatin.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Li J, Stern DF", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "16150728", "url": "https://glygen.org/publication/PubMed/16150728" } ] }, { "title": "BACH1 is critical for homologous recombination and appears to be the Fanconi anemia gene product FANCJ.", "journal": "Cancer cell", "date": "2005", "authors": "Litman R, Peng M, Jin Z, Zhang F, Zhang J, Powell S, Andreassen PR, Cantor SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "16153896", "url": "https://glygen.org/publication/PubMed/16153896" } ] }, { "title": "ATM- and cell cycle-dependent regulation of ATR in response to DNA double-strand breaks.", "journal": "Nature cell biology", "date": "2006", "authors": "Jazayeri A, Falck J, Lukas C, Bartek J, Smith GC, Lukas J, Jackson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "16327781", "url": "https://glygen.org/publication/PubMed/16327781" } ] }, { "title": "Rapid PIKK-dependent release of Chk1 from chromatin promotes the DNA-damage checkpoint response.", "journal": "Current biology : CB", "date": "2006", "authors": "Smits VA, Reaper PM, Jackson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "16360315", "url": "https://glygen.org/publication/PubMed/16360315" } ] }, { "title": "MDC1 directly binds phosphorylated histone H2AX to regulate cellular responses to DNA double-strand breaks.", "journal": "Cell", "date": "2005", "authors": "Stucki M, Clapperton JA, Mohammad D, Yaffe MB, Smerdon SJ, Jackson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "16377563", "url": "https://glygen.org/publication/PubMed/16377563" } ] }, { "title": "MDC1 maintains genomic stability by participating in the amplification of ATM-dependent DNA damage signals.", "journal": "Molecular cell", "date": "2006", "authors": "Lou Z, Minter-Dykhouse K, Franco S, Gostissa M, Rivera MA, Celeste A, Manis JP, van Deursen J, Nussenzweig A, Paull TT, Alt FW, Chen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "16427009", "url": "https://glygen.org/publication/PubMed/16427009" } ] }, { "title": "Cernunnos, a novel nonhomologous end-joining factor, is mutated in human immunodeficiency with microcephaly.", "journal": "Cell", "date": "2006", "authors": "Buck D, Malivert L, de Chasseval R, Barraud A, Fondaneche MC, Sanal O, Plebani A, Stephan JL, Hufnagel M, le Deist F, Fischer A, Durandy A, de Villartay JP, Revy P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "16439204", "url": "https://glygen.org/publication/PubMed/16439204" } ] }, { "title": "XLF interacts with the XRCC4-DNA ligase IV complex to promote DNA nonhomologous end-joining.", "journal": "Cell", "date": "2006", "authors": "Ahnesorg P, Smith P, Jackson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "16439205", "url": "https://glygen.org/publication/PubMed/16439205" } ] }, { "title": "SUMO modification of human XRCC4 regulates its localization and function in DNA double-strand break repair.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Yurchenko V, Xue Z, Sadofsky MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "16478998", "url": "https://glygen.org/publication/PubMed/16478998" } ] }, { "title": "TopBP1 activates the ATR-ATRIP complex.", "journal": "Cell", "date": "2006", "authors": "Kumagai A, Lee J, Yoo HY, Dunphy WG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "16530042", "url": "https://glygen.org/publication/PubMed/16530042" } ] }, { "title": "Pleiotropic effects of ATP.Mg2+ binding in the catalytic cycle of ubiquitin-activating enzyme.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Tokgoz Z, Bohnsack RN, Haas AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "16595681", "url": "https://glygen.org/publication/PubMed/16595681" } ] }, { "title": "Artemis phosphorylated by DNA-dependent protein kinase associates preferentially with discrete regions of chromatin.", "journal": "Journal of molecular biology", "date": "2006", "authors": "Soubeyrand S, Pope L, De Chasseval R, Gosselin D, Dong F, de Villartay JP, Hache RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "16600297", "url": "https://glygen.org/publication/PubMed/16600297" } ] }, { "title": "Characterization of a family of nucleolar SUMO-specific proteases with preference for SUMO-2 or SUMO-3.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Gong L, Yeh ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "16608850", "url": "https://glygen.org/publication/PubMed/16608850" } ] }, { "title": "Crystal structure of SUMO-3-modified thymine-DNA glycosylase.", "journal": "Journal of molecular biology", "date": "2006", "authors": "Baba D, Maita N, Jee JG, Uchimura Y, Saitoh H, Sugasawa K, Hanaoka F, Tochio H, Hiroaki H, Shirakawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "16626738", "url": "https://glygen.org/publication/PubMed/16626738" } ] }, { "title": "DNA damage-induced BARD1 phosphorylation is critical for the inhibition of messenger RNA processing by BRCA1/BARD1 complex.", "journal": "Cancer research", "date": "2006", "authors": "Kim HS, Li H, Cevher M, Parmelee A, Fonseca D, Kleiman FE, Lee SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "16651405", "url": "https://glygen.org/publication/PubMed/16651405" } ] }, { "title": "In situ SUMOylation analysis reveals a modulatory role of RanBP2 in the nuclear rim and PML bodies.", "journal": "Experimental cell research", "date": "2006", "authors": "Saitoh N, Uchimura Y, Tachibana T, Sugahara S, Saitoh H, Nakao M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "16688858", "url": "https://glygen.org/publication/PubMed/16688858" } ] }, { "title": "Human SMC5/6 complex promotes sister chromatid homologous recombination by recruiting the SMC1/3 cohesin complex to double-strand breaks.", "journal": "The EMBO journal", "date": "2006", "authors": "Potts PR, Porteus MH, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "16810316", "url": "https://glygen.org/publication/PubMed/16810316" } ] }, { "title": "Tripeptidyl peptidase II is the major peptidase needed to trim long antigenic precursors, but is not required for most MHC class I antigen presentation.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2006", "authors": "York IA, Bhutani N, Zendzian S, Goldberg AL, Rock KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "16849449", "url": "https://glygen.org/publication/PubMed/16849449" } ] }, { "title": "DNA-PK autophosphorylation facilitates Artemis endonuclease activity.", "journal": "The EMBO journal", "date": "2006", "authors": "Goodarzi AA, Yu Y, Riballo E, Douglas P, Walker SA, Ye R, Harer C, Marchetti C, Morrice N, Jeggo PA, Lees-Miller SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "16874298", "url": "https://glygen.org/publication/PubMed/16874298" } ] }, { "title": "Rad17 phosphorylation is required for claspin recruitment and Chk1 activation in response to replication stress.", "journal": "Molecular cell", "date": "2006", "authors": "Wang X, Zou L, Lu T, Bao S, Hurov KE, Hittelman WN, Elledge SJ, Li L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "16885023", "url": "https://glygen.org/publication/PubMed/16885023" } ] }, { "title": "DNA-PKcs dependence of Artemis endonucleolytic activity, differences between hairpins and 5' or 3' overhangs.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Niewolik D, Pannicke U, Lu H, Ma Y, Wang LC, Kulesza P, Zandi E, Lieber MR, Schwarz K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "16914548", "url": "https://glygen.org/publication/PubMed/16914548" } ] }, { "title": "A novel family of membrane-bound E3 ubiquitin ligases.", "journal": "Journal of biochemistry", "date": "2006", "authors": "Ohmura-Hoshino M, Goto E, Matsuki Y, Aoki M, Mito M, Uematsu M, Hotta H, Ishido S", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "16954532", "url": "https://glygen.org/publication/PubMed/16954532" } ] }, { "title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.", "journal": "Cell", "date": "2006", "authors": "Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" }, { "database": "iPTMnet", "id": "O95714", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95714" } ], "reference": [ { "type": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ] }, { "title": "XRCC4:DNA ligase IV can ligate incompatible DNA ends and can ligate across gaps.", "journal": "The EMBO journal", "date": "2007", "authors": "Gu J, Lu H, Tippin B, Shimazaki N, Goodman MF, Lieber MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "17290226", "url": "https://glygen.org/publication/PubMed/17290226" } ] }, { "title": "Phosphopeptide enrichment by aliphatic hydroxy acid-modified metal oxide chromatography for nano-LC-MS/MS in proteomics applications.", "journal": "Molecular & cellular proteomics : MCP", "date": "2007", "authors": "Sugiyama N, Masuda T, Shinoda K, Nakamura A, Tomita M, Ishihama Y", "evidence": [ { "database": "iPTMnet", "id": "O95714", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95714" } ], "reference": [ { "type": "PubMed", "id": "17322306", "url": "https://glygen.org/publication/PubMed/17322306" } ] }, { "title": "Cernunnos/XLF promotes the ligation of mismatched and noncohesive DNA ends.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Tsai CJ, Kim SA, Chu G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "17470781", "url": "https://glygen.org/publication/PubMed/17470781" } ] }, { "title": "ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "17525332", "url": "https://glygen.org/publication/PubMed/17525332" } ] }, { "title": "Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Wang B, Matsuoka S, Ballif BA, Zhang D, Smogorzewska A, Gygi SP, Elledge SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "17525340", "url": "https://glygen.org/publication/PubMed/17525340" } ] }, { "title": "Characterisation of the sites of DNA damage-induced 53BP1 phosphorylation catalysed by ATM and ATR.", "journal": "DNA repair", "date": "2007", "authors": "Jowsey P, Morrice NA, Hastie CJ, McLauchlan H, Toth R, Rouse J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "17553757", "url": "https://glygen.org/publication/PubMed/17553757" } ] }, { "title": "The Rad9-Hus1-Rad1 (9-1-1) clamp activates checkpoint signaling via TopBP1.", "journal": "Genes & development", "date": "2007", "authors": "Delacroix S, Wagner JM, Kobayashi M, Yamamoto K, Karnitz LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "17575048", "url": "https://glygen.org/publication/PubMed/17575048" } ] }, { "title": "Ubiquitylation-independent degradation of Xeroderma pigmentosum group C protein is required for efficient nucleotide excision repair.", "journal": "Nucleic acids research", "date": "2007", "authors": "Wang QE, Praetorius-Ibba M, Zhu Q, El-Mahdy MA, Wani G, Zhao Q, Qin S, Patnaik S, Wani AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "17693435", "url": "https://glygen.org/publication/PubMed/17693435" } ] }, { "title": "Structural requirements for the BARD1 tumor suppressor in chromosomal stability and homology-directed DNA repair.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Laufer M, Nandula SV, Modi AP, Wang S, Jasin M, Murty VV, Ludwig T, Baer R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "17848578", "url": "https://glygen.org/publication/PubMed/17848578" } ] }, { "title": "Sequential and synergistic modification of human RPA stimulates chromosomal DNA repair.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Anantha RW, Vassin VM, Borowiec JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "17928296", "url": "https://glygen.org/publication/PubMed/17928296" } ] }, { "title": "Human CtIP promotes DNA end resection.", "journal": "Nature", "date": "2007", "authors": "Sartori AA, Lukas C, Coates J, Mistrik M, Fu S, Bartek J, Baer R, Lukas J, Jackson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "17965729", "url": "https://glygen.org/publication/PubMed/17965729" } ] }, { "title": "RNF8 ubiquitylates histones at DNA double-strand breaks and promotes assembly of repair proteins.", "journal": "Cell", "date": "2007", "authors": "Mailand N, Bekker-Jensen S, Faustrup H, Melander F, Bartek J, Lukas C, Lukas J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "18001824", "url": "https://glygen.org/publication/PubMed/18001824" } ] }, { "title": "RNF8 transduces the DNA-damage signal via histone ubiquitylation and checkpoint protein assembly.", "journal": "Cell", "date": "2007", "authors": "Huen MS, Grant R, Manke I, Minn K, Yu X, Yaffe MB, Chen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "18001825", "url": "https://glygen.org/publication/PubMed/18001825" } ] }, { "title": "Orchestration of the DNA-damage response by the RNF8 ubiquitin ligase.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Kolas NK, Chapman JR, Nakada S, Ylanko J, Chahwan R, Sweeney FD, Panier S, Mendez M, Wildenhain J, Thomson TM, Pelletier L, Jackson SP, Durocher D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "18006705", "url": "https://glygen.org/publication/PubMed/18006705" } ] }, { "title": "Crystal structure of human XLF/Cernunnos reveals unexpected differences from XRCC4 with implications for NHEJ.", "journal": "The EMBO journal", "date": "2008", "authors": "Li Y, Chirgadze DY, Bolanos-Garcia VM, Sibanda BL, Davies OR, Ahnesorg P, Jackson SP, Blundell TL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "18046455", "url": "https://glygen.org/publication/PubMed/18046455" } ] }, { "title": "Ubc13/Rnf8 ubiquitin ligases control foci formation of the Rap80/Abraxas/Brca1/Brcc36 complex in response to DNA damage.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Wang B, Elledge SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "18077395", "url": "https://glygen.org/publication/PubMed/18077395" } ] }, { "title": "Cell cycle-dependent complex formation of BRCA1.CtIP.MRN is important for DNA double-strand break repair.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Chen L, Nievera CJ, Lee AY, Wu X", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "18171670", "url": "https://glygen.org/publication/PubMed/18171670" } ] }, { "title": "Blue eye color in humans may be caused by a perfectly associated founder mutation in a regulatory element located within the HERC2 gene inhibiting OCA2 expression.", "journal": "Hum. Genet.", "date": "2008", "authors": "Eiberg Hans, Troelsen Jesper, Nielsen Mette, Mikkelsen Annemette, Mengel-From Jonas, Kjaer Klaus W, Hansen Lars", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" } ], "reference": [ { "type": "PubMed", "id": "18172690", "url": "https://glygen.org/publication/PubMed/18172690" } ] }, { "title": "Three genome-wide association studies and a linkage analysis identify HERC2 as a human iris color gene.", "journal": "Am. J. Hum. Genet.", "date": "2008", "authors": "Kayser Manfred, Liu Fan, Janssens A Cecile J W, Rivadeneira Fernando, Lao Oscar, van Duijn Kate, Vermeulen Mark, Arp Pascal, Jhamai Mila M, van Ijcken Wilfred F J, den Dunnen Johan T, Heath Simon, Zelenika Diana, Despriet Dominiek D G, Klaver Caroline C W, Vingerling Johannes R, de Jong Paulus T V M, Hofman Albert, Aulchenko Yurii S, Uitterlinden Andre G, Oostra Ben A, van Duijn Cornelia M", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" } ], "reference": [ { "type": "PubMed", "id": "18252221", "url": "https://glygen.org/publication/PubMed/18252221" } ] }, { "title": "A single SNP in an evolutionary conserved region within intron 86 of the HERC2 gene determines human blue-brown eye color.", "journal": "Am. J. Hum. Genet.", "date": "2008", "authors": "Sturm RA, Duffy DL, Zhao ZZ, Leite FP, Stark MS, Hayward NK, Martin NG, Montgomery GW", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" } ], "reference": [ { "type": "PubMed", "id": "18252222", "url": "https://glygen.org/publication/PubMed/18252222" } ] }, { "title": "End-bridging is required for pol mu to efficiently promote repair of noncomplementary ends by nonhomologous end joining.", "journal": "Nucleic acids research", "date": "2008", "authors": "Davis BJ, Havener JM, Ramsden DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "18397950", "url": "https://glygen.org/publication/PubMed/18397950" } ] }, { "title": "The basal-like mammary carcinomas induced by Brca1 or Bard1 inactivation implicate the BRCA1/BARD1 heterodimer in tumor suppression.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Shakya R, Szabolcs M, McCarthy E, Ospina E, Basso K, Nandula S, Murty V, Baer R, Ludwig T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "18443292", "url": "https://glygen.org/publication/PubMed/18443292" } ] }, { "title": "Phosphoproteome analysis of the human Chang liver cells using SCX and a complementary mass spectrometric strategy.", "journal": "Proteomics", "date": "2008", "authors": "Sui S, Wang J, Yang B, Song L, Zhang J, Chen M, Liu J, Lu Z, Cai Y, Chen S, Bi W, Zhu Y, He F, Qian X", "evidence": [ { "database": "iPTMnet", "id": "O95714", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95714" } ], "reference": [ { "type": "PubMed", "id": "18491316", "url": "https://glygen.org/publication/PubMed/18491316" } ] }, { "title": "Histone deacetylase 7 promotes PML sumoylation and is essential for PML nuclear body formation.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Gao C, Ho CC, Reineke E, Lam M, Cheng X, Stanya KJ, Liu Y, Chakraborty S, Shih HM, Kao HY", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "18625722", "url": "https://glygen.org/publication/PubMed/18625722" } ] }, { "title": "Regulation of Chk2 ubiquitination and signaling through autophosphorylation of serine 379.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Lovly CM, Yan L, Ryan CE, Takada S, Piwnica-Worms H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "18644861", "url": "https://glygen.org/publication/PubMed/18644861" } ] }, { "title": "Structural insights into E1-catalyzed ubiquitin activation and transfer to conjugating enzymes.", "journal": "Cell", "date": "2008", "authors": "Lee I, Schindelin H", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "18662542", "url": "https://glygen.org/publication/PubMed/18662542" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" }, { "database": "iPTMnet", "id": "O95714", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95714" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Ubc9 sumoylation regulates SUMO target discrimination.", "journal": "Molecular cell", "date": "2008", "authors": "Knipscheer P, Flotho A, Klug H, Olsen JV, van Dijk WJ, Fish A, Johnson ES, Mann M, Sixma TK, Pichler A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "18691969", "url": "https://glygen.org/publication/PubMed/18691969" } ] }, { "title": "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.", "journal": "Molecular cell", "date": "2008", "authors": "Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O95714", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95714" } ], "reference": [ { "type": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ] }, { "title": "Small ubiquitin-related modifier (SUMO) binding determines substrate recognition and paralog-selective SUMO modification.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Zhu J, Zhu S, Guzzo CM, Ellis NA, Sung KS, Choi CY, Matunis MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "18708356", "url": "https://glygen.org/publication/PubMed/18708356" } ] }, { "title": "Sgs1 helicase and two nucleases Dna2 and Exo1 resect DNA double-strand break ends.", "journal": "Cell", "date": "2008", "authors": "Zhu Z, Chung WH, Shim EY, Lee SE, Ira G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "18805091", "url": "https://glygen.org/publication/PubMed/18805091" } ] }, { "title": "DNA helicases Sgs1 and BLM promote DNA double-strand break resection.", "journal": "Genes & development", "date": "2008", "authors": "Gravel S, Chapman JR, Magill C, Jackson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "18923075", "url": "https://glygen.org/publication/PubMed/18923075" } ] }, { "title": "Human exonuclease 1 and BLM helicase interact to resect DNA and initiate DNA repair.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Nimonkar AV, Ozsoy AZ, Genschel J, Modrich P, Kowalczykowski SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "18971343", "url": "https://glygen.org/publication/PubMed/18971343" } ] }, { "title": "NFBD1/MDC1, 53BP1 and BRCA1 have both redundant and unique roles in the ATM pathway.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2008", "authors": "Wilson KA, Stern DF", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "19001859", "url": "https://glygen.org/publication/PubMed/19001859" } ] }, { "title": "Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.", "journal": "The international journal of biochemistry & cell biology", "date": "2009", "authors": "Ebstein F, Lange N, Urban S, Seifert U, Kruger E, Kloetzel PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "19028597", "url": "https://glygen.org/publication/PubMed/19028597" } ] }, { "title": "WSTF regulates the H2A.X DNA damage response via a novel tyrosine kinase activity.", "journal": "Nature", "date": "2009", "authors": "Xiao A, Li H, Shechter D, Ahn SH, Fabrizio LA, Erdjument-Bromage H, Ishibe-Murakami S, Wang B, Tempst P, Hofmann K, Patel DJ, Elledge SJ, Allis CD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "19092802", "url": "https://glygen.org/publication/PubMed/19092802" } ] }, { "title": "BRCA1-associated protein 1 interferes with BRCA1/BARD1 RING heterodimer activity.", "journal": "Cancer research", "date": "2009", "authors": "Nishikawa H, Wu W, Koike A, Kojima R, Gomi H, Fukuda M, Ohta T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "19117993", "url": "https://glygen.org/publication/PubMed/19117993" } ] }, { "title": "Protein phosphatase 5 regulates the function of 53BP1 after neocarzinostatin-induced DNA damage.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Kang Y, Lee JH, Hoan NN, Sohn HM, Chang IY, You HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "19176521", "url": "https://glygen.org/publication/PubMed/19176521" } ] }, { "title": "The RIDDLE syndrome protein mediates a ubiquitin-dependent signaling cascade at sites of DNA damage.", "journal": "Cell", "date": "2009", "authors": "Stewart GS, Panier S, Townsend K, Al-Hakim AK, Kolas NK, Miller ES, Nakada S, Ylanko J, Olivarius S, Mendez M, Oldreive C, Wildenhain J, Tagliaferro A, Pelletier L, Taubenheim N, Durandy A, Byrd PJ, Stankovic T, Taylor AM, Durocher D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "19203578", "url": "https://glygen.org/publication/PubMed/19203578" } ] }, { "title": "RNF168 binds and amplifies ubiquitin conjugates on damaged chromosomes to allow accumulation of repair proteins.", "journal": "Cell", "date": "2009", "authors": "Doil C, Mailand N, Bekker-Jensen S, Menard P, Larsen DH, Pepperkok R, Ellenberg J, Panier S, Durocher D, Bartek J, Lukas J, Lukas C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "19203579", "url": "https://glygen.org/publication/PubMed/19203579" } ] }, { "title": "Tyrosine dephosphorylation of H2AX modulates apoptosis and survival decisions.", "journal": "Nature", "date": "2009", "authors": "Cook PJ, Ju BG, Telese F, Wang X, Glass CK, Rosenfeld MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "19234442", "url": "https://glygen.org/publication/PubMed/19234442" } ] }, { "title": "NBA1, a new player in the Brca1 A complex, is required for DNA damage resistance and checkpoint control.", "journal": "Genes & development", "date": "2009", "authors": "Wang B, Hurov K, Hofmann K, Elledge SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "19261749", "url": "https://glygen.org/publication/PubMed/19261749" } ] }, { "title": "A novel mechanism whereby BRCA1/1a/1b fine tunes the dynamic complex interplay between SUMO-dependent/independent activities of Ubc9 on E2-induced ERalpha activation/repression and degradation in breast cancer cells.", "journal": "International journal of oncology", "date": "2009", "authors": "Xu J, Watkins T, Reddy A, Reddy ES, Rao VN", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "19287951", "url": "https://glygen.org/publication/PubMed/19287951" } ] }, { "title": "Dephosphorylation of the C-terminal tyrosyl residue of the DNA damage-related histone H2A.X is mediated by the protein phosphatase eyes absent.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Krishnan N, Jeong DG, Jung SK, Ryu SE, Xiao A, Allis CD, Kim SJ, Tonks NK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "19351884", "url": "https://glygen.org/publication/PubMed/19351884" } ] }, { "title": "Ubiquitin-like protein activation by E1 enzymes: the apex for downstream signalling pathways.", "journal": "Nature reviews. Molecular cell biology", "date": "2009", "authors": "Schulman BA, Harper JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "19352404", "url": "https://glygen.org/publication/PubMed/19352404" } ] }, { "title": "CtIP-BRCA1 modulates the choice of DNA double-strand-break repair pathway throughout the cell cycle.", "journal": "Nature", "date": "2009", "authors": "Yun MH, Hiom K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "19357644", "url": "https://glygen.org/publication/PubMed/19357644" } ] }, { "title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.", "journal": "Analytical chemistry", "date": "2009", "authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S", "evidence": [ { "database": "iPTMnet", "id": "O95714", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95714" } ], "reference": [ { "type": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ] }, { "title": "FANCJ helicase uniquely senses oxidative base damage in either strand of duplex DNA and is stimulated by replication protein A to unwind the damaged DNA substrate in a strand-specific manner.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Suhasini AN, Sommers JA, Mason AC, Voloshin ON, Camerini-Otero RD, Wold MS, Brosh RM Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "19419957", "url": "https://glygen.org/publication/PubMed/19419957" } ] }, { "title": "What was the set of ubiquitin and ubiquitin-like conjugating enzymes in the eukaryote common ancestor?", "journal": "Journal of molecular evolution", "date": "2009", "authors": "Michelle C, Vourc'h P, Mignon L, Andres CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "19452197", "url": "https://glygen.org/publication/PubMed/19452197" } ] }, { "title": "RING domain E3 ubiquitin ligases.", "journal": "Annual review of biochemistry", "date": "2009", "authors": "Deshaies RJ, Joazeiro CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "19489725", "url": "https://glygen.org/publication/PubMed/19489725" } ] }, { "title": "Tyrosyl-DNA phosphodiesterase and the repair of 3'-phosphoglycolate-terminated DNA double-strand breaks.", "journal": "DNA repair", "date": "2009", "authors": "Zhou T, Akopiants K, Mohapatra S, Lin PS, Valerie K, Ramsden DA, Lees-Miller SP, Povirk LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "19505854", "url": "https://glygen.org/publication/PubMed/19505854" } ] }, { "title": "Proteomics analysis of nucleolar SUMO-1 target proteins upon proteasome inhibition.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Matafora V, D'Amato A, Mori S, Blasi F, Bachi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "19596686", "url": "https://glygen.org/publication/PubMed/19596686" } ] }, { "title": "Sumoylation of poly(ADP-ribose) polymerase 1 inhibits its acetylation and restrains transcriptional coactivator function.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2009", "authors": "Messner S, Schuermann D, Altmeyer M, Kassner I, Schmidt D, Schar P, Muller S, Hottiger MO", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "19622798", "url": "https://glygen.org/publication/PubMed/19622798" } ] }, { "title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Pan C, Olsen JV, Daub H, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O95714", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95714" } ], "reference": [ { "type": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ] }, { "title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.", "journal": "Science signaling", "date": "2009", "authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" }, { "database": "iPTMnet", "id": "O95714", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95714" } ], "reference": [ { "type": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" } ] }, { "title": "SUMO-dependent regulation of centrin-2.", "journal": "Journal of cell science", "date": "2009", "authors": "Klein UR, Nigg EA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "19706679", "url": "https://glygen.org/publication/PubMed/19706679" } ] }, { "title": "PARP-1 transcriptional activity is regulated by sumoylation upon heat shock.", "journal": "The EMBO journal", "date": "2009", "authors": "Martin N, Schwamborn K, Schreiber V, Werner A, Guillier C, Zhang XD, Bischof O, Seeler JS, Dejean A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "19779455", "url": "https://glygen.org/publication/PubMed/19779455" } ] }, { "title": "Structure and activation mechanism of the CHK2 DNA damage checkpoint kinase.", "journal": "Molecular cell", "date": "2009", "authors": "Cai Z, Chehab NH, Pavletich NP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "19782031", "url": "https://glygen.org/publication/PubMed/19782031" } ] }, { "title": "Building ubiquitin chains: E2 enzymes at work.", "journal": "Nature reviews. Molecular cell biology", "date": "2009", "authors": "Ye Y, Rape M", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "19851334", "url": "https://glygen.org/publication/PubMed/19851334" } ] }, { "title": "Mechanisms of ubiquitin transfer by the anaphase-promoting complex.", "journal": "Journal of biology", "date": "2009", "authors": "Matyskiela ME, Rodrigo-Brenni MC, Morgan DO", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "19874575", "url": "https://glygen.org/publication/PubMed/19874575" } ] }, { "title": "The family of ubiquitin-conjugating enzymes (E2s): deciding between life and death of proteins.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2010", "authors": "van Wijk SJ, Timmers HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "19940261", "url": "https://glygen.org/publication/PubMed/19940261" } ] }, { "title": "SUMO modification regulates BLM and RAD51 interaction at damaged replication forks.", "journal": "PLoS biology", "date": "2009", "authors": "Ouyang KJ, Woo LL, Zhu J, Huo D, Matunis MJ, Ellis NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "19956565", "url": "https://glygen.org/publication/PubMed/19956565" } ] }, { "title": "The SUMO modification pathway is involved in the BRCA1 response to genotoxic stress.", "journal": "Nature", "date": "2009", "authors": "Morris JR, Boutell C, Keppler M, Densham R, Weekes D, Alamshah A, Butler L, Galanty Y, Pangon L, Kiuchi T, Ng T, Solomon E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "20016594", "url": "https://glygen.org/publication/PubMed/20016594" } ] }, { "title": "Mammalian SUMO E3-ligases PIAS1 and PIAS4 promote responses to DNA double-strand breaks.", "journal": "Nature", "date": "2009", "authors": "Galanty Y, Belotserkovskaya R, Coates J, Polo S, Miller KM, Jackson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "20016603", "url": "https://glygen.org/publication/PubMed/20016603" } ] }, { "title": "HERC2 coordinates ubiquitin-dependent assembly of DNA repair factors on damaged chromosomes.", "journal": "Nature cell biology", "date": "2010", "authors": "Bekker-Jensen S, Rendtlew Danielsen J, Fugger K, Gromova I, Nerstedt A, Lukas C, Bartek J, Lukas J, Mailand N", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" }, { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" }, { "database": "iPTMnet", "id": "O95714", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95714" } ], "reference": [ { "type": "PubMed", "id": "20023648", "url": "https://glygen.org/publication/PubMed/20023648" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" }, { "database": "iPTMnet", "id": "O95714", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95714" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "A PP4 phosphatase complex dephosphorylates RPA2 to facilitate DNA repair via homologous recombination.", "journal": "Nature structural & molecular biology", "date": "2010", "authors": "Lee DH, Pan Y, Kanner S, Sung P, Borowiec JA, Chowdhury D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "20154705", "url": "https://glygen.org/publication/PubMed/20154705" } ] }, { "title": "The putative nuclear localization signal of the human RAD52 protein is a potential sumoylation site.", "journal": "Journal of biochemistry", "date": "2010", "authors": "Saito K, Kagawa W, Suzuki T, Suzuki H, Yokoyama S, Saitoh H, Tashiro S, Dohmae N, Kurumizaka H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "20190268", "url": "https://glygen.org/publication/PubMed/20190268" } ] }, { "title": "Tipin-replication protein A interaction mediates Chk1 phosphorylation by ATR in response to genotoxic stress.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Kemp MG, Akan Z, Yilmaz S, Grillo M, Smith-Roe SL, Kang TH, Cordeiro-Stone M, Kaufmann WK, Abraham RT, Sancar A, Unsal-Kacmaz K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "20233725", "url": "https://glygen.org/publication/PubMed/20233725" } ] }, { "title": "Circadian control of XPA and excision repair of cisplatin-DNA damage by cryptochrome and HERC2 ubiquitin ligase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Kang TH, Lindsey-Boltz LA, Reardon JT, Sancar A", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" } ], "reference": [ { "type": "PubMed", "id": "20304803", "url": "https://glygen.org/publication/PubMed/20304803" } ] }, { "title": "The UBXN1 protein associates with autoubiquitinated forms of the BRCA1 tumor suppressor and inhibits its enzymatic function.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Wu-Baer F, Ludwig T, Baer R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "20351172", "url": "https://glygen.org/publication/PubMed/20351172" } ] }, { "title": "Human eye colour and HERC2, OCA2 and MATP.", "journal": "Forensic Sci. Int. Genet.", "date": "2010", "authors": "Mengel-From Jonas, B\u00f8rsting Claus, Sanchez Juan J, Eiberg Hans, Morling Niels", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" } ], "reference": [ { "type": "PubMed", "id": "20457063", "url": "https://glygen.org/publication/PubMed/20457063" } ] }, { "title": "Regulation of DNA repair through deSUMOylation and SUMOylation of replication protein A complex.", "journal": "Molecular cell", "date": "2010", "authors": "Dou H, Huang C, Singh M, Carpenter PB, Yeh ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "20705237", "url": "https://glygen.org/publication/PubMed/20705237" } ] }, { "title": "DNA end resection by CtIP and exonuclease 1 prevents genomic instability.", "journal": "EMBO reports", "date": "2010", "authors": "Eid W, Steger M, El-Shemerly M, Ferretti LP, Pena-Diaz J, Konig C, Valtorta E, Sartori AA, Ferrari S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "21052091", "url": "https://glygen.org/publication/PubMed/21052091" } ] }, { "title": "A novel proteomics approach to identify SUMOylated proteins and their modification sites in human cells.", "journal": "Molecular & cellular proteomics : MCP", "date": "2011", "authors": "Galisson F, Mahrouche L, Courcelles M, Bonneil E, Meloche S, Chelbi-Alix MK, Thibault P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "21098080", "url": "https://glygen.org/publication/PubMed/21098080" } ] }, { "title": "Cell cycle-dependent conjugation of endogenous BRCA1 protein with SUMO-2/3.", "journal": "Biochimica et biophysica acta", "date": "2011", "authors": "Vialter A, Vincent A, Demidem A, Morvan D, Stepien G, Venezia ND, Rio PG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "21147198", "url": "https://glygen.org/publication/PubMed/21147198" } ] }, { "title": "Interaction between the helicases genetically linked to Fanconi anemia group J and Bloom's syndrome.", "journal": "The EMBO journal", "date": "2011", "authors": "Suhasini AN, Rawtani NA, Wu Y, Sommers JA, Sharma S, Mosedale G, North PS, Cantor SB, Hickson ID, Brosh RM Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "21240188", "url": "https://glygen.org/publication/PubMed/21240188" } ] }, { "title": "CtIP interacts with TopBP1 and Nbs1 in the response to double-stranded DNA breaks (DSBs) in Xenopus egg extracts.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2011", "authors": "Ramirez-Lugo JS, Yoo HY, Yoon SJ, Dunphy WG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "21263215", "url": "https://glygen.org/publication/PubMed/21263215" } ] }, { "title": "NBA1/MERIT40 and BRE interaction is required for the integrity of two distinct deubiquitinating enzyme BRCC36-containing complexes.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Hu X, Kim JA, Castillo A, Huang M, Liu J, Wang B", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "21282113", "url": "https://glygen.org/publication/PubMed/21282113" } ] }, { "title": "SUMO-1 regulates the conformational dynamics of thymine-DNA Glycosylase regulatory domain and competes with its DNA binding activity.", "journal": "BMC biochemistry", "date": "2011", "authors": "Smet-Nocca C, Wieruszeski JM, Leger H, Eilebrecht S, Benecke A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "21284855", "url": "https://glygen.org/publication/PubMed/21284855" } ] }, { "title": "MMSET regulates histone H4K20 methylation and 53BP1 accumulation at DNA damage sites.", "journal": "Nature", "date": "2011", "authors": "Pei H, Zhang L, Luo K, Qin Y, Chesi M, Fei F, Bergsagel PL, Wang L, You Z, Lou Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "21293379", "url": "https://glygen.org/publication/PubMed/21293379" } ] }, { "title": "BLM-DNA2-RPA-MRN and EXO1-BLM-RPA-MRN constitute two DNA end resection machineries for human DNA break repair.", "journal": "Genes & development", "date": "2011", "authors": "Nimonkar AV, Genschel J, Kinoshita E, Polaczek P, Campbell JL, Wyman C, Modrich P, Kowalczykowski SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "21325134", "url": "https://glygen.org/publication/PubMed/21325134" } ] }, { "title": "The BRCA1-RAP80 complex regulates DNA repair mechanism utilization by restricting end resection.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Coleman KA, Greenberg RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "21335604", "url": "https://glygen.org/publication/PubMed/21335604" } ] }, { "title": "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.", "journal": "Science signaling", "date": "2011", "authors": "Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" }, { "database": "iPTMnet", "id": "O95714", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95714" } ], "reference": [ { "type": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" } ] }, { "title": "The Nse2/Mms21 SUMO ligase of the Smc5/6 complex in the maintenance of genome stability.", "journal": "FEBS letters", "date": "2011", "authors": "Stephan AK, Kliszczak M, Morrison CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "21550342", "url": "https://glygen.org/publication/PubMed/21550342" } ] }, { "title": "A DNA damage response screen identifies RHINO, a 9-1-1 and TopBP1 interacting protein required for ATR signaling.", "journal": "Science (New York, N.Y.)", "date": "2011", "authors": "Cotta-Ramusino C, McDonald ER 3rd, Hurov K, Sowa ME, Harper JW, Elledge SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "21659603", "url": "https://glygen.org/publication/PubMed/21659603" } ] }, { "title": "Role for casein kinase 1 in the phosphorylation of Claspin on critical residues necessary for the activation of Chk1.", "journal": "Molecular biology of the cell", "date": "2011", "authors": "Meng Z, Capalbo L, Glover DM, Dunphy WG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "21680713", "url": "https://glygen.org/publication/PubMed/21680713" } ] }, { "title": "ATR autophosphorylation as a molecular switch for checkpoint activation.", "journal": "Molecular cell", "date": "2011", "authors": "Liu S, Shiotani B, Lahiri M, Marechal A, Tse A, Leung CC, Glover JN, Yang XH, Zou L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "21777809", "url": "https://glygen.org/publication/PubMed/21777809" } ] }, { "title": "FANCJ coordinates two pathways that maintain epigenetic stability at G-quadruplex DNA.", "journal": "Nucleic acids research", "date": "2012", "authors": "Sarkies P, Murat P, Phillips LG, Patel KJ, Balasubramanian S, Sale JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "22021381", "url": "https://glygen.org/publication/PubMed/22021381" } ] }, { "title": "Fanconi anemia and Bloom's syndrome crosstalk through FANCJ-BLM helicase interaction.", "journal": "Trends in genetics : TIG", "date": "2012", "authors": "Suhasini AN, Brosh RM Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "22024395", "url": "https://glygen.org/publication/PubMed/22024395" } ] }, { "title": "Human Ku70/80 protein blocks exonuclease 1-mediated DNA resection in the presence of human Mre11 or Mre11/Rad50 protein complex.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Sun J, Lee KJ, Davis AJ, Chen DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "22179609", "url": "https://glygen.org/publication/PubMed/22179609" } ] }, { "title": "Mre11 regulates CtIP-dependent double-strand break repair by interaction with CDK2.", "journal": "Nature structural & molecular biology", "date": "2012", "authors": "Buis J, Stoneham T, Spehalski E, Ferguson DO", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "22231403", "url": "https://glygen.org/publication/PubMed/22231403" } ] }, { "title": "Structural mechanism of the phosphorylation-dependent dimerization of the MDC1 forkhead-associated domain.", "journal": "Nucleic acids research", "date": "2012", "authors": "Liu J, Luo S, Zhao H, Liao J, Li J, Yang C, Xu B, Stern DF, Xu X, Ye K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "22234877", "url": "https://glygen.org/publication/PubMed/22234877" } ] }, { "title": "Interaction proteomics identify NEURL4 and the HECT E3 ligase HERC2 as novel modulators of centrosome architecture.", "journal": "Mol. Cell. Proteomics", "date": "2012", "authors": "Al-Hakim AK, Bashkurov M, Gingras AC, Durocher D, Pelletier L", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" } ], "reference": [ { "type": "PubMed", "id": "22261722", "url": "https://glygen.org/publication/PubMed/22261722" } ] }, { "title": "RNF8- and RNF168-dependent degradation of KDM4A/JMJD2A triggers 53BP1 recruitment to DNA damage sites.", "journal": "The EMBO journal", "date": "2012", "authors": "Mallette FA, Mattiroli F, Cui G, Young LC, Hendzel MJ, Mer G, Sixma TK, Richard S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "22373579", "url": "https://glygen.org/publication/PubMed/22373579" } ] }, { "title": "DNA damage-inducible SUMOylation of HERC2 promotes RNF8 binding via a novel SUMO-binding Zinc finger.", "journal": "The Journal of cell biology", "date": "2012", "authors": "Danielsen JR, Povlsen LK, Villumsen BH, Streicher W, Nilsson J, Wikstrom M, Bekker-Jensen S, Mailand N", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" }, { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" }, { "database": "iPTMnet", "id": "O95714", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95714" } ], "reference": [ { "type": "PubMed", "id": "22508508", "url": "https://glygen.org/publication/PubMed/22508508" } ] }, { "title": "Artemis C-terminal region facilitates V(D)J recombination through its interactions with DNA Ligase IV and DNA-PKcs.", "journal": "The Journal of experimental medicine", "date": "2012", "authors": "Malu S, De Ioannes P, Kozlov M, Greene M, Francis D, Hanna M, Pena J, Escalante CR, Kurosawa A, Erdjument-Bromage H, Tempst P, Adachi N, Vezzoni P, Villa A, Aggarwal AK, Cortes P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "22529269", "url": "https://glygen.org/publication/PubMed/22529269" } ] }, { "title": "Molecular insights into the function of RING finger (RNF)-containing proteins hRNF8 and hRNF168 in Ubc13/Mms2-dependent ubiquitylation.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Campbell SJ, Edwards RA, Leung CC, Neculai D, Hodge CD, Dhe-Paganon S, Glover JN", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "22589545", "url": "https://glygen.org/publication/PubMed/22589545" } ] }, { "title": "Molecular cloning and primary structure of rat testes metalloendopeptidase EC 3.4.24.15.", "journal": "Biochemistry", "date": "1990", "authors": "Pierotti A, Dong KW, Glucksman MJ, Orlowski M, Roberts JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "2261476", "url": "https://glygen.org/publication/PubMed/2261476" } ] }, { "title": "Sumoylation of MDC1 is important for proper DNA damage response.", "journal": "The EMBO journal", "date": "2012", "authors": "Luo K, Zhang H, Wang L, Yuan J, Lou Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "22635276", "url": "https://glygen.org/publication/PubMed/22635276" } ] }, { "title": "RNF4, a SUMO-targeted ubiquitin E3 ligase, promotes DNA double-strand break repair.", "journal": "Genes & development", "date": "2012", "authors": "Galanty Y, Belotserkovskaya R, Coates J, Jackson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "22661229", "url": "https://glygen.org/publication/PubMed/22661229" } ] }, { "title": "SUMO-targeted ubiquitin E3 ligase RNF4 is required for the response of human cells to DNA damage.", "journal": "Genes & development", "date": "2012", "authors": "Yin Y, Seifert A, Chua JS, Maure JF, Golebiowski F, Hay RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "22661230", "url": "https://glygen.org/publication/PubMed/22661230" } ] }, { "title": "Scc1 sumoylation by Mms21 promotes sister chromatid recombination through counteracting Wapl.", "journal": "Genes & development", "date": "2012", "authors": "Wu N, Kong X, Ji Z, Zeng W, Potts PR, Yokomori K, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "22751501", "url": "https://glygen.org/publication/PubMed/22751501" } ] }, { "title": "FANCJ/BACH1 acetylation at lysine 1249 regulates the DNA damage response.", "journal": "PLoS genetics", "date": "2012", "authors": "Xie J, Peng M, Guillemette S, Quan S, Maniatis S, Wu Y, Venkatesh A, Shaffer SA, Brosh RM Jr, Cantor SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "22792074", "url": "https://glygen.org/publication/PubMed/22792074" } ] }, { "title": "Dual recognition of phosphoserine and phosphotyrosine in histone variant H2A.X by DNA damage response protein MCPH1.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Singh N, Basnet H, Wiltshire TD, Mohammad DH, Thompson JR, Heroux A, Botuyan MV, Yaffe MB, Couch FJ, Rosenfeld MG, Mer G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "22908299", "url": "https://glygen.org/publication/PubMed/22908299" } ] }, { "title": "Distinct roles for DNA-PK, ATM and ATR in RPA phosphorylation and checkpoint activation in response to replication stress.", "journal": "Nucleic acids research", "date": "2012", "authors": "Liu S, Opiyo SO, Manthey K, Glanzer JG, Ashley AK, Amerin C, Troksa K, Shrivastav M, Nickoloff JA, Oakley GG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "22977173", "url": "https://glygen.org/publication/PubMed/22977173" } ] }, { "title": "RNF168 ubiquitinates K13-15 on H2A/H2AX to drive DNA damage signaling.", "journal": "Cell", "date": "2012", "authors": "Mattiroli F, Vissers JH, van Dijk WJ, Ikpa P, Citterio E, Vermeulen W, Marteijn JA, Sixma TK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "22980979", "url": "https://glygen.org/publication/PubMed/22980979" } ] }, { "title": "A homozygous missense mutation in HERC2 associated with global developmental delay and autism spectrum disorder.", "journal": "Human mutation", "date": "2012", "authors": "Puffenberger EG, Jinks RN, Wang H, Xin B, Fiorentini C, Sherman EA, Degrazio D, Shaw C, Sougnez C, Cibulskis K, Gabriel S, Kelley RI, Morton DH, Strauss KA", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" } ], "reference": [ { "type": "PubMed", "id": "23065719", "url": "https://glygen.org/publication/PubMed/23065719" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" }, { "database": "iPTMnet", "id": "O95714", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95714" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "53BP1 regulates DSB repair using Rif1 to control 5' end resection.", "journal": "Science (New York, N.Y.)", "date": "2013", "authors": "Zimmermann M, Lottersberger F, Buonomo SB, Sfeir A, de Lange T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "23306437", "url": "https://glygen.org/publication/PubMed/23306437" } ] }, { "title": "A cell cycle-dependent regulatory circuit composed of 53BP1-RIF1 and BRCA1-CtIP controls DNA repair pathway choice.", "journal": "Molecular cell", "date": "2013", "authors": "Escribano-Diaz C, Orthwein A, Fradet-Turcotte A, Xing M, Young JT, Tkac J, Cook MA, Rosebrock AP, Munro M, Canny MD, Xu D, Durocher D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "23333306", "url": "https://glygen.org/publication/PubMed/23333306" } ] }, { "title": "Nek1 kinase associates with ATR-ATRIP and primes ATR for efficient DNA damage signaling.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Liu S, Ho CK, Ouyang J, Zou L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "23345434", "url": "https://glygen.org/publication/PubMed/23345434" } ] }, { "title": "The interaction of CtIP and Nbs1 connects CDK and ATM to regulate HR-mediated double-strand break repair.", "journal": "PLoS genetics", "date": "2013", "authors": "Wang H, Shi LZ, Wong CC, Han X, Hwang PY, Truong LN, Zhu Q, Shao Z, Chen DJ, Berns MW, Yates JR 3rd, Chen L, Wu X", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "23468639", "url": "https://glygen.org/publication/PubMed/23468639" } ] }, { "title": "TDP2-dependent non-homologous end-joining protects against topoisomerase II-induced DNA breaks and genome instability in cells and in vivo.", "journal": "PLoS genetics", "date": "2013", "authors": "Gomez-Herreros F, Romero-Granados R, Zeng Z, Alvarez-Quilon A, Quintero C, Ju L, Umans L, Vermeire L, Huylebroeck D, Caldecott KW, Cortes-Ledesma F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "23505375", "url": "https://glygen.org/publication/PubMed/23505375" } ] }, { "title": "53BP1 mediates productive and mutagenic DNA repair through distinct phosphoprotein interactions.", "journal": "Cell", "date": "2013", "authors": "Callen E, Di Virgilio M, Kruhlak MJ, Nieto-Soler M, Wong N, Chen HT, Faryabi RB, Polato F, Santos M, Starnes LM, Wesemann DR, Lee JE, Tubbs A, Sleckman BP, Daniel JA, Ge K, Alt FW, Fernandez-Capetillo O, Nussenzweig MC, Nussenzweig A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "23727112", "url": "https://glygen.org/publication/PubMed/23727112" } ] }, { "title": "Targeted identification of SUMOylation sites in human proteins using affinity enrichment and paralog-specific reporter ions.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Lamoliatte F, Bonneil E, Durette C, Caron-Lizotte O, Wildemann D, Zerweck J, Wenshuk H, Thibault P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "23750026", "url": "https://glygen.org/publication/PubMed/23750026" } ] }, { "title": "DNA-dependent SUMO modification of PARP-1.", "journal": "DNA repair", "date": "2013", "authors": "Zilio N, Williamson CT, Eustermann S, Shah R, West SC, Neuhaus D, Ulrich HD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "23871147", "url": "https://glygen.org/publication/PubMed/23871147" } ] }, { "title": "BLM SUMOylation regulates ssDNA accumulation at stalled replication forks.", "journal": "Frontiers in genetics", "date": "2013", "authors": "Ouyang KJ, Yagle MK, Matunis MJ, Ellis NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "24027577", "url": "https://glygen.org/publication/PubMed/24027577" } ] }, { "title": "Processing of damaged DNA ends for double-strand break repair in mammalian cells.", "journal": "ISRN molecular biology", "date": "2012", "authors": "Povirk LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "24236237", "url": "https://glygen.org/publication/PubMed/24236237" } ] }, { "title": "Role of MERIT40 in stabilization of BRCA1 complex: a protein-protein interaction study.", "journal": "Biochemical and biophysical research communications", "date": "2014", "authors": "Vikrant, Sawant UU, Varma AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "24667604", "url": "https://glygen.org/publication/PubMed/24667604" } ] }, { "title": "HERC2 targets the iron regulator FBXL5 for degradation and modulates iron metabolism.", "journal": "The Journal of biological chemistry", "date": "2014-06-06", "authors": "Moroishi Toshiro, Yamauchi Takayoshi, Nishiyama Masaaki, Nakayama Keiichi I", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" } ], "reference": [ { "type": "PubMed", "id": "24778179", "url": "https://glygen.org/publication/PubMed/24778179" } ] }, { "title": "Proteome-wide identification of SUMO2 modification sites.", "journal": "Science signaling", "date": "2014", "authors": "Tammsalu T, Matic I, Jaffray EG, Ibrahim AFM, Tatham MH, Hay RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "24782567", "url": "https://glygen.org/publication/PubMed/24782567" } ] }, { "title": "Phosphorylated RPA recruits PALB2 to stalled DNA replication forks to facilitate fork recovery.", "journal": "The Journal of cell biology", "date": "2014", "authors": "Murphy AK, Fitzgerald M, Ro T, Kim JH, Rabinowitsch AI, Chowdhury D, Schildkraut CL, Borowiec JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "25113031", "url": "https://glygen.org/publication/PubMed/25113031" } ] }, { "title": "Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014", "authors": "Impens F, Radoshevich L, Cossart P, Ribet D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "25114211", "url": "https://glygen.org/publication/PubMed/25114211" } ] }, { "title": "DNA2 cooperates with the WRN and BLM RecQ helicases to mediate long-range DNA end resection in human cells.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Sturzenegger A, Burdova K, Kanagaraj R, Levikova M, Pinto C, Cejka P, Janscak P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "25122754", "url": "https://glygen.org/publication/PubMed/25122754" } ] }, { "title": "Uncovering global SUMOylation signaling networks in a site-specific manner.", "journal": "Nature structural & molecular biology", "date": "2014", "authors": "Hendriks IA, D'Souza RC, Yang B, Verlaan-de Vries M, Mann M, Vertegaal AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "25218447", "url": "https://glygen.org/publication/PubMed/25218447" } ] }, { "title": "PTIP associates with Artemis to dictate DNA repair pathway choice.", "journal": "Genes & development", "date": "2014", "authors": "Wang J, Aroumougame A, Lobrich M, Li Y, Chen D, Chen J, Gong Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "25512557", "url": "https://glygen.org/publication/PubMed/25512557" } ] }, { "title": "CtIP tetramer assembly is required for DNA-end resection and repair.", "journal": "Nature structural & molecular biology", "date": "2015", "authors": "Davies OR, Forment JV, Sun M, Belotserkovskaya R, Coates J, Galanty Y, Demir M, Morton CR, Rzechorzek NJ, Jackson SP, Pellegrini L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "25558984", "url": "https://glygen.org/publication/PubMed/25558984" } ] }, { "title": "Damage-induced BRCA1 phosphorylation by Chk2 contributes to the timing of end resection.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2015", "authors": "Parameswaran B, Chiang HC, Lu Y, Coates J, Deng CX, Baer R, Lin HK, Li R, Paull TT, Hu Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "25659039", "url": "https://glygen.org/publication/PubMed/25659039" } ] }, { "title": "Differential phosphorylation of DNA-PKcs regulates the interplay between end-processing and end-ligation during nonhomologous end-joining.", "journal": "Molecular cell", "date": "2015", "authors": "Jiang W, Crowe JL, Liu X, Nakajima S, Wang Y, Li C, Lee BJ, Dubois RL, Liu C, Yu X, Lan L, Zha S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "25818648", "url": "https://glygen.org/publication/PubMed/25818648" } ] }, { "title": "TDP1 promotes assembly of non-homologous end joining protein complexes on DNA.", "journal": "DNA repair", "date": "2015", "authors": "Heo J, Li J, Summerlin M, Hays A, Katyal S, McKinnon PJ, Nitiss KC, Nitiss JL, Hanakahi LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "25841101", "url": "https://glygen.org/publication/PubMed/25841101" } ] }, { "title": "Loss of the proteostasis factor AIRAPL causes myeloid transformation by deregulating IGF-1 signaling.", "journal": "Nature medicine", "date": "2016", "authors": "Osorio FG, Soria-Valles C, Santiago-Fernandez O, Bernal T, Mittelbrunn M, Colado E, Rodriguez F, Bonzon-Kulichenko E, Vazquez J, Porta-de-la-Riva M, Ceron J, Fueyo A, Li J, Green AR, Freije JM, Lopez-Otin C", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" } ], "reference": [ { "type": "PubMed", "id": "26692333", "url": "https://glygen.org/publication/PubMed/26692333" } ] }, { "title": "Mapping and Quantification of Over 2000 O-linked Glycopeptides in Activated Human T Cells with Isotope-Targeted Glycoproteomics (Isotag).", "journal": "Molecular & cellular proteomics : MCP", "date": "2018", "authors": "Woo CM, Lund PJ, Huang AC, Davis MM, Bertozzi CR, Pitteri SJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "O95714", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95714" }, { "database": "O-GlcNAc Atlas", "id": "O95714", "url": "https://oglcnac.org/atlas/detail/O95714" } ], "reference": [ { "type": "PubMed", "id": "29351928", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "title": "Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and alpha-1B-Glycoprotein.", "journal": "Analytical chemistry", "date": "2018", "authors": "Sun S, Hu Y, Jia L, Eshghi ST, Liu Y, Shah P, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "O95714", "url": "" }, { "database": "GlyConnect", "id": "1191", "url": "https://glyconnect.expasy.org/browser/proteins/1191" } ], "reference": [ { "type": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "GlyConnect", "id": "1191", "url": "https://glyconnect.expasy.org/browser/proteins/1191" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "A triarylphosphine-trimethylpiperidine reagent for the one-step derivatization and enrichment of protein post-translational modifications and identification by mass spectrometry.", "journal": "Chemical communications (Cambridge, England)", "date": "2018", "authors": "Huo B, Zhang W, Zhao X, Dong H, Yu Y, Wang J, Qian X, Qin W", "evidence": [ { "database": "O-GlcNAc Database", "id": "O95714", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95714" }, { "database": "O-GlcNAc Atlas", "id": "O95714", "url": "https://oglcnac.org/atlas/detail/O95714" } ], "reference": [ { "type": "PubMed", "id": "30379171", "url": "https://glygen.org/publication/PubMed/30379171" } ] }, { "title": "Identification of tumor-educated platelet biomarkers of non-small-cell lung cancer.", "journal": "OncoTargets and therapy", "date": "2018", "authors": "Sheng M, Dong Z, Xie Y", "evidence": [ { "database": "GlyGen", "id": "A0478", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "30532555", "url": "https://glygen.org/publication/PubMed/30532555" } ] }, { "title": "Common genetic variants associated with melanoma risk or naevus count in patients with wildtype MC1R melanoma.", "journal": "The British journal of dermatology", "date": "2022-11", "authors": "Calbet-Llopart Neus, Combalia Marc, Kiroglu Anil, Potrony Miriam, Tell-Mart\u00ed Gemma, Combalia Andrea, Brugues Albert, Podlipnik Sebastian, Carrera Cristina, Puig Susana, Malvehy Josep, Puig-Butill\u00e9 Joan Anton", "evidence": [ { "database": "RefSeq", "id": "NP_004658", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004658" } ], "reference": [ { "type": "PubMed", "id": "35701387", "url": "https://glygen.org/publication/PubMed/35701387" } ] }, { "title": "The mechanism of radiotherapy for lung adenocarcinoma in promoting protein SIRT6-mediated deacetylation of RBBP8 to enhance the sensitivity of targeted therapy.", "journal": "International journal of immunopathology and pharmacology", "date": "2022", "authors": "Wang J, Sheng Z, Dong Z, Wu Q, Cai Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "36172813", "url": "https://glygen.org/publication/PubMed/36172813" } ] }, { "title": "HERC2 deficiency activates C-RAF/MKK3/p38 signalling pathway altering the cellular response to oxidative stress.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2022-10-14", "authors": "Sala-Gaston Joan, Pedrazza Leonardo, Ramirez Juanma, Martinez-Martinez Arturo, Rawlins Lettie E, Baple Emma L, Crosby Andrew H, Mayor Ugo, Ventura Francesc, Rosa Jose Luis", "evidence": [ { "database": "RefSeq", "id": "NP_004658", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004658" } ], "reference": [ { "type": "PubMed", "id": "36241744", "url": "https://glygen.org/publication/PubMed/36241744" } ] }, { "title": "HERC2 promotes inflammation-driven cancer stemness and immune evasion in hepatocellular carcinoma by activating STAT3 pathway.", "journal": "Journal of experimental & clinical cancer research : CR", "date": "2023-02-01", "authors": "Liu Yunzhi, Xu Qishan, Deng Fan, Zheng Zhuojun, Luo Jialiang, Wang Ping, Zhou Jia, Lu Xiao, Zhang Liyun, Chen Zhengliang, Zhang Qifan, Chen Qingyun, Zuo Daming", "evidence": [ { "database": "RefSeq", "id": "NP_004658", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004658" } ], "reference": [ { "type": "PubMed", "id": "36721234", "url": "https://glygen.org/publication/PubMed/36721234" } ] }, { "title": "EHD1 promotes CP110 ubiquitination by centriolar satellite delivery of HERC2 to the mother centriole.", "journal": "EMBO reports", "date": "2023", "authors": "Xie S, Naslavsky N, Caplan S", "evidence": [ { "database": "RefSeq", "id": "NP_004658", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004658" } ], "reference": [ { "type": "PubMed", "id": "37074924", "url": "https://glygen.org/publication/PubMed/37074924" } ] }, { "title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.", "journal": "Journal of biomedical science", "date": "2023-05-22", "authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K", "evidence": [ { "database": "O-GlcNAc Database", "id": "O95714", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95714" } ], "reference": [ { "type": "PubMed", "id": "37217939", "url": "https://glygen.org/publication/PubMed/37217939" } ] }, { "title": "Mechanism of orphan subunit recognition during assembly quality control.", "journal": "Cell", "date": "2023-08-03", "authors": "Yagita Yuichi, Zavodszky Eszter, Peak-Chew Sew-Yeu, Hegde Ramanujan S", "evidence": [ { "database": "RefSeq", "id": "NP_004658", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004658" } ], "reference": [ { "type": "PubMed", "id": "37480851", "url": "https://glygen.org/publication/PubMed/37480851" } ] }, { "title": "The DNA-dependent protein kinase: requirement for DNA ends and association with Ku antigen.", "journal": "Cell", "date": "1993", "authors": "Gottlieb TM, Jackson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "8422676", "url": "https://glygen.org/publication/PubMed/8422676" } ] }, { "title": "Identification of a RING protein that can interact in vivo with the BRCA1 gene product.", "journal": "Nature genetics", "date": "1996", "authors": "Wu LC, Wang ZW, Tsan JT, Spillman MA, Phung A, Xu XL, Yang MC, Hwang LY, Bowcock AM, Baer R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "8944023", "url": "https://glygen.org/publication/PubMed/8944023" } ] }, { "title": "Ataxia telangiectasia mutant protein activates c-Abl tyrosine kinase in response to ionizing radiation.", "journal": "Nature", "date": "1997", "authors": "Baskaran R, Wood LD, Whitaker LL, Canman CE, Morgan SE, Xu Y, Barlow C, Baltimore D, Wynshaw-Boris A, Kastan MB, Wang JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "9168116", "url": "https://glygen.org/publication/PubMed/9168116" } ] }, { "title": "Mammalian DNA double-strand break repair protein XRCC4 interacts with DNA ligase IV.", "journal": "Current biology : CB", "date": "1997", "authors": "Critchlow SE, Bowater RP, Jackson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "9259561", "url": "https://glygen.org/publication/PubMed/9259561" } ] }, { "title": "Two distinct proteolytic processes in the generation of a major histocompatibility complex class I-presented peptide.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Craiu A, Akopian T, Goldberg A, Rock KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "9380723", "url": "https://glygen.org/publication/PubMed/9380723" } ] }, { "title": "Evidence for covalent modification of the nuclear dot-associated proteins PML and Sp100 by PIC1/SUMO-1.", "journal": "The Journal of cell biology", "date": "1997", "authors": "Sternsdorf T, Jensen K, Will H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "9412458", "url": "https://glygen.org/publication/PubMed/9412458" } ] }, { "title": "The XRCC4 gene product is a target for and interacts with the DNA-dependent protein kinase.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Leber R, Wise TW, Mizuta R, Meek K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "9430729", "url": "https://glygen.org/publication/PubMed/9430729" } ] }, { "title": "Covalent modification of PML by the sentrin family of ubiquitin-like proteins.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Kamitani T, Nguyen HP, Kito K, Fukuda-Kamitani T, Yeh ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "9452416", "url": "https://glygen.org/publication/PubMed/9452416" } ] }, { "title": "DNA double-stranded breaks induce histone H2AX phosphorylation on serine 139.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Rogakou EP, Pilch DR, Orr AH, Ivanova VS, Bonner WM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693565", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565" } ], "reference": [ { "type": "PubMed", "id": "9488723", "url": "https://glygen.org/publication/PubMed/9488723" } ] }, { "title": "Interaction of Ku protein and DNA-dependent protein kinase catalytic subunit with nucleic acids.", "journal": "Nucleic acids research", "date": "1998", "authors": "Dynan WS, Yoo S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "9512523", "url": "https://glygen.org/publication/PubMed/9512523" } ] }, { "title": "Interferon-gamma can stimulate post-proteasomal trimming of the N terminus of an antigenic peptide by inducing leucine aminopeptidase.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Beninga J, Rock KL, Goldberg AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "9668046", "url": "https://glygen.org/publication/PubMed/9668046" } ] }, { "title": "Nuclease activities in a complex of human recombination and DNA repair factors Rad50, Mre11, and p95.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Trujillo KM, Yuan SS, Lee EY, Sung P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607" } ], "reference": [ { "type": "PubMed", "id": "9705271", "url": "https://glygen.org/publication/PubMed/9705271" } ] }, { "title": "Identification of three major sentrinization sites in PML.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Kamitani T, Kito K, Nguyen HP, Wada H, Fukuda-Kamitani T, Yeh ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "9756909", "url": "https://glygen.org/publication/PubMed/9756909" } ] }, { "title": "DNA end-joining catalyzed by human cell-free extracts.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Baumann P, West SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571" } ], "reference": [ { "type": "PubMed", "id": "9826654", "url": "https://glygen.org/publication/PubMed/9826654" } ] }, { "title": "SUMO-1 modification of the acute promyelocytic leukaemia protein PML: implications for nuclear localisation.", "journal": "Journal of cell science", "date": "1999", "authors": "Duprez E, Saurin AJ, Desterro JM, Lallemand-Breitenbach V, Howe K, Boddy MN, Solomon E, de The H, Hay RT, Freemont PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "9885291", "url": "https://glygen.org/publication/PubMed/9885291" } ] }, { "title": "The ancestral gene for transcribed, low-copy repeats in the Prader-Willi/Angelman region encodes a large protein implicated in protein trafficking, which is deficient in mice with neuromuscular and spermiogenic abnormalities.", "journal": "Hum. Mol. Genet.", "date": "1999", "authors": "Ji Y, Walkowicz MJ, Buiting K, Johnson DK, Tarvin RE, Rinchik EM, Horsthemke B, Stubbs L, Nicholls RD", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" } ], "reference": [ { "type": "PubMed", "id": "9949213", "url": "https://glygen.org/publication/PubMed/9949213" } ] } ], "pathway": [ { "id": "hsa:8924", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8924", "resource": "KEGG Pathway" }, { "id": "R-HSA-3108214", "name": "SUMOylation of DNA damage response and repair proteins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214", "resource": "Reactome", "description": "SUMOylation of DNA damage response and repair proteins" }, { "id": "R-HSA-5693565", "name": "Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693565", "resource": "Reactome", "description": "Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks" }, { "id": "R-HSA-5693571", "name": "Nonhomologous End-Joining (NHEJ)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693571", "resource": "Reactome", "description": "Nonhomologous End-Joining (NHEJ)" }, { "id": "R-HSA-5693607", "name": "Processing of DNA double-strand break ends", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693607", "resource": "Reactome", "description": "Processing of DNA double-strand break ends" }, { "id": "R-HSA-69473", "name": "G2/M DNA damage checkpoint", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69473", "resource": "Reactome", "description": "G2/M DNA damage checkpoint" }, { "id": "R-HSA-983168", "name": "Antigen processing: Ubiquitination & Proteasome degradation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168", "resource": "Reactome", "description": "Antigen processing: Ubiquitination & Proteasome degradation" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A0G2JUC9-1", "protein_name": "HECT-type E3 ubiquitin transferase", "gene_name": "Herc2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MPSESFCLAAQSRLDSKWLKTDIQLAFTRDGLCGLWNEMVKDGEIVYTGTELTQNRELPSRKDDGVDAQSGTKKEDLNDKEKKEEEETPAPVCRAKSILESWVWGRQPDVNELKECLSVLVKEQQALAVQSATTTLSALRLKQRLVILERYFIALNRTVFQENVKVKWKSSSISVPPTEKKSARPPGRGVEGLARVGSRAALSFAFAFLRRAWRSGEDADLCSELLQESLDALRALPEASLFDESTVSSVWLEVVERATRFLRSVVTGDVHGTPGTKGPGGVPLQDQHLALAILLELAVQRGTLSQMLSAILLLLQLWDSGAQETDNERSAQGTSAPLLPLLHRFQSILCSKDMPHTESDMHLLSGPLSPNESFLKYLTLPQDNELAIDLRQTAVVVMAHLDRLATPCMPPLCSSPTSHKGSLQEVIGWGLIGWKYYANVIGPIQCEGLASLGVMQVACAEKRFLILSRNGRVYTQAYNSDMLAPQLVQGLASRNIVKIAAHSDGHHYLALAATGEVYSWGCGDGGRLGHGDTVPLEEPKVISAFSGKQAGKHVVHIACGSTYSAAITAEGELYTWGRGNYGRLGHGSSEDEAIPMLVAGLKGLKVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLIEKLQDLDVIKVRCGSQFSIALTKDGQVYSWGKGDNQRLGHGTEEHVRYPKLLEGLQGKKVIDVAAGSTHCLALTEDSEVHSWGSNDQCQHFDTLRVTKPEPTALPGLDTKHIVGIACGPAQSFAWSSCSEWSIGLRVPFVVDICPVTFEQLDLLLRQVSEGMDGTADWPPPQEKECMAVATLNLLRLQLHAAISHQVDPEFLGLGLGSVLLNSLKQTVVTLASSAGVLSTVQSAAQAVLQSGWSVLLPTAEERARALSALLPCTVSGNEVNISPGRRFMIDLLVGSLMADGGLESALNAAITAEIQDIEAKKEAQKEKEIDEQEANASTFHRSRTPLDKDLINTGIYESSGKQCLPLVQLIQQLLRNIASQTVARLKDVARRISSCLDFEQHSCERSASLDLLLRFQRLLISKLYPGENIGPISDTSSPELMGVGSLLKKYTALVCTHIGDILPVAASIASSSWQHFAEVACVMEGDFTGVLLPELVVSIVLLLSKNASLMQEAGAIPLLGGLLEHLDRFNHLAPGKERDDHEELAWPGIMESFFTGQNCRNNEEVTLIRKADLENHNKDGGFWTVIDGKVYDIKDFQTQSLTGNSILAQFAGEDPVVALEAALQFEDTQESMHAFCVGQYLEPDQEVVTIPDLGSLSSPLIDTERNLGLLLGLHASYLAMSTPLSPVEVECAKWLQSSIFSGGLQTSQIHYSYNEEKDEDHCSSPGGTPISKSRLCSHRWALGDHSQAFLQAIADNNIQDYNVKDFLCQIERYCRQCHLTTPITFPPEHPVEEVGRLLLCCLLKHEDLGHVALSLVHVGTLGIEQVKHRALPKAVVDVCRVVYQAKCSLIKTHQEQGRSYKEVCAPVIERLRFLFNELRPAVCSDLSIMSKFKLLGSLPRWRRIAQKIIRERRRKRVPKKPESTDGEEKIGNEESDLEEACVLPHSPINVDKRPISMKSPKDKWQPLLNTVTGVHKYKWLKQNVQGLYPQSALLNTIVEFALKEEPVDVEKMRKCLLKQLERAEVRLEGIDTILKLAAKSFLLPSVQYAMFCGWQRLIPEGIDIGEPLTDCLRDVDLIPPFNRMLLEVTFGKLYAWAVQNIRSVLMDASAKFKELGIQPVPLQTITNENPAGPSLGTIPQARFLLVMLSMLTLQHGANNLDLLLNSGTLALTQTALKLIGPTCDSVEDDMNASARGASATVLEETRKETAPVQLPVSGPELAAMMKIGTRVMRGVDWKWGDQDGPPPGLGRVIGELGEDGWIRVQWDTGSTNSYRMGKEGKYDLKLVELPVSSQPSAEDSDTEDDSEAEQGERNIHPTAMMLTSVINLLQTLCLSVGVHADIMQSEATKTLCGLLRMLVESGTTDKPSPPDRLVAREQHRSWCTLGFVRSIALTPQACGALSSPRWITLLMKVVEGHAPFTAASLQRQILAVHLLQAVLPSWDKTERARDMKCLVEKLFGFLGSLLTTCSSDVPLLRESTLRKRRARPQASLTATHSSTLAEEVVGLLRTLHSLTQWNGLINKYINSQLCSVTQSYAGKTSERTLLEDYFPDSENLEVGGLMAVLAVIGGIDGRLRLGGQVMHDEFGEGTVTRITPKGKITVQFCDMRMCRVCPLNQLKPLPAVAFSVNNLPFTEPMLSVWAELVNLAGSKLEKHKTKKSAKQAFAGQVDLDLLRSQQLKLYILKAGRALLSHQDKLRQILSQPAVQETGTLHTDDGAAASPDLGDMSPEGPQPPMILLQQLLSSATQPSPVKAIFDKQELEAAALALCQCLAVESTHPSSPGCEDCSSSEATTPVSVQHIHLARAKKHRQSPAPALPIVVQLMEMGFPRKNIEFALKSLTGTSGNASGLPGVEALVGWLLDHSDVQVTEFSDAETVSDEYSDEEVVEDVDDTPYPVAAGAVVTESQTYKKRADFLSNDDYAVYVRENVQVGMMVRCCRTYEEVCEGDVGKVIKLDRDGLHDLNVQCDWQQKGGTYWVRYIHVELIGYPPPSSSSHIKIGDKVRVKASVTTPKYKWGSVTHQSVGLVKAFSANGKDIIVDFPQQSHWTGLLSEMELVPSIHPGVTCDGCQTFPINGSRFKCRNCDDFDFCETCFKTKKHNTRHTFGRINEPGQSAVFCGRSGKQLKRCHSSQPGMLLDSWSRMVKSLNVSSSVNQASRLIDGSEPCWQSSGSQGKHWIRLEIFPDVLVHRLKMIVDPADSSYMPSLVVVSGGNSLNNLIELKTININQTDTTVPLLSDCAEYHRYIEIAIKQCRSSGIDCKIHGLILLGRIRAEEEDLAAVPFLASDNEEEEDDKGSTGSLIRKKTPGLESTATIRTKVFVWGLNDKDQLGGLKGSKIKVPSFSETLSALNVVQVAGGSKSLFAVTVEGKVYSCGEATNGRLGLGMSSGTVPIPRQITALSSYVVKKVAVHSGGRHATALTVDGKVFSWGEGDDGKLGHFSRMNCDKPRLIEALKTKRIRDIACGSSHSAALTSSGELYTWGLGEYGRLGHGDNTTQLKPKMVKVLLGHRVIQVACGSRDAQTLALTDEGLVFSWGDGDFGKLGRGGSEGCNIPQNIERLNGQGVCQIECGAQFSLALTKSGVVWTWGKGDYFRLGHGSDVHVRKPQVVEGLRGKKIVHVAVGALHCLAVTDSGQVYAWGDNDHGQQGNGTTTVNRKPTLVQGLEGQKITRVACGSSHSVAWTTVDVATPSVHEPVLFQTARDPLGASYLGVPSDADSSSSSNKISGVSNCKPNRPSLAKILLSLEGNLAKQQALSHILTALQIMYARDAVVGALMPAGMLAPVECPSFSSSAPASDVSAMASPMNVEESMLAADLEDRLSPNLWQEKREIVSSEDAVTPSAVTPSAPSASSRPFIPVTDDPGAASIIAETMTKTKEDVESQNKTSGPEPQSLDEFTSLLIPDDTRVVVDLLKLSVCSRAGDRGREVLSAVLSGMGIAYPQVADMLLELCVTELEDVATDSQSGRLSSQPVVVESSHPYTDDTSTSGTVKIPGAEGLRVEFDRQCSTERRHDPLTVMDGVNRIVSVRSGREWSDWSSELRIPGDELKWKFISDGSVNGWGWRFTVYPIMPAAGPKDLLSDRCVLSCPSMDLVTCLLDFRLNLTSNRSIVPRLAASLAACAQLSALAASHRMWALQRLRRLLTTEFGQSININRLLGENDGETRALSFTGSALAALVKGLPEALQRQFEYEDPIVRGGKQLLHSPFFKVLVALACDLELDTLPCCAETHKWAWFRRYCMASRVAVALDKRTPLPRLFLDEVAKKIRELMADSESMDVLHESHSIFKREQDEQLVQWMNRRPDDWTLSAGGSGTIYGWGHNHRGQLGGIEGAKVKVPTPCEALATLRPVQLIGGEQTLFAVTADGKLYATGYGAGGRLGIGGTESVSTPTLLESIQHVFIKKVAVNSGGKHCLALSSEGEVYSWGEAEDGKLGHGNRSPCDRPRVIESLRGIEVVDVAAGGAHSACVTAAGDLYTWGKGRYGRLGHSDSEDQLKPKLVEALQGHRVIDIACGSGDAQTLCLTDDDTVWSWGDGDYGKLGRGGSDGCKVPMKIDSLTGLGVVKVECGSQFSVALTKSGAVYTWGKGDYHRLGHGSDDHVRRPRQVQGLQGKKVIAIATGSLHCVCCTEDGEVYTWGDNDEGQLGDGTTNAIQRPRLVAALQGKKVNRVACGSAHTLAWSTSKPASAGKLPAQVPMEYNHLQEIPIIALRNRLLLLHHISELFCPCIPMFDLEGSLDETGLGPSVGFDTLRGILISQGKEAAFRKVVQATMVRDRQHGPVVELNRIQVKRSRSKGGLAGPDGTKSVFGQMCAKMSSFSPDSLLLPHRVWKVKFVGESVDDCGGGYSESIAEICEELQNGLTPLLIVTPNGRDESGANRDCYLLNPATRAPVHCSMFRFLGVLLGIAIRTGSPLSLNLAEPVWKQLAGMSLTIADLSEVDKDFIPGLMYIRDNEATSEEFEAMSLPFTVPSASGQDIQLSSKHTHITLDNRAEYVRLAINYRLHEFDEQVAAVREGMARVVPVPLLSLFTGYELETMVCGSPDIPLHLLKSVATYKGIEPSASLVQWFWEVMESFSNTERSLFLRFVWGRTRLPRTIADFRGRDFVIQVLDKYNPPDHFLPESYTCFFLLKLPRYSCKQVLEEKLKYAIHFCKSIDTDDYARIALTGEPAADDSSEDSDNEDADSFASDSTQDYLTGH", "length": 4836 }, "evidence": [ { "id": "45921627", "url": "http://www.informatics.jax.org/homology/45921627", "database": "MGI" }, { "id": "O95714", "url": "https://omabrowser.org/oma/group/O95714/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q4U2R1-1", "protein_name": "E3 ubiquitin-protein ligase HERC2", "gene_name": "Herc2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MPSESFCLAAQSRLDSKWLKTDIQLAFTRDGLCGLWNEMVKDGEIVYTGTELAQNRELPLRKDDGVDAQSGTKKEDLNDKEKKEEEETPAPVYRAKSILESWVWGRQPDVNELKECLSVLVKEQQALAVQSATTTLSALRLKQRLVILERYFIALNRTVFQENVKVKWKSSSISVPPTEKKSARPTGRGVEGLARVGSRAALSFAFAFLRRAWRSGEDADLCSELLQESLDALRALPEASLFDESTVSSVWLEVVERATRFLRSVVTGDVHGTPGTKGPGGVPLQDQHLALAILLELAVQRGTLSQMLSAILLLLQLWDSGAQETDNERSAQGTSAPLLPLLQRFQSIICSKDVPHTESDMHLLSGPLSPNESFLRYLTLPQDNELAIDLRQTAVVVMAHLDRLATPCMPPLCSSPTSHKGSLQEVIGWGLIGWKYYANVIGPIQCEGLASLGVMQVACAEKRFLILSRNGRVYTQAYNSDMLAPQLVQGLASRNIVKIAAHSDGHHYLALAATGEVYSWGCGDGGRLGHGDTVPLEEPKVISAFSGKQAGKHVVHIACGSTYSAAITAEGELYTWGRGNYGRLGHGSSEDEAIPMLVAGLKGLKVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLIEKLQDLDVIKVRCGSQFSIALTKDGQVYSWGKGDNQRLGHGTEEHVRYPKLLEGLQGKKVIDVAAGSTHCLALTEDSEVHSWGSNDQCQHFDTLRVTKPEPTALPGLDSKHIVGIACGPAQSFAWSSCSEWSIGLRVPFVVDICSMTFEQLDLLLRQVSEGMDGTADWPPPQEKECMAVATLNLLRLQLHAAISHQVDPEFLGLGLGSVLLNSLKQTVVTLASSAGVLSTVQSAAQAVLQSGWSVLLPTAEERARALSALLPCTVSGNEVNISPGRRFMIDLLVGSLMADGGLESALNAAITAEIQDIEAKKEAQKEKEIDEQEASASTFHRSRTPLDKDLINTGIYESSGKQCLPLVQLIQQLLRNIASQTVARLKDVARRISSCLDFEQQSCERSASLDLLLRFQRLLISKLYPGEKIGPISDTSSPELMGVGSLLKKYTALVCTHIGDILPVAASIASSSWQHFAEVACVMEGDFTGVLLPELVVSIVLLLSKNASLMQEAGAIPLLGGLLEHLDRFNHLAPGKERDDHEELAWPGIMESFFTGQNCRNNEEVTLIRKADLENHNKDGGFWTVIDGKVYGIKDFQTQSLTGNSILAQFAGEDPVVALEAALQFEDTQESMHAFCVGQYLEPDQEVVTIPDLGSLSSPLIDTERNLGLLLGLHASYLAMSTPLSPVEVECAKWLQSSIFSGGLQTSQIHYSYNEEKDEDHCSSPGGTPISKSRLCSHRWALGDHSQAFLQAIADNNIQDYNVKDFLCQIERYCRQCHLTTPITFPPEHPVEEVGRLLLCCLLKHEDLGHVALSLVHVGTLGIEQVKHRTLPKSVVDVCRVVYQAKCSLIKTHQEQGRSYKEVCAPVIERLRFLFNELRPAVCSDLSIMSKFKLLGSLPRWRRIAQKIIRERRKKRVPKKPESIDSEEKIGNEESDLEEACVLPHSPINVDKRPISMKSPKDKWQPLLNTVTGVHKYKWLKQNVQGLYPQSALLNTIVEFALKEEPVDVEKMRKCLLKQLERAEVRLEGIDTILKLAAKSFLLPSVQYAMFCGWQRLIPEGIDIGEPLTDCLRDVDLIPPFNRMLLEVTFGKLYAWAVQNIRSVLMDASARFKELGIQPVPLQTITNENPAGPSLGTIPQARFLLVMLSMLTLQHGANNLDLLLNSGTLALTQTALRLIGPTCDSVEDDMNASARGASATVLEETRKETAPVQLPVSGPELAAMMKIGTRVMRGVDWKWGDQDGPPPGLGRVIGELGEDGWIRVQWDTGSTNSYRMGKEGKYDLKLVELPVSSQPSAEDSDTEDDSEAEQGERNIHPTAMMLTSVINLLQTLCLSVGVHADIMQSEATKTLCGLLRMLVESGTTDKPAPPDRLVAREQHRSWCTLGFVRSIALTPQACGALSSPRWITLLMKVVEGHAPFTAASLQRQILAVHLLQAVLPSWDKTERARDMKCLVEKLFGFLGSLLTTCSSDVPLLRESTLRKRRARPQASLTATHSSTLAEEVVGLLRTLHSLTQWNGLINKYINSQLCSVTQSYAGKTSERAQLEDYFPDSENLEVGGLMAVLAVIGGIDGRLRLGGQVMHDEFGEGTVTRITPKGRITVQFCDMRMCRVCPLNQLKPLPAVAFSVNNLPFTEPMLSVWAELVNLAGSKLEKHKTKKSAKPAFAGQVDLDLLRSQQLKLYILKAGRALLSHQDKLRQILSQPAVQGTGTLQTDDGAAASPDLGDMSPEGPQPPMILLQQLLSSATQPSPVKAIFDKQELEAAALALCQCLAVESTHPSSPGCEDCSSSEATTPVSVQHIHLARAKKRRQSPAPALPIVVQLMEMGFPRKNIEFALKSLTGTSGNASGLPGVEALVGWLLDHSDVQVTEFSDAETLSDEYSDEEVVEDVDDTPYPVAAGAVVTESQTYKKRADFLSNDDYAVYVRENVQVGMMVRCCRTYEEVCEGDVGKVIKLDRDGLHDLNVQCDWQQKGGTYWVRYIHVELIGYPPPSSSSHIKIGDKVRVKASVTTPKYKWGSVTHQSVGLVKAFSANGKDIIVDFPQQSHWTGLLSEMELVPSIHPGVTCDGCQTFPINGSRFKCRNCDDFDFCETCFKTKKHNTRHTFGRINEPGQSAVFCGRSGKQLKRCHSSQPGMLLDSWSRMVKSLNVSSSVNQASRLIDGSEPCWQSSGSQGKHWIRLEIFPDVLVHRLKMIVDPADSSYMPSLVVVSGGNSLNNLIELKTININQTDTTVPLLSDCAEYHRYIEIAIKQCRSSGIDCKIHGLILLGRIRAEEEDLAAVPFLASDNEEEEDDKGSTGSLIRKKTPGLESTATIRTKVFVWGLNDKDQLGGLKGSKIKVPSFSETLSALNVVQVAGGSKSLFAVTVEGKVYSCGEATNGRLGLGMSSGTVPIPRQITALSSYVVKKVAVHSGGRHATALTVDGKVFSWGEGDDGKLGHFSRMNCDKPRLIEALKTKRIRDIACGSSHSAALTSSGELYTWGLGEYGRLGHGDNTTQLKPKMVKVLLGHRVIQVACGSRDAQTLALTDEGLVFSWGDGDFGKLGRGGSEGCNIPQNIERLNGQGVCQIECGAQFSLALTKSGVVWTWGKGDYFRLGHGSDVHVRKPQVVEGLRGKKIVHVAVGALHCLAVTDSGQVYAWGDNDHGQQGNGTTTVNRKPTLVQGLEGQKITRVACGSSHSVAWTTVDVATPSVHEPVLFQTARDPLGASYLGVPSDADSSSSSNKISGANNCKPNRPSLAKILLSLEGNLAKQQALSHILTALQIMYARDAVVGALMPAGMLAPVECPSFSSSAPASDVSAMASPMHMEDSTLAADLEDRLSPNLWQEKREIVSSEDAVTPSAVTPSAPSASSRPFIPVTDDPGAASIIAETMTKTKEDVESQNKTSGPEPQSLDEFTSLLIPDDTRVVVELLKLSVCSRAGDKGREVLSAVLSGMGTAYPQVADMLLELCVTELEDVATDSQSGRLSSQPVVVESSHPYTDDTSTSGTVKIPGAEGLRVEFDRQCSTERRHDPLTVMDGVNRIVSVRSGREWSDWSSELRIPGDELKWKFISDGSVNGWGWRFTVYPIMPAAGPKDLLSDRCVLSCPSMDLVTCLLDFRLNLTSNRSIVPRLAASLAACAQLSALAASHRMWALQRLRRLLTTEFGQSININRLLGENDGESRALSFTGSALAALVKGLPEALQRQFEYEDPIVRGGKQLLHSPFFKVLVALACDLELDTLPCCAETHKWAWFRRYCMASRVAVALDKRTPLPRLFLDEVAKKIRELMADSESMDVLHESHSIFKREQDEQLVQWMNRRPDDWTLSAGGSGTIYGWGHNHRGQLGGIEGAKVKVPTPCEALATLRPVQLIGGEQTLFAVTADGKLYATGYGAGGRLGIGGTESVSTPTLLESIQHVFIKKVAVNSGGKHCLALSSEGEVYSWGEAEDGKLGHGNRSPCDRPRVIESLRGIEVVDVAAGGAHSACVTAAGDLYTWGKGRYGRLGHSDSEDQLKPKLVEALQGHRVIDIACGSGDAQTLCLTDDDTVWSWGDGDYGKLGRGGSDGCKVPMKIDSLTGLGVVKVECGSQFSVALTKSGAVYTWGKGDYHRLGHGSDDHVRRPRQVQGLQGKKVIAIATGSLHCVCCTEDGEVYTWGDNDEGQLGDGTTNAIQRPRLVAALQGKKVNRVACGSAHTLAWSTSKPASAGKLPAQVPMEYNHLQEIPIIALRNRLLLLHHISELFCPCIPMFDLEGSLDETGLGPSVGFDTLRGILISQGKEAAFRKVVQATMVRDRQHGPVVELNRIQVKRSRSKGGLAGPDGTKSVFGQMCAKMSSFSPDSLLLPHRVWKVKFVGESVDDCGGGYSESIAEICEELQNGLTPLLIVTPNGRDESGANRDCYLLNPATRAPVHCSMFRFLGVLLGIAIRTGSPLSLNLAEPVWKQLAGMSLTIADLSEVDKDFIPGLMYIRDNEATSEEFEAMSLPFTVPSASGQDIQLSSKHTHITLDNRAEYVRLAINYRLHEFDEQVAAVREGMARVVPVPLLSLFTGYELETMVCGSPDIPLHLLKSVATYKGIEPSASLVQWFWEVMESFSNTERSLFLRFVWGRTRLPRTIADFRGRDFVIQVLDKYNPPDHFLPESYTCFFLLKLPRYSCKQVLEEKLKYAIHFCKSIDTDDYARIALTGEPAADDSSEDSDNEDADSFASDSTQDYLTGH", "length": 4836 }, "evidence": [ { "id": "45921627", "url": "http://www.informatics.jax.org/homology/45921627", "database": "MGI" }, { "id": "O95714", "url": "https://omabrowser.org/oma/group/O95714/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9VR91-1", "protein_name": "Probable E3 ubiquitin-protein ligase HERC2", "gene_name": "HERC2", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MFNRQASGGAGSSGQGAGSSQTASAAPVSAGVGVGGGGGASGAAAGAGSAAGSGSGSGSGSAAPPSHSPDLYLRPLPFLDAKWLRADLIASLRNAADGAVLWNHLIQDCELVSSPTAPLLNARGQLSYLGDDGKHYCGAQQLKCSCCQPEYCGPLSACNCDGCRPLDSDTAIKKLTTQAAAQQAAHLSQATDMVLSGWLWSQPPSQQARLDCQRSMISELQELALRAAGNCLSAQHLRQQLFIYERYFVALKRERERERKSTTSAQAVASVTTANTTIAATTANAAVESQPAEQQAEHGALGLARVATHAALNFSFAFLRRAWRSGEDTEMCSELLSEALASLQELPEATLFEAAVVSSLWLEVMERSIKFLRLVALGDPMGNRCTAPLNDRHTALCLLLELGVQKGTLAATLECVVLLLLLWEKDRAGNDNRDMPRKTGAPLQRILLRYQKIGATAKGGGIAGGEPAPVASATETFLRFLSLPKSSAAIVDLRRAAVVIISHLDRMVQPLMPRCLLRGGQATAASSSSAPQQRIYALGWPSLSKDQQGFSAEPTLSWSGESAGVPTLSCRFQIKQVACCETQMLILSQEGKLYTWRLAKPEAEPLPMEEVAHDVFISIAGHCEGRHFLAIDSNHNAYSWGTGEDHRLGHGDTHARAVPTKIAALEQHCVQSVYCGCSYSAAITCGGNLLTWGRGTYARLGHGNSDDRSLPTLVVALSDHMVVDVALGSGDAHSLALTSEGLVFAWGDGDYGKLGNGNCNGSLQPILVESLPRVQRVFAGSQFSVALSSEGQLYTWGKATCLGHQLVERSVQGCSVPRLVSSLQHKRIVDVAVSVAHCLALSSSGEVFGWGRNDSQQICPASVSSEPLLRTPILVSLPTFPASGIACTSAQSLVWTQSSHQGVPRRAPFVVDLGEPTFRLLDQLLGMCSSQDNRQTPNQESECIAVACLNLFRLQLLALIANGVEPRQVGLASGSRLLCSLKTRILGLAGGSQVLRTIQVAAQQALQDGWSVLLPTAAERAQTLTSLLPSEPGQASSAGHRFMTDLLVSSLMAEGGLESALQHAIRLESSSCSADCGDGVHLPLLQLITRLLSNNAALSQTRLSPTLGKQQEKEEEEREQQHQEPSTSPSLSLLHRFQRLLLSHIHQAQPEEETTGAEALLLQYMHALIPACVATLQKAHELALQCREPGENSFGQMVGHLGRVLQADISDALLNELLVGLLLLKRDRPQCLGGLRWARLFLPLLRVLDRLNRALGEGELRDGDDMGWPGIICRGGPKGGPPPADPETHYVRRADMENLLLDGSRCIILAGYVCDLSGYNCESETLRSVLDSGLGKDLTAEMSSQVHRTAMEHILEHHKLGKYMVQASTEEKSSAPGPSRLTHFSSECALAQLLGLVANLMCSGPALQPAELQCRQLDKSSLLSGGLQLLQPSNPFDEEKGEARSSHSCHSTAGNTPTELPPPLPMQQQLAPGRGKSQLQLRADAFISGLAEARVSEPPVAAWLALTERYCKAHNLMWHQEFATEHPVQELERLLSAVLIRHQYLGGLVLNALETEVPPPRQLGEIIRLVHQAKWSVVRTRQQLNRSYKEVCAPILERLRFLLYEVRPAISPQQRGLRRLPILQRPPRFKMLVRRLLQELRSSRQPAKPEDLLNASIQQEQEKKPQSMPKQELEEQEEEETLLRRLNERQIHGEGELDPALMQDIVDFALQDSCDVETARRAMYCQMQRYQLRLAGLQIVQQLLELHGLLDAAQYSLLNGFLGLHLKSTSSGGGSTGSGSSLHVLGQLNMISAYQKARLLLAQSRVLDWAVRELRRLVNQEQQGHARGKDSTNLGTYVLLKRLPRARFLLSVFGLLAKELGPNELGFLINSGLLGTVLGLLAQTGGEGATGGQVHGELSILYEDSVLKQKSSKAQLSGPDLAKLMKIGTRIVRGADWKWGDQDGNPPGEGRIISEVGEDGWVRVEWYTGATNSYRMGKEGQYDLQLADSALNVASPTEPEREDVSGSEASPTSDSHPSKLLRHCAAKLLQILAVGTGLHGAQLDKDALRGMTSMFRTIIYPKPSMSNISYALGWLNLGFIRAISGDCPRLCLELSTPGWLSHYLSLLEQPAGNEAGVYRQLHCLRLLQLILAQWGAEEEPRMPALVHQLFATLGRIALHCPGDASLLPTAEGKARVLLTASHSGSVAEELVALLRRLHTLPSWNPVINSFLAQKLCVAAELLAEQSHSTALDSEQVFVLGVLGAMGGHDLRPRVGLHCFHEGSHMVIASFTPKGRCLLAPGGVGSGVGFVKVQLPAVMPHLDHTVFSLSRLPMNEMLLNAWTVLLYGPAPELRELPSSADGRLDLALLRAQQLQMAVLHTNGVLYRHQVALRRILKQRAPGSIYASPDEPDRSDAESQQPGEQDQQLSSGSGQEPQLLIQCILLRATQASPVKACYSYMDLATAALNCIQSLATQAHQELSEGGGVPPNGRALSSPPQPTMVHGVPVYNVARKEQKPSEQVEQKSKWPAAATDAQLIGQIMEMGFTRRTVELALKQLSLQAEIMPTPEQIVQWILEHPDVCANTIEEDTLPLASSASSHDPEADSDNECPSSNSTTSSSTSSDTVEGQPMAVSGPAPPVKFESRKDFQTADLYALYVRGLVRPGMTVRCCRDFEEIKQGDMGTVLIVDTEGLHDLNVQVDWRNHGSTYWVCFVHIELVEAAQTHHQPRPPPIAVGARVRLRTSSLRYGMLCPLRLGRSQGSSAIGVVSSVRSKQLTVDFPDQPAWQGHINEVELVASQPTSATLPSLGDSCSQMPPSDLIEDWSRCIRSLTVSSNEAAAKHLLNGSNQPWQSCSSGPCRHWIRLELHDRILVHSLTLKVSPEDHSHMPSLLEIRVGDCVDSLKEYTWIPVPAGASRVLLMQQVPTYYPWVEVVVKQCQNNGIQCKIHGIKFVGRRQQPDLQHILANAQFLASEYSAGVGPGSTAGAGAVSTSHEEAAAAPEQDLPCTVMVWGLNDKEQLGGLKGSKVKVPTFSQTISRLRPIHIAGGSKSLFIVSQDGKVYACGEGTNGRLGLGVTHNVPLPHQLPVLRQYVVKKVAVHSGGKHALALTLDGKVFSWGEGEDGKLGHGNRTTLDKPRLVEALRAKKIRDVACGSSHSAAISSQGELYTWGLGEYGRLGHGDNTTQLKPKLVTALAGRRVVQVACGSRDAQTLALTEDGAVFSWGDGDFGKLGRGGSEGSDTPHEIERLSGIGVVQIECGAQFSLALTRAGEVWTWGKGDYYRLGHGGDQHVRKPQPIGGLRGRRVIHVAVGALHCLAVTDAGQVYAWGDNDHGQQGSGNTFVNKKPALVIGLDAVFVNRVACGSSHSIAWGLPNASSDEEKRGPVPFSSTRDPLGGSSLGIYEAETMQTLKQEAKPLNQSSLSESLALETPAARQAALGHVLRAMSILQARQLIVAALTSHSKVNFKERGAVGGEEDHLIGGPIMGAPLQLAETIAQGGGEAPADATDAGLQEHSPEAAVDALTGGMSGGANTLPPLSAGPLSAFQSLTGSLSMSGSLSSSALPQHKHSRMSASAMSVMAATMTQQEEMLSHISHCHGLDDFGGLLGEPEAKSLVELLKLAVCGRCGPPSTSQTIADTLISLGAGTPAVAAMLLETCITELEDLCTSRHCLGKLPKPVMQESSHPYVDNVNVTGVVRIPGAEMLRLEFDSQCSTEKRNDPLVIMDGTGRVLAMRSGREFAHWAPEIRVLGDELRWKFSSDSSVNGWGWRFWVHAIMPAATLGESGSDRAVLSQPSMALVMSLLDSRLAPRQPSVLLRLASALAACSQLGALTTAQRIWSLRKLHAVLLLEQAPRPQDPSLSTLLQPLIPELLRQYEYEEPQVRGGIHLMHSDYFKTLAALACDMQLDAALPATSSSSSSSAAPGAISSTGDVHKWAWFKRYCIAVRVAQSLIRRTELPRAFCLEVRKKFAEMLPSSSSNSNANPGCQSPGASMLNSTTSLSSSTVSNVSPPPGITGEQPDLHCHAHQLESTSTLLHEDHTLFQAPHDAQLLQWLNRRPDDWALSWGGASTIYGWGHNHRGQLGGLEGSRIKTPTPCEALSLLRPVQLAGGEQSLFAVTPDGKLFATGYGSGGRLGVGGSDSWAIPTLLGSLQHVFVKKVAVNSGGKHCLALTTEGEVYAWGEGEDGKLGHGNRMSYDRPKLVEHLNGMSVADIACGSAHSAAITASGHVLTWGKGRYGRLGHGDSEDQLRPKLVEALLGYRAIDIACGSGDAQTLCITDDDNVWSWGDGDYGKLGRGGSDGCKLPYKIESLAGLGVVKVECGSQFSVALTKSGAVYTWGKGDFHRLGHGSVDHVRRPKKVAALQGKKIISIATGSLHCVACSDSGEVYTWGDNDEGQLGDGTVTAIQRPRLVAALQGKHIVKVTCGSAHTLALSTSQLSERLRPLPNPPLEYDLVRDLAPEALHARLILLHHFSELVCPCLAMLPISGDLSLGALKDVLVYNIKEAAFRKVIQTTMVRDKQHGPVIELNRIQVKRSRNRCNGLAGIDGMKSVFGQMVQKLPLLTQEALALPHRVWKVKFVGESVDDCGGGYSESIAEMCDELQNGSVPLLINTPNGRGEAGANRDCFLLDPTLSSVLQMNMFRFLGVLMGIAVRTGSPLSINLAEPVWRQLTGEVLRPTDLTEVDRDYVAGLLCIRNMDDDPKLFTALELPFSTSSARGHEVPLSTRYTHISPRNRAEYVRLALGFRLHEFDEQVKAVRDGMSKVIPVPLLSLFSAAELQAMVCGSPDIPLGLLKSVATYKGFDPSSALVTWFWEVMEEFTNQERSLFLRFVWGRTRLPRTIADFRGRDFVLQVLEKNPPDHFLPESYTCFFLLKMPRYSCKAVLLEKLKYAIHFCKSIDTDEYARVAMGEPTEATGSEDNSDLESVASHEG", "length": 4912 }, "evidence": [ { "id": "O95714", "url": "https://omabrowser.org/oma/group/O95714/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "protein ubiquitination", "id": "GO:0016567", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016567", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" } ], "pmid": "" }, { "name": "DNA repair", "id": "GO:0006281", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006281", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" } ], "pmid": "" }, { "name": "intracellular protein transport", "id": "GO:0006886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006886", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" } ], "pmid": "" }, { "name": "spermatogenesis", "id": "GO:0007283", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007283", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" } ], "pmid": "" }, { "name": "DNA damage response", "id": "GO:0006974", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006974", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" } ], "pmid": "" }, { "name": "proteasome-mediated ubiquitin-dependent protein catabolic process", "id": "GO:0043161", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043161", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "ubiquitin-protein transferase activity", "id": "GO:0004842", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004842", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" } ], "pmid": "" }, { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" } ], "pmid": "" }, { "name": "ubiquitin protein ligase binding", "id": "GO:0031625", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031625", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" } ], "pmid": "" }, { "name": "guanyl-nucleotide exchange factor activity", "id": "GO:0005085", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005085", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" } ], "pmid": "" }, { "name": "ubiquitin protein ligase activity", "id": "GO:0061630", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061630", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" } ], "pmid": "" }, { "name": "SUMO binding", "id": "GO:0032183", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032183", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" } ], "pmid": "" }, { "name": "centriole", "id": "GO:0005814", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005814", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "E3 ubiquitin-protein ligase HERC2 N-glycosylated 1 (human)", "definition": "An E3 ubiquitin-protein ligase HERC2 (human) that has been N-glycosylated at the residue equivalent to Asn-2790 of the amino acid sequence represented by UniProtKB:O95714-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:O95714-1, Asn-2790, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000050928", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050928" } ] } ], "site_annotation": [ { "start_pos": 155, "end_pos": 157, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1833, "end_pos": 1835, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2488, "end_pos": 2490, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2717, "end_pos": 2719, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2790, "end_pos": 2792, "annotation": "n_glycosylation_sequon" }, { "start_pos": 3136, "end_pos": 3138, "annotation": "n_glycosylation_sequon" }, { "start_pos": 3291, "end_pos": 3293, "annotation": "n_glycosylation_sequon" }, { "start_pos": 370, "end_pos": 372, "annotation": "n_glycosylation_sequon" }, { "start_pos": 3746, "end_pos": 3748, "annotation": "n_glycosylation_sequon" }, { "start_pos": 4075, "end_pos": 4077, "annotation": "n_glycosylation_sequon" }, { "start_pos": 922, "end_pos": 924, "annotation": "n_glycosylation_sequon" }, { "start_pos": 977, "end_pos": 979, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylation at Thr-4827 is required for interaction with RNF8.", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" }, { "database": "PubMed", "id": "20023648", "url": "https://glygen.org/publication/PubMed/20023648" } ] }, { "annotation": "Sumoylated with SUMO1 by PIAS4 in response to double-strand breaks (DSBs), promoting the interaction with RNF8.", "evidence": [ { "database": "UniProtKB", "id": "O95714", "url": "https://www.uniprot.org/uniprot/O95714" }, { "database": "PubMed", "id": "22508508", "url": "https://glygen.org/publication/PubMed/22508508" } ] } ], "interactions": [], "reactions": [ { "id": "R-HSA-4551724", "name": "PIAS4 SUMOylates HERC2 with SUMO1", "equation": "", "summary": "PIAS4 SUMOylates HERC2 at an unknown lysine residue with SUMO1 (Danielsen et al. 2012). HERC2 binds SUMO1 and is then SUMOylated. SUMOylation of HERC2 promotes binding to RNF8 at double-strand breaks in DNA.", "cellular_location": "nucleoplasm", "input_participant_list": [ "R-HSA-4551680" ], "output_participant_list": [ "R-HSA-4551758" ], "enzyme_list": [ "P63279-1", "O95714-1", "Q8N2W9-1" ], "evidence": [ { "id": "R-HSA-4551724", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4551724" } ] }, { "id": "R-HSA-5682586", "name": "HERC2 and PIAS4 are recruited to DNA DSBs", "equation": "", "summary": "PIAS4, an E3 SUMO ligase, is recruited to DNA double-strand breaks (DSBs) via an unknown mechanism that requires a DNA-binding SAP domain of PIAS4 (Galanty et al. 2009). HERC2, an E3 ubiquitin ligase and a PIAS4 target, is recruited to DNA DSBs probably through its interaction with ATM (Bekker-Jensen et al. 2010).", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q13315-1", "O96028-1", "Q92993-1", "O76064-1", "P49959-1", "O75164-1", "Q92878-1", "O94953-1", "O95714-1", "Q8N2W9-1" ], "evidence": [ { "id": "R-HSA-5682586", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5682586" } ] }, { "id": "R-HSA-5682598", "name": "ATM phosphorylates HERC2", "equation": "", "summary": "ATM phosphorylates HERC2 on threonine residue T4827. This threonine residue may also be phosphorylated by ATR and DNA-PKcs (PRKDC) (Bekker-Jensen et al. 2010).", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q13315-1", "O96028-1", "Q92993-1", "O76064-1", "P49959-1", "O75164-1", "Q92878-1", "O94953-1", "O95714-1", "Q8N2W9-1" ], "evidence": [ { "id": "R-HSA-5682598", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5682598" } ] }, { "id": "R-HSA-5682607", "name": "PIAS4 SUMOylates HERC2 with SUMO1 at DNA DSBs", "equation": "", "summary": "PIAS4 SUMOylates HERC2 at an unknown lysine residue with SUMO1. ATM activity is needed for PIAS4-mediated HERC2 SUMOylation and it is therefore plausible that the ATM-mediated phosphorylation of HERC2 precedes HERC2 SUMOylation. Once SUMOylated, the ZZ domain of HERC2 interacts with the attached SUMO1 group, probably leading to a conformational change that allows binding of phosphorylated HERC2 to RNF8 (Bekker-Jensen et al. 2010, Danielsen et al. 2012).", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q13315-1", "P63279-1", "O96028-1", "Q92993-1", "O76064-1", "P49959-1", "O75164-1", "Q92878-1", "O94953-1", "O95714-1", "Q8N2W9-1" ], "evidence": [ { "id": "R-HSA-5682607", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5682607" } ] }, { "id": "R-HSA-5682629", "name": "HERC2 facilitates UBE2N:UBE2V2 binding to RNF8", "equation": "", "summary": "HERC2 facilitates binding of the E2 ubiquitin conjugase dimer UBE2N:UBE2V2 (UBC13:MMS2) to RNF8 at DNA double-strand breaks (DSBs) (Kolas et al. 2007, Bekker-Jensen et al. 2010, Campbell et al. 2012).", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q13315-1", "O96028-1", "Q92993-1", "O76064-1", "P49959-1", "O75164-1", "P61088-1", "Q92878-1", "O94953-1", "O95714-1", "Q8N2W9-1" ], "evidence": [ { "id": "R-HSA-5682629", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5682629" } ] }, { "id": "R-HSA-5682858", "name": "RNF8 and RNF168 ubiquitinate H2AFX", "equation": "", "summary": "RNF8 and RNF168 E3 ubiquitin ligases work in concert with the E2 ubiquitin ligase complex UBE2N:UBE2V2 (UBC13:MMS2) to polyubiquitinate histone H2AFX (H2AX) on lysine residues K14 and K16 (commonly labeled in literature as K13 and K15) via ubiquitin lysine K63-directed cross-linking (Mattiroli et al. 2012). The scenario best supported by experimental evidence is that RNF8 initiates ubiquitination of H2AFX, followed by RNF168 binding to and extending ubiquitin chains ligated by RNF8 (Huen et al. 2007, Mailand et al. 2007, Stewart et al. 2009, Doil et al. 2009, Campbell et al. 2012).", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q13315-1", "O96028-1", "Q92993-1", "O76064-1", "P49959-1", "O75164-1", "Q8IYW5-1", "P61088-1", "Q92878-1", "O94953-1", "O95714-1", "Q8N2W9-1" ], "evidence": [ { "id": "R-HSA-5682858", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5682858" } ] }, { "id": "R-HSA-5682863", "name": "RNF168 binds DNA DSBs", "equation": "", "summary": "The recruitment of RNF168, an E3 ubiquitin ligase, to DNA double-strand breaks (DSBs) is facilitated by the interaction of RNF168 with the UBE2N:UBE2V2 (UBC13:MMS2) complex, which serves as the E2 ubiquitin ligase for both RNF8 and RNF168. In addition, because the two RNF168 ubiquitin interaction motifs (UIMs) are needed for the accumulation of RNF168 at DSBs, the initial ubiquitination of H2AFX (H2AX) histones by RNF8 is likely involved in RNF168 recruitment to DSBs. Inactivating mutations in both RNF168 alleles are responsible for the RIDDLE (radiosensitivity, immunodeficiency, dysmorphic features and learning difficulties) syndrome (Stewart et al. 2009, Doil et al. 2009, Bekker-Jensen et al. 2010, Campbell et al. 2012, Mattiroli et al. 2012).", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q13315-1", "O96028-1", "Q92993-1", "O76064-1", "P49959-1", "O75164-1", "Q8IYW5-1", "P61088-1", "Q92878-1", "O94953-1", "O95714-1", "Q8N2W9-1" ], "evidence": [ { "id": "R-HSA-5682863", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5682863" } ] }, { "id": "R-HSA-5683077", "name": "RNF8 and RNF168 ubiquitinate KDM4A,B", "equation": "", "summary": "RNF8 and RNF168 polyubiquitinate KDM4A and KDM4B via ubiquitin lysine K48 cross-linking, leading to dissociation of ubiquitinated KDM4A and KDM4B from H4K20Me2 (Me2-K21-HIST1H4A) and subsequent proteasome-mediated degradation of KDM4A and KDM4B (Mallette et al. 2012).", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q13315-1", "O96028-1", "Q92993-1", "O76064-1", "P49959-1", "O75164-1", "Q8IYW5-1", "P61088-1", "Q92878-1", "O94953-1", "O95714-1", "Q8N2W9-1" ], "evidence": [ { "id": "R-HSA-5683077", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683077" } ] }, { "id": "R-HSA-5683384", "name": "UIMC1 and FAM175A bind DNA DSBs", "equation": "", "summary": "UIMC1 (RAP80) is recruited to DNA double-strand breaks (DSBs) through the interaction of its UIM (ubiquitin interaction motif) region with H2AFX (H2AX) ubiquitinated by RNF8 and RNF168 (Huen et al. 2007, Wang and Elledge 2007, Kolas et al. 2007, Mailand et al. 2007). A simultaneous interaction with FAM175A (Abraxas) through the AIR (Abraxas-interaction region) domain of UIMC1 facilitates UIMC1 binding to DNA DSBs. The interaction between UIMC1 and FAM175A and their loading to DNA DSBs is independent of BRCA1 (Wang et al. 2007, Wang and Elledge 2007).", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q13315-1", "O96028-1", "Q92993-1", "O76064-1", "P49959-1", "Q8IYW5-1", "P61088-1", "Q92878-1", "O95714-1", "Q8N2W9-1" ], "evidence": [ { "id": "R-HSA-5683384", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683384" } ] }, { "id": "R-HSA-5683385", "name": "Formation of BRCA1-A complex at DNA DSBs", "equation": "", "summary": "A DNA damage-independent phosphorylation of FAM175A (Abraxas) serine residue S406 creates a pS-X-X-F (phospho-Ser-X-X-Phe) motif that binds BRCT repeats of BRCA1. The BRCA1 cancer predisposing mutation M1775R (Met1775Arg) inhibits BRCA1 binding to FAM175A. FAM175A interaction with UIMC1 (RAP80) enables BRCA1 recruitment to DNA double-strand breaks (DSBs) (Wang et al. 2007). In addition to BRCA1, FAM175A also interacts with BRCC3 (BRCC36) (Wang et al. 2007, Hu et al. 2011) and BABAM1 (MERIT40, NBA1) (Vikrant et al. 2014). BABAM1 simultaneously interacts with BRE (BRCC45) (Hu et al. 2011). Together, BRCA1, BARD1, UIMC1, FAM175A, BRCC36, BRE and BABAM1 form the so-called BRCA1-A complex at DNA DSBs (Wang et al. 2009).", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P38398-1", "Q13315-1", "P46736-1", "O96028-1", "Q92993-1", "O76064-1", "P49959-1", "Q8IYW5-1", "Q99728-1", "P61088-1", "Q92878-1", "O95714-1", "Q8N2W9-1" ], "evidence": [ { "id": "R-HSA-5683385", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683385" } ] }, { "id": "R-HSA-5683405", "name": "PPP5C dephosphorylates TP53BP1", "equation": "", "summary": "PPP5C-mediated dephosphorylation of TP53BP1 serine residues S25 and S1778 contributes to dissociation of TP53BP1 from DNA doubles strand break (DSB) sites and termination of DSB repair (Kang et al. 2009).", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q13315-1", "P53041-1", "O96028-1", "Q92993-1", "O76064-1", "P49959-1", "Q8IYW5-1", "P61088-1", "Q92878-1", "O95714-1", "Q8N2W9-1" ], "evidence": [ { "id": "R-HSA-5683405", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683405" } ] }, { "id": "R-HSA-5683425", "name": "ATM phosphorylates TP53BP1 at DNA DSBs", "equation": "", "summary": "Activated ATM hyper-phosphorylates TP53BP1 (53BP1) at multiple residues in response to DNA damage (Fernandez-Capetillo et al. 2002, Ward et al. 2003, Jowsey et al. 2007). Phosphorylation of TP53BP1 serine residues S25 and S1778 is important for the retention of TP53BP1 at DNA double-strand break (DSB) sites (Kang et al. 2009).", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q13315-1", "O96028-1", "Q92993-1", "O76064-1", "P49959-1", "Q8IYW5-1", "P61088-1", "Q92878-1", "O95714-1", "Q8N2W9-1" ], "evidence": [ { "id": "R-HSA-5683425", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683425" } ] }, { "id": "R-HSA-5683735", "name": "CHEK2 is recruited to DNA DSBs", "equation": "", "summary": "CHEK2 (CHK2, Cds1) is recruited to DNA double-strand breaks (DSBs) mainly through its interaction with TP53BP1 (53BP1) (Wang et al. 2002), but BRCA1 also contributes to CHEK2 recruitment (Wilson and Stern 2008).", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P38398-1", "O96017-1", "Q13315-1", "P46736-1", "O96028-1", "Q92993-1", "O76064-1", "P49959-1", "Q8IYW5-1", "Q99728-1", "P61088-1", "Q92878-1", "O95714-1", "Q8N2W9-1" ], "evidence": [ { "id": "R-HSA-5683735", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683735" } ] }, { "id": "R-HSA-5683801", "name": "CHEK2 phosphorylates BRCA1", "equation": "", "summary": "Activated CHEK2 phosphorylates BRCA1 on serine residue S988 (Lee et al. 2000), but does not phosphorylate BARD1, the heterodimerization partner of BRCA1 (Kim et al. 2006).", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P38398-1", "O96017-1", "Q13315-1", "P46736-1", "O96028-1", "Q92993-1", "O76064-1", "P49959-1", "Q8IYW5-1", "Q99728-1", "P61088-1", "Q92878-1", "O95714-1", "Q8N2W9-1" ], "evidence": [ { "id": "R-HSA-5683801", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683801" } ] }, { "id": "R-HSA-5684052", "name": "PIAS4 SUMOylates MDC1", "equation": "", "summary": "PIAS4 SUMOylates MDC1 at lysine residue K1840. The exact timing and regulation of this modification is not known (Luo et al. 2012, Yin et al. 2012).", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P38398-1", "Q13315-1", "P46736-1", "P63279-1", "O96028-1", "Q92993-1", "O76064-1", "P49959-1", "Q8IYW5-1", "Q99728-1", "P61088-1", "Q92878-1", "O95714-1", "Q8N2W9-1" ], "evidence": [ { "id": "R-HSA-5684052", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5684052" } ] }, { "id": "R-HSA-5684071", "name": "RNF4 ubiquitinates MDC1", "equation": "", "summary": "SUMOylation of MDC1 by PIAS4 creates a docking site for RNF4, an E3 ubiquitin ligase. RNF4 binds to MDC1 specifically when SUMO2 is attached to lysine K1840 of MDC1. RNF4 polyubiquitinates MDC1 through ubiquitin lysine residue K48 cross-linking. RNF4-mediated ubiquitination targets MDC1 for degradation and causes dissociation of MDC1-bound proteins from DNA double-strand breaks (DSBs). While additional regulation steps may be involved, the activity of RNF4 is necessary for the initiation of resection of DNA ends at DSBs and progression of homologous recombination (Luo et al. 2012, Yin et al. 2012, Galanty et al. 2012).", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P38398-1", "Q13315-1", "P46736-1", "O96028-1", "Q92993-1", "O76064-1", "P49959-1", "Q8IYW5-1", "P78317-1", "Q99728-1", "P61088-1", "Q92878-1", "O95714-1", "Q8N2W9-1" ], "evidence": [ { "id": "R-HSA-5684071", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5684071" } ] }, { "id": "R-HSA-5686685", "name": "RIF1 and PAX1IP bind TP53BP1 at DNA DSBs", "equation": "", "summary": "RIF1 binds TP53BP1 phosphorylated by ATM at DNA double strand breaks (DSBs). RIF1 binding interferes with the accumulation of BRCA1:BARD1 heterodimers and associated proteins at DNA DSBs. Therefore, TP53BP1-mediated recruitment of RIF1 prevents RBBP8 (CtIP) binding to BRCA1:BARD1 and the subsequent resection of DNA DSBs. The action of RIF1 and TP53BP1 promotes non-homologous end joining (NHEJ) of DNA DSBs during G1 phase of the cell cycle, when sister chromatids are not available for homologous recombination-mediated repair (Zimmermann et al. 2013, Escribano-Diaz et al. 2013).

Similar to RIF1, PAX1IP (PTIP) is also recruited to DNA DSBs through interaction with ATM-phosphorylated TP53BP1. Since RIF1 and PAX1IP interact with different phosphorylated sites on TP53BP1, they can simultaneously bind TP53BP1 and colocalize in the majority of TP53BP1 foci. PAX1IP contributes to inhibition of DNA DSB resection mediated by BRCA1-recruited RBBP8 (CtIP) (Callen et al. 2013).", "cellular_location": "nucleoplasm", "input_participant_list": [ "R-HSA-480742", "R-HSA-5619395" ], "output_participant_list": [ "R-HSA-5682574", "R-HSA-5682575", "R-HSA-5682577", "R-HSA-5682579", "R-HSA-5682582" ], "enzyme_list": [ "P38398-1", "Q13315-1", "P46736-1", "O96028-1", "Q92993-1", "O76064-1", "P49959-1", "Q8IYW5-1", "Q99728-1", "P61088-1", "Q92878-1", "O95714-1", "Q8N2W9-1" ], "evidence": [ { "id": "R-HSA-5686685", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686685" } ] }, { "id": "R-HSA-5686704", "name": "Activated ATM phosphorylates DCLRE1C", "equation": "", "summary": "Activated ATM phosphorylates DCLRE1C (ARTEMIS) at serine residue S645. S645 phosphorylation is necessary for the function of DCLRE1C in non-homologous end joining (NHEJ) (Riballo et al. 2004, Poinsignon et al. 2004, Chen et al. 2005).", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [ "R-HSA-5686708" ], "enzyme_list": [ "Q96SD1-1", "Q13315-1", "O96028-1", "Q92993-1", "O76064-1", "P49959-1", "Q8IYW5-1", "P61088-1", "Q92878-1", "O95714-1", "Q8N2W9-1" ], "evidence": [ { "id": "R-HSA-5686704", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686704" } ] }, { "id": "R-HSA-5686900", "name": "TP53BP1 recruits DCLRE1C to ATM", "equation": "", "summary": "TP53BP1 is required for the recruitment of DCLRE1C (ARTEMIS) to DNA double strand breaks (DSBs) and ATM-mediated phosphorylation of DCLRE1C (Riballo et al. 2004). DCRLE1C directly interacts with the TP53BP1-binding protein PAX1IP (PTIP) (Wang et al. 2014).", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q96SD1-1", "Q13315-1", "O96028-1", "Q92993-1", "O76064-1", "P49959-1", "Q8IYW5-1", "P61088-1", "Q92878-1", "O95714-1", "Q8N2W9-1" ], "evidence": [ { "id": "R-HSA-5686900", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686900" } ] }, { "id": "R-HSA-5693551", "name": "Phosphorylation of BRCA1-A complex at multiple sites by ATM", "equation": "", "summary": "ATM phosphorylates BRCA1 at serine residues S1387, S1423, S1457, and S1524 (Cortez et al. 1999, Gatei et al. 2000). At least a fraction of these sites and some additional BRCA1 SQ/TQ sites can also be phosphorylated by ATR (Tibbetts et al. 2000). ATM also phosphorylates BARD1, the heterodimerization partner of BRCA1, at threonine residues T714 and T734 (Kim et al. 2006).", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P38398-1", "Q13315-1", "P46736-1", "O96028-1", "Q92993-1", "O76064-1", "P49959-1", "Q8IYW5-1", "Q99728-1", "P61088-1", "Q92878-1", "O95714-1", "Q8N2W9-1" ], "evidence": [ { "id": "R-HSA-5693551", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693551" } ] }, { "id": "R-HSA-5693566", "name": "TP53BP1 associates with H4K20Me2 at DNA DSBs", "equation": "", "summary": "RNF8- and RNF168-mediated removal of KDM4A and KDM4B from H4K20Me2 (Me2-K21-HIST1H4A) enables TP53BP1 (53BP1) recruitment to WHSC1-methylated histone H4K20Me2 at DNA double-strand breaks (DSBs) (Pei et al. 2011, Mallette et al. 2012)", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q13315-1", "O96028-1", "Q92993-1", "O76064-1", "P49959-1", "Q8IYW5-1", "P61088-1", "Q92878-1", "O95714-1", "Q8N2W9-1" ], "evidence": [ { "id": "R-HSA-5693566", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693566" } ] }, { "id": "R-HSA-5693599", "name": "Association of Ku heterodimer with ends of DNA double-strand break", "equation": "", "summary": "Ionizing radiation (IR) induces single-strand breaks, i.e., cleavage of the phosphodiester backbone. When two single-strand breaks occur within approximately 10 base pairs, a DNA double-strand break (DSB) results. IR-induced DSBs are complex DNA damage lesions, frequently containing base damage, 5'-OH groups, and 3'-hydroxy or phosphoglycolate groups that must be removed prior to ligation in the final step of NHEJ (Friedberg et al, 1995; Nikjoo et al, 2001; Valerie and Povirk, 2003). The Ku70/80 heterodimer (XRCC5:XRCC6) (Walker et al., 2001) binds to the ends of the double-strand break. Ku can translocate inwards from the site of the break in an ATP-independent manner (reviewed in Dynan and Yoo, 1998). Binding of XRCC5:XRCC6 to DNA DSBs competes away the MRN complex and associated proteins from the DNA DSB (Sun et al. 2012).", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q13315-1", "P13010-1", "O96028-1", "Q92993-1", "P12956-1", "O76064-1", "P49959-1", "Q8IYW5-1", "P61088-1", "Q92878-1", "O95714-1", "Q8N2W9-1" ], "evidence": [ { "id": "R-HSA-5693599", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693599" } ] }, { "id": "R-HSA-69891", "name": "Phosphorylation and activation of CHEK2 by ATM", "equation": "", "summary": "Activated ATM phosphorylates CHEK2 (CHK2, Cds1) on threonine residue T68 (Matsuoka et al. 2000, Melchionna et al. 2000). The presence of BRCA1 and TP53BP1 positively regulates ATM-mediated phosphorylation of CHEK2 (Wang et al. 2002, Foray et al. 2003). ATM-mediated phosphorylation causes formation of CHEK2 dimers and dissociation of CHEK2 from chromatin (Li and Stern 2005).", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [ "R-HSA-113825" ], "enzyme_list": [ "P38398-1", "O96017-1", "Q13315-1", "P46736-1", "O96028-1", "Q92993-1", "O76064-1", "P49959-1", "Q8IYW5-1", "Q99728-1", "P61088-1", "Q92878-1", "O95714-1", "Q8N2W9-1" ], "evidence": [ { "id": "R-HSA-69891", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69891" } ] }, { "id": "R-HSA-983140", "name": "Transfer of Ub from E2 to substrate and release of E2", "equation": "", "summary": "Interaction of E3 with both substrate and E2-Ub, brings them into proximity so that ubiquitin is transferred from E2 to the substrate. In most cases the transfer of ubiquitin is direct from E2 to substrate, but in a small subset of E3s, it occurs via a covalent E3-Ub thioester intermediate (Raymond et al. 2009).", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9BYM8-1", "Q9H832-1", "Q969T4-1", "Q7Z7E8-1", "Q9UHC7-1", "Q96PU5-1", "Q9Y2X8-1", "Q9Y4L5-1", "Q8TDB6-1", "Q9NQ86-1", "O43255-1", "Q96BH1-1", "P49427-1", "P61081-1", "P62877-1", "Q8WVD3-1", "Q15386-1", "Q5VVX9-1", "Q86XS8-1", "O94822-1", "Q2Q1W2-1", "O60291-1", "Q5U5Q3-1", "Q96AX9-1", "Q96F44-1", "Q9NVW2-1", "O94874-1", "Q7Z3V4-1", "Q8IUQ4-1", "Q13049-1", "Q9UNE7-1", "Q16763-1", "Q86Y13-1", "Q8TBB1-1", "Q8WV44-1", "Q96PM5-1", "Q9C026-1", "O60260-1", "Q9UBS8-1", "Q9Y252-1", "P60604-1", "Q712K3-1", "Q969K3-1", "O15033-1", "O94972-1", "Q86WT6-1", "Q9H4P4-1", "Q13191-1", "Q14669-1", "Q7Z6Z7-1", "O14933-1", "O95376-1", "P68036-1", "Q96LR5-1", "Q7Z419-1", "Q96J02-1", "Q9BV68-1", "Q969Q1-1", "Q9H0M0-1", "Q9HAU4-1", "Q9HCE7-1", "Q5T447-1", "Q15751-1", "Q9UII4-1", "Q05086-1", "O43164-1", "Q86XT4-1", "P78317-1", "P49459-1", "Q7Z6E9-1", "Q5VTB9-1", "Q5XPI4-1", "Q63HN8-3", "Q6ZMZ0-1", "Q9C0C9-1", "P51668-1", "P61077-1", "Q9Y508-1", "P51965-1", "P61088-1", "P62837-1", "Q6ZNA4-1", "P62253-1", "Q7Z6J8-1", "Q8IWV8-1", "Q8ND25-1", "Q9Y385-1", "Q5T4S7-1", "Q8N7E2-1", "Q8NHG8-1", "Q9HCM9-1", "P19474-1", "Q8WY64-1", "Q9Y4B6-1", "Q6Q0C0-1", "Q6UWE0-1", "Q8N6D2-1", "Q8TC41-1", "Q9NV58-1", "P61086-1", "P46934-1", "P41226-1", "P62256-1", "Q14139-1", "Q96B02-1", "Q9C037-1", "Q8IYU2-1", "Q9P2P5-1", "O95714-1", "Q15034-1", "Q8NG27-1", "Q9BWF2-1", "O94941-1", "P63146-1", "Q5GLZ8-1", "Q5U5R9-1", "Q8IVU3-1", "Q9ULT8-1", "Q7Z6J0-1", "Q9H9P5-4", "Q8IWV7-1", "Q8N2K1-1", "Q969M7-1", "O00762-1", "Q8WVN8-1" ], "evidence": [ { "id": "R-HSA-983140", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983140" } ] }, { "id": "R-HSA-983147", "name": "Release of E3 from polyubiquitinated substrate", "equation": "", "summary": "K48 polyubiquitinated substrate dissociates from E3 to become a substrate for a multicatalytic complex called the 26S proteasome.", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9BYM8-1", "Q9UHC7-1", "Q96PU5-1", "Q9Y4L5-1", "Q8TDB6-1", "Q9NQ86-1", "O43255-1", "Q96BH1-1", "P62877-1", "Q8WVD3-1", "Q15386-1", "Q86XS8-1", "O94822-1", "Q2Q1W2-1", "O60291-1", "Q5U5Q3-1", "Q96AX9-1", "Q96F44-1", "Q9NVW2-1", "O94874-1", "Q7Z3V4-1", "Q8IUQ4-1", "Q13049-1", "Q9UNE7-1", "Q86Y13-1", "Q8TBB1-1", "Q8WV44-1", "Q96PM5-1", "Q9C026-1", "O60260-1", "Q9UBS8-1", "Q9Y252-1", "Q969K3-1", "O15033-1", "O94972-1", "Q86WT6-1", "Q9H4P4-1", "Q13191-1", "Q14669-1", "Q7Z6Z7-1", "O95376-1", "Q7Z419-1", "Q96J02-1", "Q9BV68-1", "Q969Q1-1", "Q9H0M0-1", "Q9HAU4-1", "Q9HCE7-1", "Q5T447-1", "Q15751-1", "Q9UII4-1", "Q05086-1", "O43164-1", "Q86XT4-1", "P78317-1", "Q7Z6E9-1", "Q5VTB9-1", "Q5XPI4-1", "Q63HN8-3", "Q6ZMZ0-1", "Q9Y508-1", "Q6ZNA4-1", "Q7Z6J8-1", "Q8IWV8-1", "Q8ND25-1", "Q5T4S7-1", "Q8N7E2-1", "Q8NHG8-1", "Q9HCM9-1", "P19474-1", "Q8WY64-1", "Q9Y4B6-1", "Q6Q0C0-1", "Q6UWE0-1", "Q8N6D2-1", "Q8TC41-1", "Q9NV58-1", "P46934-1", "Q14139-1", "Q9C037-1", "Q8IYU2-1", "Q9P2P5-1", "O95714-1", "Q15034-1", "Q8NG27-1", "Q9BWF2-1", "O94941-1", "Q5GLZ8-1", "Q5U5R9-1", "Q8IVU3-1", "Q9ULT8-1", "Q7Z6J0-1", "Q9H9P5-4", "Q8IWV7-1" ], "evidence": [ { "id": "R-HSA-983147", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983147" } ] }, { "id": "R-HSA-983156", "name": "Polyubiquitination of substrate", "equation": "", "summary": "Monoubiquitinated substrate acquires additional ubiquitin modifications in the form of multiple single attachments or a ubiquitin chain. Polyubiquitin chains added through K48 residue of ubiquitin typically targets the substrate for degradation (Raymond et al. 2009).", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9BYM8-1", "Q9H832-1", "Q969T4-1", "Q7Z7E8-1", "Q9UHC7-1", "Q96PU5-1", "Q9Y2X8-1", "Q9Y4L5-1", "Q8TDB6-1", "Q9NQ86-1", "O43255-1", "Q96BH1-1", "P49427-1", "P61081-1", "P62877-1", "Q8WVD3-1", "Q15386-1", "Q5VVX9-1", "Q86XS8-1", "O94822-1", "Q2Q1W2-1", "O60291-1", "Q5U5Q3-1", "Q96AX9-1", "Q96F44-1", "Q9NVW2-1", "O94874-1", "Q7Z3V4-1", "Q8IUQ4-1", "Q13049-1", "Q9UNE7-1", "Q16763-1", "Q86Y13-1", "Q8TBB1-1", "Q8WV44-1", "Q96PM5-1", "Q9C026-1", "O60260-1", "Q9UBS8-1", "Q9Y252-1", "P60604-1", "Q712K3-1", "Q969K3-1", "O15033-1", "O94972-1", "Q86WT6-1", "Q9H4P4-1", "Q13191-1", "Q14669-1", "Q7Z6Z7-1", "O14933-1", "O95376-1", "P68036-1", "Q96LR5-1", "Q7Z419-1", "Q96J02-1", "Q9BV68-1", "Q969Q1-1", "Q9H0M0-1", "Q9HAU4-1", "Q9HCE7-1", "Q5T447-1", "Q15751-1", "Q9UII4-1", "Q05086-1", "O43164-1", "Q86XT4-1", "P78317-1", "P49459-1", "Q7Z6E9-1", "Q5VTB9-1", "Q5XPI4-1", "Q63HN8-3", "Q6ZMZ0-1", "Q9C0C9-1", "P51668-1", "P61077-1", "Q9Y508-1", "P51965-1", "P61088-1", "P62837-1", "Q6ZNA4-1", "P62253-1", "Q7Z6J8-1", "Q8IWV8-1", "Q8ND25-1", "Q9Y385-1", "Q5T4S7-1", "Q8N7E2-1", "Q8NHG8-1", "Q9HCM9-1", "P19474-1", "Q8WY64-1", "Q9Y4B6-1", "Q6Q0C0-1", "Q6UWE0-1", "Q8N6D2-1", "Q8TC41-1", "Q9NV58-1", "P61086-1", "P46934-1", "P41226-1", "P62256-1", "Q14139-1", "Q96B02-1", "Q9C037-1", "Q8IYU2-1", "Q9P2P5-1", "O95714-1", "Q15034-1", "Q8NG27-1", "Q9BWF2-1", "O94941-1", "P63146-1", "Q5GLZ8-1", "Q5U5R9-1", "Q8IVU3-1", "Q9ULT8-1", "Q7Z6J0-1", "Q9H9P5-4", "Q8IWV7-1", "Q8N2K1-1", "Q969M7-1", "O00762-1", "Q8WVN8-1" ], "evidence": [ { "id": "R-HSA-983156", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983156" } ] }, { "id": "R-HSA-983157", "name": "Interaction of E3 with substrate and E2-Ub complex", "equation": "", "summary": "Ubiquitin E3 ligases confer specificity to ubiquitination by recognizing target substrates and mediating transfer of ubiquitin from an E2 ubiquitin-conjugating enzyme to substrate (Raymond et al. 2009). E3 ligases includes a large, diverse set of proteins characterized by several defining motifs which include a HECT (homologous to E6-associated C-terminus), RING (Really Interesting New Gene) and U-box domains. The E3 ligases can be multisubunit complexes rather than a single polypeptide. Presently three different kinds of E3 complexes have been described called SCF, APC, and VHL. E3 ligases binds to both substrate and an E2 thioesterified with ubiquitin (E2-Ub).", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9BYM8-1", "Q9H832-1", "Q969T4-1", "Q7Z7E8-1", "Q9UHC7-1", "Q96PU5-1", "Q9Y2X8-1", "Q9Y4L5-1", "Q8TDB6-1", "Q9NQ86-1", "O43255-1", "Q96BH1-1", "P49427-1", "P61081-1", "P62877-1", "Q8WVD3-1", "Q15386-1", "Q5VVX9-1", "Q86XS8-1", "O94822-1", "Q2Q1W2-1", "O60291-1", "Q5U5Q3-1", "Q96AX9-1", "Q96F44-1", "Q9NVW2-1", "O94874-1", "Q7Z3V4-1", "Q8IUQ4-1", "Q13049-1", "Q9UNE7-1", "Q16763-1", "Q86Y13-1", "Q8TBB1-1", "Q8WV44-1", "Q96PM5-1", "Q9C026-1", "O60260-1", "Q9UBS8-1", "Q9Y252-1", "P60604-1", "Q712K3-1", "Q969K3-1", "O15033-1", "O94972-1", "Q86WT6-1", "Q9H4P4-1", "Q13191-1", "Q14669-1", "Q7Z6Z7-1", "O14933-1", "O95376-1", "P68036-1", "Q96LR5-1", "Q7Z419-1", "Q96J02-1", "Q9BV68-1", "Q969Q1-1", "Q9H0M0-1", "Q9HAU4-1", "Q9HCE7-1", "Q5T447-1", "Q15751-1", "Q9UII4-1", "Q05086-1", "O43164-1", "Q86XT4-1", "P78317-1", "P49459-1", "Q7Z6E9-1", "Q5VTB9-1", "Q5XPI4-1", "Q63HN8-3", "Q6ZMZ0-1", "Q9C0C9-1", "P51668-1", "P61077-1", "Q9Y508-1", "P51965-1", "P61088-1", "P62837-1", "Q6ZNA4-1", "P62253-1", "Q7Z6J8-1", "Q8IWV8-1", "Q8ND25-1", "Q9Y385-1", "Q5T4S7-1", "Q8N7E2-1", "Q8NHG8-1", "Q9HCM9-1", "P19474-1", "Q8WY64-1", "Q9Y4B6-1", "Q6Q0C0-1", "Q6UWE0-1", "Q8N6D2-1", "Q8TC41-1", "Q9NV58-1", "P61086-1", "P46934-1", "P41226-1", "P62256-1", "Q14139-1", "Q96B02-1", "Q9C037-1", "Q8IYU2-1", "Q9P2P5-1", "O95714-1", "Q15034-1", "Q8NG27-1", "Q9BWF2-1", "O94941-1", "P63146-1", "Q5GLZ8-1", "Q5U5R9-1", "Q8IVU3-1", "Q9ULT8-1", "Q7Z6J0-1", "Q9H9P5-4", "Q8IWV7-1", "Q8N2K1-1", "Q969M7-1", "O00762-1", "Q8WVN8-1" ], "evidence": [ { "id": "R-HSA-983157", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983157" } ] } ], "reaction_participants": [ { "participant_id": "R-HSA-113825", "participant_name": "p-T68-CHEK2 [nucleoplasm]", "crossref": [ { "id": "ENSG00000183765", "database": "OpenTargets", "url": "" }, { "id": "ENST00000433728", "database": "Ensembl", "url": "" }, { "id": "4BDG", "database": "PDB", "url": "" }, { "id": "2WTC", "database": "PDB", "url": "" }, { "id": "4A9T", "database": "PDB", "url": "" }, { "id": "O96017", "database": "GeneCards", "url": "" }, { "id": "3I6U", "database": "PDB", "url": "" }, { "id": "ENST00000425190", "database": "Ensembl", "url": "" }, { "id": "CHK2_HUMAN", "database": "ZINC - Investigational", "url": "" }, { "id": "ENST00000348295", "database": "Ensembl", "url": "" }, { "id": "2WTJ", "database": "PDB", "url": "" }, { "id": "4A9U", "database": "PDB", "url": "" }, { "id": "2YCQ", "database": "PDB", "url": "" }, { "id": "ENSP00000372023", "database": "Ensembl", "url": "" }, { "id": "2YIT", "database": "PDB", "url": "" }, { "id": "ENSP00000384919", "database": "Ensembl", "url": "" }, { "id": "2YIR", "database": "PDB", "url": "" }, { "id": "ENST00000404276", "database": "Ensembl", "url": "" }, { "id": "2XM8", "database": "PDB", "url": "" }, { "id": "ENST00000650281", "database": "Ensembl", "url": "" }, { "id": "O96017", "database": "UniProt", "url": "" }, { "id": "4BDB", "database": "PDB", "url": "" }, { "id": "4BDK", "database": "PDB", "url": "" }, { "id": "ENSP00000329012", "database": "Ensembl", "url": "" }, { "id": "2WTD", "database": "PDB", "url": "" }, { "id": "CHK2_HUMAN", "database": "ZINC - Predictions - Purchasable", "url": "" }, { "id": "CHK2_HUMAN", "database": "ZINC - World Drugs", "url": "" }, { "id": "2YCS", "database": "PDB", "url": "" }, { "id": "4BDC", "database": "PDB", "url": "" }, { "id": "2XK9", "database": "PDB", "url": "" }, { "id": "ENSP00000386087", "database": "Ensembl", "url": "" }, { "id": "1988", "database": "Guide to Pharmacology - Targets", "url": "" }, { "id": "3I6W", "database": "PDB", "url": "" }, { "id": "ENSP00000385747", "database": "Ensembl", "url": "" }, { "id": "2YCF", "database": "PDB", "url": "" }, { "id": "ENSP00000497000", "database": "Ensembl", "url": "" }, { "id": "O96017", "database": "PRO", "url": "" }, { "id": "2W0J", "database": "PDB", "url": "" }, { "id": "4BDJ", "database": "PDB", "url": "" }, { "id": "15444", "database": "Orphanet", "url": "" }, { "id": "XP_011528147.1", "database": "RefSeq", "url": "" }, { "id": "ENSP00000390244", "database": "Ensembl", "url": "" }, { "id": "HMDBP01248", "database": "HMDB Protein", "url": "" }, { "id": "2W7X", "database": "PDB", "url": "" }, { "id": "2XBJ", "database": "PDB", "url": "" }, { "id": "ENSG00000183765-CHEK2", "database": "HPA", "url": "" }, { "id": "2CN5", "database": "PDB", "url": "" }, { "id": "2WTI", "database": "PDB", "url": "" }, { "id": "ENST00000403642", "database": "Ensembl", "url": "" }, { "id": "O96017", "database": "ZINC target", "url": "" }, { "id": "4BDD", "database": "PDB", "url": "" }, { "id": "4A9R", "database": "PDB", "url": "" }, { "id": "CHK2_HUMAN", "database": "ZINC - Biogenic", "url": "" }, { "id": "ENST00000649563", "database": "Ensembl", "url": "" }, { "id": "O96017", "database": "Pharos - Targets", "url": "" }, { "id": "4BDE", "database": "PDB", "url": "" }, { "id": "NP_665861.1", "database": "RefSeq", "url": "" }, { "id": "XP_016884050.1", "database": "RefSeq", "url": "" }, { "id": "NP_009125.1", "database": "RefSeq", "url": "" }, { "id": "ENSP00000404400", "database": "Ensembl", "url": "" }, { "id": "2XM9", "database": "PDB", "url": "" }, { "id": "ENST00000417588", "database": "Ensembl", "url": "" }, { "id": "4BDH", "database": "PDB", "url": "" }, { "id": "ENSP00000412901", "database": "Ensembl", "url": "" }, { "id": "NP_001005735.1", "database": "RefSeq", "url": "" }, { "id": "ENST00000405598", "database": "Ensembl", "url": "" }, { "id": "4BDF", "database": "PDB", "url": "" }, { "id": "4A9S", "database": "PDB", "url": "" }, { "id": "1GXC", "database": "PDB", "url": "" }, { "id": "2YCR", "database": "PDB", "url": "" }, { "id": "ENST00000382580", "database": "Ensembl", "url": "" }, { "id": "4BDI", "database": "PDB", "url": "" }, { "id": "2CN8", "database": "PDB", "url": "" }, { "id": "4BDA", "database": "PDB", "url": "" }, { "id": "CHK2_HUMAN", "database": "ZINC - Substances", "url": "" }, { "id": "ENSG00000183765", "database": "Ensembl", "url": "" }, { "id": "NP_001244316.1", "database": "RefSeq", "url": "" }, { "id": "ENSP00000404567", "database": "Ensembl", "url": "" }, { "id": "CHK2_HUMAN", "database": "ZINC - FDA approved", "url": "" }, { "id": "3VA4", "database": "PDB", "url": "" }, { "id": "ENSP00000496928", "database": "Ensembl", "url": "" }, { "id": "ENST00000448511", "database": "Ensembl", "url": "" }, { "id": "2YIQ", "database": "PDB", "url": "" } ] }, { "participant_id": "R-HSA-4551680", "participant_name": "HERC2 [nucleoplasm]", "crossref": [ { "id": "O95714", "database": "UniProt", "url": "" }, { "id": "2KEO", "database": "PDB", "url": "" }, { "id": "7Q45", "database": "PDB", "url": "" }, { "id": "7Q46", "database": "PDB", "url": "" }, { "id": "3KCI", "database": "PDB", "url": "" }, { "id": "7Q41", "database": "PDB", "url": "" }, { "id": "NP_004658.3", "database": "RefSeq", "url": "" }, { "id": "22009", "database": "Orphanet", "url": "" }, { "id": "ENSG00000128731-HERC2", "database": "HPA", "url": "" }, { "id": "7Q42", "database": "PDB", "url": "" }, { "id": "ENSG00000128731", "database": "Ensembl", "url": "" }, { "id": "7RGW", "database": "PDB", "url": "" }, { "id": "ENST00000261609", "database": "Ensembl", "url": "" }, { "id": "4L1M", "database": "PDB", "url": "" }, { "id": "ENSP00000261609", "database": "Ensembl", "url": "" }, { "id": "HMDBP08656", "database": "HMDB Protein", "url": "" }, { "id": "O95714", "database": "GeneCards", "url": "" }, { "id": "O95714", "database": "Pharos - Targets", "url": "" }, { "id": "6WW3", "database": "PDB", "url": "" }, { "id": "7Q43", "database": "PDB", "url": "" }, { "id": "ENSG00000128731", "database": "OpenTargets", "url": "" }, { "id": "O95714", "database": "PRO", "url": "" }, { "id": "6WW4", "database": "PDB", "url": "" }, { "id": "7Q44", "database": "PDB", "url": "" }, { "id": "7Q40", "database": "PDB", "url": "" } ] }, { "participant_id": "R-HSA-4551758", "participant_name": "monoSUMO1-HERC2 [nucleoplasm]", "crossref": [ { "id": "ENSP00000261609", "database": "Ensembl", "url": "" }, { "id": "NP_004658.3", "database": "RefSeq", "url": "" }, { "id": "7Q45", "database": "PDB", "url": "" }, { "id": "6WW3", "database": "PDB", "url": "" }, { "id": "ENSG00000128731", "database": "Ensembl", "url": "" }, { "id": "6WW4", "database": "PDB", "url": "" }, { "id": "ENST00000261609", "database": "Ensembl", "url": "" }, { "id": "3KCI", "database": "PDB", "url": "" }, { "id": "ENSG00000128731", "database": "OpenTargets", "url": "" }, { "id": "O95714", "database": "UniProt", "url": "" }, { "id": "O95714", "database": "GeneCards", "url": "" }, { "id": "ENSG00000128731-HERC2", "database": "HPA", "url": "" }, { "id": "7Q40", "database": "PDB", "url": "" }, { "id": "HMDBP08656", "database": "HMDB Protein", "url": "" }, { "id": "22009", "database": "Orphanet", "url": "" }, { "id": "7Q44", "database": "PDB", "url": "" }, { "id": "7Q46", "database": "PDB", "url": "" }, { "id": "7Q43", "database": "PDB", "url": "" }, { "id": "7RGW", "database": "PDB", "url": "" }, { "id": "2KEO", "database": "PDB", "url": "" }, { "id": "O95714", "database": "Pharos - Targets", "url": "" }, { "id": "7Q42", "database": "PDB", "url": "" }, { "id": "O95714", "database": "PRO", "url": "" }, { "id": "7Q41", "database": "PDB", "url": "" }, { "id": "4L1M", "database": "PDB", "url": "" } ] }, { "participant_id": "R-HSA-480742", "participant_name": "RIF1 [nucleoplasm]", "crossref": [ { "id": "Q5UIP0", "database": "UniProt", "url": "" }, { "id": "Q5UIP0", "database": "Pharos - Targets", "url": "" }, { "id": "NP_001171136.1", "database": "RefSeq", "url": "" }, { "id": "NP_060621.3", "database": "RefSeq", "url": "" }, { "id": "Q5UIP0", "database": "GeneCards", "url": "" }, { "id": "Q5UIP0", "database": "PRO", "url": "" }, { "id": "ENSG00000080345-RIF1", "database": "HPA", "url": "" }, { "id": "ENSG00000080345", "database": "OpenTargets", "url": "" }, { "id": "ENSP00000243326", "database": "Ensembl", "url": "" }, { "id": "ENSP00000415691", "database": "Ensembl", "url": "" }, { "id": "ENST00000453091", "database": "Ensembl", "url": "" }, { "id": "ENST00000444746", "database": "Ensembl", "url": "" }, { "id": "XP_005246722.1", "database": "RefSeq", "url": "" }, { "id": "ENSG00000080345", "database": "Ensembl", "url": "" }, { "id": "ENSP00000414615", "database": "Ensembl", "url": "" }, { "id": "NP_001171134.1", "database": "RefSeq", "url": "" }, { "id": "ENST00000430328", "database": "Ensembl", "url": "" }, { "id": "NP_001171135.1", "database": "RefSeq", "url": "" }, { "id": "ENST00000428287", "database": "Ensembl", "url": "" }, { "id": "ENSP00000390181", "database": "Ensembl", "url": "" }, { "id": "ENST00000243326", "database": "Ensembl", "url": "" }, { "id": "ENSP00000416123", "database": "Ensembl", "url": "" } ] }, { "participant_id": "R-HSA-5619395", "participant_name": "PAXIP1 [nucleoplasm]", "crossref": [ { "id": "Q6ZW49", "database": "UniProt", "url": "" }, { "id": "3SQD", "database": "PDB", "url": "" }, { "id": "XP_016867370.1", "database": "RefSeq", "url": "" }, { "id": "Q6ZW49", "database": "GeneCards", "url": "" }, { "id": "Q6ZW49", "database": "Pharos - Targets", "url": "" }, { "id": "ENST00000404141", "database": "Ensembl", "url": "" }, { "id": "XP_005249596.1", "database": "RefSeq", "url": "" }, { "id": "ENSP00000384048", "database": "Ensembl", "url": "" }, { "id": "ENSG00000157212", "database": "Ensembl", "url": "" }, { "id": "Q6ZW49", "database": "PRO", "url": "" }, { "id": "NP_031375.3", "database": "RefSeq", "url": "" }, { "id": "ENSG00000157212-PAXIP1", "database": "HPA", "url": "" }, { "id": "ENSG00000157212", "database": "OpenTargets", "url": "" } ] }, { "participant_id": "R-HSA-5682574", "participant_name": "UIMC1 [nucleoplasm]", "crossref": [ { "id": "ENSG00000087206", "database": "OpenTargets", "url": "" }, { "id": "ENSP00000366434", "database": "Ensembl", "url": "" }, { "id": "NP_001186226.1", "database": "RefSeq", "url": "" }, { "id": "ENST00000511320", "database": "Ensembl", "url": "" }, { "id": "ENSP00000427480", "database": "Ensembl", "url": "" }, { "id": "XP_016865063.1", "database": "RefSeq", "url": "" }, { "id": "Q96RL1", "database": "PRO", "url": "" }, { "id": "NP_001304890.1", "database": "RefSeq", "url": "" }, { "id": "XP_005265993.1", "database": "RefSeq", "url": "" }, { "id": "ENSG00000087206", "database": "Ensembl", "url": "" }, { "id": "XP_006714934.1", "database": "RefSeq", "url": "" }, { "id": "ENST00000377227", "database": "Ensembl", "url": "" }, { "id": "Q96RL1", "database": "GeneCards", "url": "" }, { "id": "2RR9", "database": "PDB", "url": "" }, { "id": "NP_001186227.1", "database": "RefSeq", "url": "" }, { "id": "ENST00000506128", "database": "Ensembl", "url": "" }, { "id": "2MKG", "database": "PDB", "url": "" }, { "id": "2MKF", "database": "PDB", "url": "" }, { "id": "XP_016865067.1", "database": "RefSeq", "url": "" }, { "id": "ENSP00000421926", "database": "Ensembl", "url": "" }, { "id": "ENST00000510698", "database": "Ensembl", "url": "" }, { "id": "XP_005265987.1", "database": "RefSeq", "url": "" }, { "id": "Q96RL1", "database": "UniProt", "url": "" }, { "id": "ENSP00000423717", "database": "Ensembl", "url": "" }, { "id": "2N9E", "database": "PDB", "url": "" }, { "id": "NP_057374.3", "database": "RefSeq", "url": "" }, { "id": "ENSG00000087206-UIMC1", "database": "HPA", "url": "" }, { "id": "XP_016865068.1", "database": "RefSeq", "url": "" }, { "id": "Q96RL1", "database": "Pharos - Targets", "url": "" } ] }, { "participant_id": "R-HSA-5682575", "participant_name": "p-S406-FAM175A [nucleoplasm]", "crossref": [ { "id": "NP_620775.2", "database": "RefSeq", "url": "" }, { "id": "ENST00000321945", "database": "Ensembl", "url": "" }, { "id": "24528", "database": "Orphanet", "url": "" }, { "id": "4Y2G", "database": "PDB", "url": "" }, { "id": "Q6UWZ7", "database": "PRO", "url": "" }, { "id": "4Y18", "database": "PDB", "url": "" }, { "id": "Q6UWZ7", "database": "GeneCards", "url": "" }, { "id": "Q6UWZ7", "database": "UniProt", "url": "" }, { "id": "Q6UWZ7", "database": "Pharos - Targets", "url": "" }, { "id": "4JLU", "database": "PDB", "url": "" }, { "id": "ENSG00000163322", "database": "Ensembl", "url": "" }, { "id": "ENSG00000163322-ABRAXAS1", "database": "HPA", "url": "" }, { "id": "4U4A", "database": "PDB", "url": "" }, { "id": "ENSP00000369857", "database": "Ensembl", "url": "" }, { "id": "NP_001332891.1", "database": "RefSeq", "url": "" } ] }, { "participant_id": "R-HSA-5682577", "participant_name": "BRCC3 [nucleoplasm]", "crossref": [ { "id": "ENST00000369459", "database": "Ensembl", "url": "" }, { "id": "ENSP00000328641", "database": "Ensembl", "url": "" }, { "id": "NP_077308.1", "database": "RefSeq", "url": "" }, { "id": "HMDBP13773", "database": "HMDB Protein", "url": "" }, { "id": "ENST00000340647", "database": "Ensembl", "url": "" }, { "id": "ENSP00000358471", "database": "Ensembl", "url": "" }, { "id": "6H3C", "database": "PDB", "url": "" }, { "id": "NP_001018065.1", "database": "RefSeq", "url": "" }, { "id": "ENSG00000185515-BRCC3", "database": "HPA", "url": "" }, { "id": "ENSG00000185515", "database": "OpenTargets", "url": "" }, { "id": "ENST00000369462", "database": "Ensembl", "url": "" }, { "id": "P46736", "database": "UniProt", "url": "" }, { "id": "P46736", "database": "Pharos - Targets", "url": "" }, { "id": "ENSP00000358474", "database": "Ensembl", "url": "" }, { "id": "ENST00000330045", "database": "Ensembl", "url": "" }, { "id": "P46736", "database": "GeneCards", "url": "" }, { "id": "ENSP00000344103", "database": "Ensembl", "url": "" }, { "id": "XP_016885327.1", "database": "RefSeq", "url": "" }, { "id": "NP_001229569.1", "database": "RefSeq", "url": "" }, { "id": "ENSG00000185515", "database": "Ensembl", "url": "" }, { "id": "6R8F", "database": "PDB", "url": "" }, { "id": "20200", "database": "Orphanet", "url": "" }, { "id": "P46736", "database": "PRO", "url": "" } ] }, { "participant_id": "R-HSA-5682579", "participant_name": "BRE [nucleoplasm]", "crossref": [ { "id": "NP_001248769.1", "database": "RefSeq", "url": "" }, { "id": "6R8F", "database": "PDB", "url": "" }, { "id": "6H3C", "database": "PDB", "url": "" }, { "id": "ENSP00000343412", "database": "Ensembl", "url": "" }, { "id": "ENSP00000354699", "database": "Ensembl", "url": "" }, { "id": "NP_001316042.1", "database": "RefSeq", "url": "" }, { "id": "Q9NXR7", "database": "PRO", "url": "" }, { "id": "ENSP00000368953", "database": "Ensembl", "url": "" }, { "id": "NP_954664.1", "database": "RefSeq", "url": "" }, { "id": "ENSP00000368945", "database": "Ensembl", "url": "" }, { "id": "NP_954662.1", "database": "RefSeq", "url": "" }, { "id": "Q9NXR7", "database": "Pharos - Targets", "url": "" }, { "id": "HMDBP13806", "database": "HMDB Protein", "url": "" }, { "id": "ENST00000379632", "database": "Ensembl", "url": "" }, { "id": "ENSP00000339371", "database": "Ensembl", "url": "" }, { "id": "Q9NXR7", "database": "GeneCards", "url": "" }, { "id": "ENST00000344773", "database": "Ensembl", "url": "" }, { "id": "ENSG00000158019-BABAM2", "database": "HPA", "url": "" }, { "id": "ENSG00000158019", "database": "Ensembl", "url": "" }, { "id": "NP_954661.1", "database": "RefSeq", "url": "" }, { "id": "Q9NXR7", "database": "UniProt", "url": "" }, { "id": "NP_001316041.1", "database": "RefSeq", "url": "" }, { "id": "ENST00000342045", "database": "Ensembl", "url": "" }, { "id": "NP_954663.1", "database": "RefSeq", "url": "" }, { "id": "ENST00000361704", "database": "Ensembl", "url": "" }, { "id": "ENST00000379624", "database": "Ensembl", "url": "" }, { "id": "NP_004890.2", "database": "RefSeq", "url": "" } ] }, { "participant_id": "R-HSA-5682582", "participant_name": "BABAM1 [nucleoplasm]", "crossref": [ { "id": "NP_001275685.1", "database": "RefSeq", "url": "" }, { "id": "Q9NWV8", "database": "GeneCards", "url": "" }, { "id": "ENSG00000105393", "database": "OpenTargets", "url": "" }, { "id": "ENSP00000470920", "database": "Ensembl", "url": "" }, { "id": "Q9NWV8", "database": "PRO", "url": "" }, { "id": "6H3C", "database": "PDB", "url": "" }, { "id": "ENSP00000352408", "database": "Ensembl", "url": "" }, { "id": "NP_001028721.1", "database": "RefSeq", "url": "" }, { "id": "ENSG00000105393", "database": "Ensembl", "url": "" }, { "id": "ENSG00000105393-BABAM1", "database": "HPA", "url": "" }, { "id": "ENST00000359435", "database": "Ensembl", "url": "" }, { "id": "ENST00000601043", "database": "Ensembl", "url": "" }, { "id": "NP_001275686.1", "database": "RefSeq", "url": "" }, { "id": "Q9NWV8", "database": "Pharos - Targets", "url": "" }, { "id": "Q9NWV8", "database": "UniProt", "url": "" }, { "id": "ENST00000598188", "database": "Ensembl", "url": "" }, { "id": "NP_054892.2", "database": "RefSeq", "url": "" }, { "id": "ENSP00000471605", "database": "Ensembl", "url": "" }, { "id": "HMDBP13781", "database": "HMDB Protein", "url": "" } ] }, { "participant_id": "R-HSA-5686708", "participant_name": "p-S645-DCLRE1C [nucleoplasm]", "crossref": [ { "id": "ENST00000697075", "database": "Ensembl", "url": "" }, { "id": "XP_006717554.1", "database": "RefSeq", "url": "" }, { "id": "ENST00000396817", "database": "Ensembl", "url": "" }, { "id": "NP_001276005.1", "database": "RefSeq", "url": "" }, { "id": "ENSG00000152457", "database": "Ensembl", "url": "" }, { "id": "NP_001029030.1", "database": "RefSeq", "url": "" }, { "id": "XP_011517918.1", "database": "RefSeq", "url": "" }, { "id": "ENSP00000367527", "database": "Ensembl", "url": "" }, { "id": "ENST00000357717", "database": "Ensembl", "url": "" }, { "id": "NP_001276008.1", "database": "RefSeq", "url": "" }, { "id": "ENST00000378278", "database": "Ensembl", "url": "" }, { "id": "ENSP00000367496", "database": "Ensembl", "url": "" }, { "id": "NP_001276007.1", "database": "RefSeq", "url": "" }, { "id": "ENST00000378258", "database": "Ensembl", "url": "" }, { "id": "NP_001029027.1", "database": "RefSeq", "url": "" }, { "id": "6WNL", "database": "PDB", "url": "" }, { "id": "ENSP00000367538", "database": "Ensembl", "url": "" }, { "id": "7TYR", "database": "PDB", "url": "" }, { "id": "ENSP00000367502", "database": "Ensembl", "url": "" }, { "id": "ENSP00000367506", "database": "Ensembl", "url": "" }, { "id": "ENSP00000513090", "database": "Ensembl", "url": "" }, { "id": "NP_071932.2", "database": "RefSeq", "url": "" }, { "id": "7ABS", "database": "PDB", "url": "" }, { "id": "ENSG00000152457-DCLRE1C", "database": "HPA", "url": "" }, { "id": "ENST00000378246", "database": "Ensembl", "url": "" }, { "id": "XP_011517919.1", "database": "RefSeq", "url": "" }, { "id": "ENSP00000380030", "database": "Ensembl", "url": "" }, { "id": "NP_001276006.1", "database": "RefSeq", "url": "" }, { "id": "ENSP00000367492", "database": "Ensembl", "url": "" }, { "id": "ENSP00000350349", "database": "Ensembl", "url": "" }, { "id": "3W1B", "database": "PDB", "url": "" }, { "id": "7AF1", "database": "PDB", "url": "" }, { "id": "7SGL", "database": "PDB", "url": "" }, { "id": "6TT5", "database": "PDB", "url": "" }, { "id": "XP_016872046.1", "database": "RefSeq", "url": "" }, { "id": "Q96SD1", "database": "UniProt", "url": "" }, { "id": "XP_011517921.1", "database": "RefSeq", "url": "" }, { "id": "ENST00000378254", "database": "Ensembl", "url": "" }, { "id": "4HTP", "database": "PDB", "url": "" }, { "id": "ENST00000378249", "database": "Ensembl", "url": "" }, { "id": "ENSG00000152457", "database": "OpenTargets", "url": "" }, { "id": "NP_001029029.1", "database": "RefSeq", "url": "" }, { "id": "ENST00000378289", "database": "Ensembl", "url": "" }, { "id": "3W1G", "database": "PDB", "url": "" }, { "id": "ENST00000378255", "database": "Ensembl", "url": "" }, { "id": "ENSP00000367503", "database": "Ensembl", "url": "" }, { "id": "XP_016872047.1", "database": "RefSeq", "url": "" }, { "id": "Q96SD1", "database": "PRO", "url": "" }, { "id": "7AFU", "database": "PDB", "url": "" }, { "id": "15852", "database": "Orphanet", "url": "" }, { "id": "7AFS", "database": "PDB", "url": "" }, { "id": "7AGI", "database": "PDB", "url": "" }, { "id": "Q96SD1", "database": "Pharos - Targets", "url": "" }, { "id": "7APV", "database": "PDB", "url": "" }, { "id": "6WO0", "database": "PDB", "url": "" }, { "id": "Q96SD1", "database": "GeneCards", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "O00762", "gene_name": "UBE2C", "activity": [ { "ec_number": "2.3.2.24", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "O00762", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00762" } ] }, { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "O00762", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00762" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "O00762", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00762" } ] } ] }, { "uniprot_ac": "O14933", "gene_name": "UBE2L6", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "O14933", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14933" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "O14933", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14933" } ] } ] }, { "uniprot_ac": "O15033", "gene_name": "AREL1", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "O15033", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15033" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "O15033", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15033" } ] } ] }, { "uniprot_ac": "O43164", "gene_name": "PJA2", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "O43164", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43164" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "O43164", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43164" } ] } ] }, { "uniprot_ac": "O43255", "gene_name": "SIAH2", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "O43255", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43255" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "O43255", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43255" } ] } ] }, { "uniprot_ac": "O60260", "gene_name": "PRKN", "activity": [ { "ec_number": "2.3.2.31", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.", "evidence": [ { "id": "O60260", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60260" } ] }, { "ec_number": "2.3.2.31", "activity": "", "evidence": [ { "id": "O60260", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60260" } ] }, { "ec_number": "6.3.2.19", "activity": "", "evidence": [ { "id": "O60260", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60260" } ] } ] }, { "uniprot_ac": "O60291", "gene_name": "MGRN1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "O60291", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60291" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "O60291", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60291" } ] } ] }, { "uniprot_ac": "O75164", "gene_name": "KDM4A", "activity": [ { "ec_number": "1.14.11.69", "activity": "2 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(36)-[histone H3] + 2 O2 = 2 CO2 + 2 formaldehyde + N(6)-methyl-L-lysyl(36)-[histone H3] + 2 succinate.", "evidence": [ { "id": "O75164", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75164" } ] }, { "ec_number": "1.14.11.66", "activity": "2 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(9)-[histone H3] + 2 O2 = 2 CO2 + 2 formaldehyde + N(6)-methyl-L-lysyl(9)-[histone H3] + 2 succinate.", "evidence": [ { "id": "O75164", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75164" } ] }, { "ec_number": "1.14.11.66", "activity": "", "evidence": [ { "id": "O75164", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75164" } ] }, { "ec_number": "1.14.11.69", "activity": "", "evidence": [ { "id": "O75164", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75164" } ] } ] }, { "uniprot_ac": "O76064", "gene_name": "RNF8", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "O76064", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O76064" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "O76064", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O76064" } ] } ] }, { "uniprot_ac": "O94822", "gene_name": "LTN1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "O94822", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O94822" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "O94822", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O94822" } ] } ] }, { "uniprot_ac": "O94874", "gene_name": "UFL1", "activity": [ { "ec_number": "2.3.2.-", "activity": "", "evidence": [ { "id": "O94874", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O94874" } ] } ] }, { "uniprot_ac": "O94941", "gene_name": "UBOX5", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "O94941", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O94941" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "O94941", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O94941" } ] } ] }, { "uniprot_ac": "O94953", "gene_name": "KDM4B", "activity": [ { "ec_number": "1.14.11.66", "activity": "2 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(9)-[histone H3] + 2 O2 = 2 CO2 + 2 formaldehyde + N(6)-methyl-L-lysyl(9)-[histone H3] + 2 succinate.", "evidence": [ { "id": "O94953", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O94953" } ] }, { "ec_number": "1.14.11.66", "activity": "", "evidence": [ { "id": "O94953", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O94953" } ] } ] }, { "uniprot_ac": "O94972", "gene_name": "TRIM37", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "O94972", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O94972" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "O94972", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O94972" } ] } ] }, { "uniprot_ac": "O95376", "gene_name": "ARIH2", "activity": [ { "ec_number": "2.3.2.31", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.", "evidence": [ { "id": "O95376", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95376" } ] }, { "ec_number": "2.3.2.31", "activity": "", "evidence": [ { "id": "O95376", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95376" } ] } ] }, { "uniprot_ac": "O95714", "gene_name": "HERC2", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "O95714", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95714" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "O95714", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95714" } ] } ] }, { "uniprot_ac": "O96017", "gene_name": "CHEK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O96017", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O96017" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O96017", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O96017" } ] } ] }, { "uniprot_ac": "O96028", "gene_name": "NSD2", "activity": [ { "ec_number": "2.1.1.357", "activity": "L-lysyl(36)-[histone H3] + 2 S-adenosyl-L-methionine = 2 H(+) + N(6),N(6)-dimethyl-L-lysyl(36)-[histone H3] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "O96028", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O96028" } ] }, { "ec_number": "2.1.1.357", "activity": "", "evidence": [ { "id": "O96028", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O96028" } ] } ] }, { "uniprot_ac": "P12956", "gene_name": "XRCC6", "activity": [ { "ec_number": "4.2.99.-", "activity": "", "evidence": [ { "id": "P12956", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12956" } ] }, { "ec_number": "3.6.4.-", "activity": "", "evidence": [ { "id": "P12956", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12956" } ] } ] }, { "uniprot_ac": "P13010", "gene_name": "XRCC5", "activity": [ { "ec_number": "3.6.4.-", "activity": "", "evidence": [ { "id": "P13010", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13010" } ] } ] }, { "uniprot_ac": "P19474", "gene_name": "TRIM21", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "P19474", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19474" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "P19474", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19474" } ] } ] }, { "uniprot_ac": "P38398", "gene_name": "BRCA1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "P38398", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38398" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "P38398", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38398" } ] } ] }, { "uniprot_ac": "P41226", "gene_name": "UBA7", "activity": [ { "ec_number": "6.2.1.-", "activity": "", "evidence": [ { "id": "P41226", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41226" } ] } ] }, { "uniprot_ac": "P46736", "gene_name": "BRCC3", "activity": [ { "ec_number": "3.4.19.-", "activity": "", "evidence": [ { "id": "P46736", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46736" } ] } ] }, { "uniprot_ac": "P46934", "gene_name": "NEDD4", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "P46934", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46934" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "P46934", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46934" } ] } ] }, { "uniprot_ac": "P49427", "gene_name": "CDC34", "activity": [ { "ec_number": "2.3.2.24", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "P49427", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49427" } ] }, { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P49427", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49427" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P49427", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49427" } ] } ] }, { "uniprot_ac": "P49459", "gene_name": "UBE2A", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P49459", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49459" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P49459", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49459" } ] } ] }, { "uniprot_ac": "P49959", "gene_name": "MRE11", "activity": [ { "ec_number": "3.1.-.-", "activity": "", "evidence": [ { "id": "P49959", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49959" } ] } ] }, { "uniprot_ac": "P51668", "gene_name": "UBE2D1", "activity": [ { "ec_number": "2.3.2.24", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "P51668", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51668" } ] }, { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P51668", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51668" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P51668", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51668" } ] } ] }, { "uniprot_ac": "P51965", "gene_name": "UBE2E1", "activity": [ { "ec_number": "2.3.2.24", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "P51965", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51965" } ] }, { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P51965", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51965" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P51965", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51965" } ] } ] }, { "uniprot_ac": "P53041", "gene_name": "PPP5C", "activity": [ { "ec_number": "3.1.3.16", "activity": "H2O + O-phospho-L-threonyl-[protein] = L-threonyl-[protein] + phosphate.", "evidence": [ { "id": "P53041", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53041" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "P53041", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53041" } ] } ] }, { "uniprot_ac": "P60604", "gene_name": "UBE2G2", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P60604", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60604" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P60604", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60604" } ] } ] }, { "uniprot_ac": "P61077", "gene_name": "UBE2D3", "activity": [ { "ec_number": "2.3.2.24", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "P61077", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61077" } ] }, { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P61077", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61077" } ] }, { "ec_number": "2.3.2.24", "activity": "", "evidence": [ { "id": "P61077", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61077" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P61077", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61077" } ] } ] }, { "uniprot_ac": "P61081", "gene_name": "UBE2M", "activity": [ { "ec_number": "2.3.2.34", "activity": "[E1 NEDD8-activating enzyme]-S-[NEDD8 protein]-yl-L-cysteine + [E2 NEDD8-conjugating enzyme]-L-cysteine = [E1 NEDD8-activating enzyme]-L-cysteine + [E2 NEDD8-conjugating enzyme]-S-[NEDD8-protein]-yl-L-cysteine.", "evidence": [ { "id": "P61081", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61081" } ] }, { "ec_number": "2.3.2.34", "activity": "", "evidence": [ { "id": "P61081", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61081" } ] } ] }, { "uniprot_ac": "P61086", "gene_name": "UBE2K", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P61086", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61086" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P61086", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61086" } ] } ] }, { "uniprot_ac": "P61088", "gene_name": "UBE2N", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P61088", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61088" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P61088", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61088" } ] } ] }, { "uniprot_ac": "P62253", "gene_name": "UBE2G1", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P62253", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62253" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P62253", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62253" } ] } ] }, { "uniprot_ac": "P62256", "gene_name": "UBE2H", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P62256", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62256" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P62256", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62256" } ] }, { "ec_number": "2.3.2.24", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "P62256", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62256" } ] } ] }, { "uniprot_ac": "P62837", "gene_name": "UBE2D2", "activity": [ { "ec_number": "2.3.2.24", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "P62837", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62837" } ] }, { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P62837", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62837" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P62837", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62837" } ] } ] }, { "uniprot_ac": "P62877", "gene_name": "RBX1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "P62877", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62877" } ] }, { "ec_number": "2.3.2.32", "activity": "S-[NEDD8-protein]-yl-[E2 NEDD8-conjugating enzyme]-L-cysteine + [cullin]-L-lysine = [E2 NEDD8-conjugating enzyme]-L-cysteine + N(6)-[NEDD8-protein]-yl-[cullin]-L-lysine.", "evidence": [ { "id": "P62877", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62877" } ] }, { "ec_number": "2.3.2.32", "activity": "", "evidence": [ { "id": "P62877", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62877" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "P62877", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62877" } ] } ] }, { "uniprot_ac": "P63146", "gene_name": "UBE2B", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P63146", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63146" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P63146", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63146" } ] } ] }, { "uniprot_ac": "P63279", "gene_name": "UBE2I", "activity": [ { "ec_number": "2.3.2.-", "activity": "", "evidence": [ { "id": "P63279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63279" } ] } ] }, { "uniprot_ac": "P68036", "gene_name": "UBE2L3", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P68036", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68036" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P68036", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68036" } ] } ] }, { "uniprot_ac": "P78317", "gene_name": "RNF4", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "P78317", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78317" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "P78317", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78317" } ] } ] }, { "uniprot_ac": "Q05086", "gene_name": "UBE3A", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q05086", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05086" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q05086", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05086" } ] } ] }, { "uniprot_ac": "Q13049", "gene_name": "TRIM32", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q13049", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13049" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q13049", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13049" } ] } ] }, { "uniprot_ac": "Q13191", "gene_name": "CBLB", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q13191", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13191" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q13191", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13191" } ] } ] }, { "uniprot_ac": "Q13315", "gene_name": "ATM", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q13315", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13315" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q13315", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13315" } ] } ] }, { "uniprot_ac": "Q14139", "gene_name": "UBE4A", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q14139", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14139" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q14139", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14139" } ] } ] }, { "uniprot_ac": "Q14669", "gene_name": "TRIP12", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q14669", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14669" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q14669", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14669" } ] } ] }, { "uniprot_ac": "Q15034", "gene_name": "HERC3", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q15034", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15034" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q15034", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15034" } ] } ] }, { "uniprot_ac": "Q15386", "gene_name": "UBE3C", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q15386", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15386" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q15386", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15386" } ] } ] }, { "uniprot_ac": "Q15751", "gene_name": "HERC1", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q15751", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15751" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q15751", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15751" } ] } ] }, { "uniprot_ac": "Q16763", "gene_name": "UBE2S", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "Q16763", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16763" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "Q16763", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16763" } ] } ] }, { "uniprot_ac": "Q2Q1W2", "gene_name": "TRIM71", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q2Q1W2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2Q1W2" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q2Q1W2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2Q1W2" } ] } ] }, { "uniprot_ac": "Q5GLZ8", "gene_name": "HERC4", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q5GLZ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5GLZ8" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q5GLZ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5GLZ8" } ] } ] }, { "uniprot_ac": "Q5T447", "gene_name": "HECTD3", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q5T447", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5T447" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q5T447", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5T447" } ] } ] }, { "uniprot_ac": "Q5T4S7", "gene_name": "UBR4", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q5T4S7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5T4S7" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q5T4S7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5T4S7" } ] } ] }, { "uniprot_ac": "Q5U5Q3", "gene_name": "MEX3C", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q5U5Q3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5U5Q3" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q5U5Q3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5U5Q3" } ] } ] }, { "uniprot_ac": "Q5U5R9", "gene_name": "HECTD2", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q5U5R9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5U5R9" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q5U5R9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5U5R9" } ] } ] }, { "uniprot_ac": "Q5VTB9", "gene_name": "RNF220", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q5VTB9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5VTB9" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q5VTB9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5VTB9" } ] } ] }, { "uniprot_ac": "Q5VVX9", "gene_name": "UBE2U", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "Q5VVX9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5VVX9" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "Q5VVX9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5VVX9" } ] } ] }, { "uniprot_ac": "Q5XPI4", "gene_name": "RNF123", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q5XPI4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XPI4" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q5XPI4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XPI4" } ] } ] }, { "uniprot_ac": "Q63HN8", "gene_name": "RNF213", "activity": [ { "ec_number": "2.3.2.-", "activity": "", "evidence": [ { "id": "Q63HN8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63HN8" } ] }, { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q63HN8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63HN8" } ] }, { "ec_number": "3.6.4.-", "activity": "", "evidence": [ { "id": "Q63HN8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63HN8" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q63HN8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63HN8" } ] } ] }, { "uniprot_ac": "Q6Q0C0", "gene_name": "TRAF7", "activity": [ { "ec_number": "2.3.2.-", "activity": "", "evidence": [ { "id": "Q6Q0C0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6Q0C0" } ] }, { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q6Q0C0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6Q0C0" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q6Q0C0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6Q0C0" } ] } ] }, { "uniprot_ac": "Q6UWE0", "gene_name": "LRSAM1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q6UWE0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6UWE0" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q6UWE0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6UWE0" } ] } ] }, { "uniprot_ac": "Q6ZMZ0", "gene_name": "RNF19B", "activity": [ { "ec_number": "2.3.2.31", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.", "evidence": [ { "id": "Q6ZMZ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZMZ0" } ] }, { "ec_number": "2.3.2.31", "activity": "", "evidence": [ { "id": "Q6ZMZ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZMZ0" } ] } ] }, { "uniprot_ac": "Q6ZNA4", "gene_name": "RNF111", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q6ZNA4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZNA4" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q6ZNA4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZNA4" } ] } ] }, { "uniprot_ac": "Q712K3", "gene_name": "UBE2R2", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "Q712K3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q712K3" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "Q712K3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q712K3" } ] } ] }, { "uniprot_ac": "Q7Z3V4", "gene_name": "UBE3B", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q7Z3V4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7Z3V4" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q7Z3V4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7Z3V4" } ] } ] }, { "uniprot_ac": "Q7Z419", "gene_name": "RNF144B", "activity": [ { "ec_number": "2.3.2.31", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.", "evidence": [ { "id": "Q7Z419", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7Z419" } ] }, { "ec_number": "2.3.2.31", "activity": "", "evidence": [ { "id": "Q7Z419", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7Z419" } ] } ] }, { "uniprot_ac": "Q7Z6E9", "gene_name": "RBBP6", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q7Z6E9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7Z6E9" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q7Z6E9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7Z6E9" } ] } ] }, { "uniprot_ac": "Q7Z6J0", "gene_name": "SH3RF1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q7Z6J0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7Z6J0" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q7Z6J0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7Z6J0" } ] } ] }, { "uniprot_ac": "Q7Z6J8", "gene_name": "UBE3D", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q7Z6J8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7Z6J8" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q7Z6J8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7Z6J8" } ] } ] }, { "uniprot_ac": "Q7Z6Z7", "gene_name": "HUWE1", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q7Z6Z7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7Z6Z7" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q7Z6Z7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7Z6Z7" } ] } ] }, { "uniprot_ac": "Q7Z7E8", "gene_name": "UBE2Q1", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "Q7Z7E8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7Z7E8" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "Q7Z7E8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7Z7E8" } ] } ] }, { "uniprot_ac": "Q86WT6", "gene_name": "TRIM69", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q86WT6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86WT6" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q86WT6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86WT6" } ] } ] }, { "uniprot_ac": "Q86XS8", "gene_name": "RNF130", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q86XS8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86XS8" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q86XS8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86XS8" } ] } ] }, { "uniprot_ac": "Q86XT4", "gene_name": "TRIM50", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q86XT4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86XT4" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q86XT4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86XT4" } ] } ] }, { "uniprot_ac": "Q86Y13", "gene_name": "DZIP3", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q86Y13", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86Y13" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q86Y13", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86Y13" } ] } ] }, { "uniprot_ac": "Q8IUQ4", "gene_name": "SIAH1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8IUQ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IUQ4" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q8IUQ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IUQ4" } ] } ] }, { "uniprot_ac": "Q8IVU3", "gene_name": "HERC6", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8IVU3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IVU3" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q8IVU3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IVU3" } ] } ] }, { "uniprot_ac": "Q8IWV7", "gene_name": "UBR1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8IWV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IWV7" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q8IWV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IWV7" } ] } ] }, { "uniprot_ac": "Q8IWV8", "gene_name": "UBR2", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8IWV8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IWV8" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q8IWV8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IWV8" } ] } ] }, { "uniprot_ac": "Q8IYU2", "gene_name": "HACE1", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8IYU2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IYU2" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q8IYU2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IYU2" } ] } ] }, { "uniprot_ac": "Q8IYW5", "gene_name": "RNF168", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8IYW5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IYW5" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q8IYW5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IYW5" } ] } ] }, { "uniprot_ac": "Q8N2K1", "gene_name": "UBE2J2", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "Q8N2K1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N2K1" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "Q8N2K1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N2K1" } ] } ] }, { "uniprot_ac": "Q8N2W9", "gene_name": "PIAS4", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8N2W9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N2W9" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q8N2W9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N2W9" } ] } ] }, { "uniprot_ac": "Q8N6D2", "gene_name": "RNF182", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8N6D2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N6D2" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q8N6D2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N6D2" } ] } ] }, { "uniprot_ac": "Q8N7E2", "gene_name": "CBLL2", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8N7E2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N7E2" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q8N7E2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N7E2" } ] } ] }, { "uniprot_ac": "Q8ND25", "gene_name": "ZNRF1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8ND25", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8ND25" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q8ND25", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8ND25" } ] } ] }, { "uniprot_ac": "Q8NG27", "gene_name": "PJA1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8NG27", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NG27" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q8NG27", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NG27" } ] } ] }, { "uniprot_ac": "Q8NHG8", "gene_name": "ZNRF2", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8NHG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NHG8" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q8NHG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NHG8" } ] } ] }, { "uniprot_ac": "Q8TBB1", "gene_name": "LNX1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8TBB1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TBB1" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q8TBB1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TBB1" } ] } ] }, { "uniprot_ac": "Q8TC41", "gene_name": "RNF217", "activity": [ { "ec_number": "2.3.2.31", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.", "evidence": [ { "id": "Q8TC41", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TC41" } ] }, { "ec_number": "2.3.2.31", "activity": "", "evidence": [ { "id": "Q8TC41", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TC41" } ] } ] }, { "uniprot_ac": "Q8TDB6", "gene_name": "DTX3L", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8TDB6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TDB6" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q8TDB6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TDB6" } ] } ] }, { "uniprot_ac": "Q8WV44", "gene_name": "TRIM41", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8WV44", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WV44" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q8WV44", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WV44" } ] } ] }, { "uniprot_ac": "Q8WVD3", "gene_name": "RNF138", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8WVD3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WVD3" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q8WVD3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WVD3" } ] } ] }, { "uniprot_ac": "Q8WVN8", "gene_name": "UBE2Q2", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "Q8WVN8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WVN8" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "Q8WVN8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WVN8" } ] } ] }, { "uniprot_ac": "Q8WY64", "gene_name": "MYLIP", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8WY64", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WY64" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q8WY64", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WY64" } ] } ] }, { "uniprot_ac": "Q92878", "gene_name": "RAD50", "activity": [ { "ec_number": "3.6.-.-", "activity": "", "evidence": [ { "id": "Q92878", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92878" } ] } ] }, { "uniprot_ac": "Q92993", "gene_name": "KAT5", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q92993", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92993" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q92993", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92993" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q92993", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92993" } ] } ] }, { "uniprot_ac": "Q969K3", "gene_name": "RNF34", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q969K3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q969K3" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q969K3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q969K3" } ] } ] }, { "uniprot_ac": "Q969M7", "gene_name": "UBE2F", "activity": [ { "ec_number": "2.3.2.32", "activity": "S-[NEDD8-protein]-yl-[E2 NEDD8-conjugating enzyme]-L-cysteine + [cullin]-L-lysine = [E2 NEDD8-conjugating enzyme]-L-cysteine + N(6)-[NEDD8-protein]-yl-[cullin]-L-lysine.", "evidence": [ { "id": "Q969M7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q969M7" } ] }, { "ec_number": "2.3.2.32", "activity": "", "evidence": [ { "id": "Q969M7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q969M7" } ] } ] }, { "uniprot_ac": "Q969Q1", "gene_name": "TRIM63", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q969Q1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q969Q1" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q969Q1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q969Q1" } ] } ] }, { "uniprot_ac": "Q969T4", "gene_name": "UBE2E3", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "Q969T4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q969T4" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "Q969T4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q969T4" } ] } ] }, { "uniprot_ac": "Q96AX9", "gene_name": "MIB2", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q96AX9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96AX9" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q96AX9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96AX9" } ] } ] }, { "uniprot_ac": "Q96B02", "gene_name": "UBE2W", "activity": [ { "ec_number": "2.3.2.25", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-N-terminal-amino acid = [E1 ubiquitin-activating enzyme]-L-cysteine + N-terminal-ubiquitinyl-[acceptor protein].", "evidence": [ { "id": "Q96B02", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96B02" } ] }, { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "Q96B02", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96B02" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "Q96B02", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96B02" } ] }, { "ec_number": "2.3.2.25", "activity": "", "evidence": [ { "id": "Q96B02", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96B02" } ] } ] }, { "uniprot_ac": "Q96BH1", "gene_name": "RNF25", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q96BH1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96BH1" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q96BH1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96BH1" } ] } ] }, { "uniprot_ac": "Q96F44", "gene_name": "TRIM11", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q96F44", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96F44" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q96F44", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96F44" } ] } ] }, { "uniprot_ac": "Q96J02", "gene_name": "ITCH", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q96J02", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96J02" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q96J02", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96J02" } ] } ] }, { "uniprot_ac": "Q96LR5", "gene_name": "UBE2E2", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "Q96LR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96LR5" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "Q96LR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96LR5" } ] } ] }, { "uniprot_ac": "Q96PM5", "gene_name": "RCHY1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q96PM5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96PM5" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q96PM5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96PM5" } ] } ] }, { "uniprot_ac": "Q96PU5", "gene_name": "NEDD4L", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q96PU5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96PU5" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q96PU5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96PU5" } ] }, { "ec_number": "2.3.2.36", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-cysteine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-S-ubiquitinyl-L-cysteine.", "evidence": [ { "id": "Q96PU5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96PU5" } ] }, { "ec_number": "2.3.2.36", "activity": "", "evidence": [ { "id": "Q96PU5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96PU5" } ] } ] }, { "uniprot_ac": "Q96SD1", "gene_name": "DCLRE1C", "activity": [ { "ec_number": "3.1.-.-", "activity": "", "evidence": [ { "id": "Q96SD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96SD1" } ] } ] }, { "uniprot_ac": "Q99728", "gene_name": "BARD1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q99728", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99728" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q99728", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99728" } ] } ] }, { "uniprot_ac": "Q9BV68", "gene_name": "RNF126", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9BV68", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BV68" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9BV68", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BV68" } ] } ] }, { "uniprot_ac": "Q9BWF2", "gene_name": "TRAIP", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9BWF2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BWF2" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9BWF2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BWF2" } ] } ] }, { "uniprot_ac": "Q9BYM8", "gene_name": "RBCK1", "activity": [ { "ec_number": "2.3.2.31", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.", "evidence": [ { "id": "Q9BYM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BYM8" } ] }, { "ec_number": "2.3.2.31", "activity": "", "evidence": [ { "id": "Q9BYM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BYM8" } ] } ] }, { "uniprot_ac": "Q9C026", "gene_name": "TRIM9", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9C026", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9C026" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9C026", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9C026" } ] } ] }, { "uniprot_ac": "Q9C037", "gene_name": "TRIM4", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9C037", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9C037" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9C037", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9C037" } ] } ] }, { "uniprot_ac": "Q9C0C9", "gene_name": "UBE2O", "activity": [ { "ec_number": "2.3.2.24", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9C0C9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9C0C9" } ] }, { "ec_number": "2.3.2.24", "activity": "", "evidence": [ { "id": "Q9C0C9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9C0C9" } ] } ] }, { "uniprot_ac": "Q9H0M0", "gene_name": "WWP1", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9H0M0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H0M0" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q9H0M0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H0M0" } ] } ] }, { "uniprot_ac": "Q9H4P4", "gene_name": "RNF41", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9H4P4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H4P4" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9H4P4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H4P4" } ] } ] }, { "uniprot_ac": "Q9H832", "gene_name": "UBE2Z", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "Q9H832", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H832" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "Q9H832", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H832" } ] } ] }, { "uniprot_ac": "Q9H9P5", "gene_name": "UNKL", "activity": [ { "ec_number": "2.3.2.-", "activity": "", "evidence": [ { "id": "Q9H9P5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H9P5" } ] } ] }, { "uniprot_ac": "Q9HAU4", "gene_name": "SMURF2", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9HAU4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HAU4" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q9HAU4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HAU4" } ] } ] }, { "uniprot_ac": "Q9HCE7", "gene_name": "SMURF1", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9HCE7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HCE7" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q9HCE7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HCE7" } ] } ] }, { "uniprot_ac": "Q9HCM9", "gene_name": "TRIM39", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9HCM9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HCM9" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9HCM9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HCM9" } ] } ] }, { "uniprot_ac": "Q9NQ86", "gene_name": "TRIM36", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9NQ86", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQ86" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9NQ86", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQ86" } ] } ] }, { "uniprot_ac": "Q9NV58", "gene_name": "RNF19A", "activity": [ { "ec_number": "2.3.2.31", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.", "evidence": [ { "id": "Q9NV58", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NV58" } ] }, { "ec_number": "2.3.2.31", "activity": "", "evidence": [ { "id": "Q9NV58", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NV58" } ] } ] }, { "uniprot_ac": "Q9NVW2", "gene_name": "RLIM", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9NVW2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NVW2" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9NVW2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NVW2" } ] } ] }, { "uniprot_ac": "Q9P2P5", "gene_name": "HECW2", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9P2P5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9P2P5" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q9P2P5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9P2P5" } ] } ] }, { "uniprot_ac": "Q9UBS8", "gene_name": "RNF14", "activity": [ { "ec_number": "2.3.2.31", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.", "evidence": [ { "id": "Q9UBS8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UBS8" } ] }, { "ec_number": "2.3.2.31", "activity": "", "evidence": [ { "id": "Q9UBS8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UBS8" } ] } ] }, { "uniprot_ac": "Q9UHC7", "gene_name": "MKRN1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9UHC7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UHC7" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9UHC7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UHC7" } ] } ] }, { "uniprot_ac": "Q9UII4", "gene_name": "HERC5", "activity": [ { "ec_number": "2.3.2.-", "activity": "", "evidence": [ { "id": "Q9UII4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UII4" } ] } ] }, { "uniprot_ac": "Q9ULT8", "gene_name": "HECTD1", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9ULT8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ULT8" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q9ULT8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ULT8" } ] } ] }, { "uniprot_ac": "Q9UNE7", "gene_name": "STUB1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9UNE7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UNE7" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9UNE7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UNE7" } ] } ] }, { "uniprot_ac": "Q9Y252", "gene_name": "RNF6", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9Y252", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y252" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9Y252", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y252" } ] } ] }, { "uniprot_ac": "Q9Y2X8", "gene_name": "UBE2D4", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "Q9Y2X8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2X8" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "Q9Y2X8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2X8" } ] } ] }, { "uniprot_ac": "Q9Y385", "gene_name": "UBE2J1", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "Q9Y385", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y385" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "Q9Y385", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y385" } ] } ] }, { "uniprot_ac": "Q9Y4B6", "gene_name": "DCAF1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Y4B6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y4B6" } ] } ] }, { "uniprot_ac": "Q9Y4L5", "gene_name": "RNF115", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9Y4L5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y4L5" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9Y4L5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y4L5" } ] } ] }, { "uniprot_ac": "Q9Y508", "gene_name": "RNF114", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9Y508", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y508" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9Y508", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y508" } ] } ] } ], "biomarkers": [ { "assessed_biomarker_entity": "Lung cancer forty-eight-gene TEP liquid-biopsy panel", "biomarker_id": "A0478", "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "30532555", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30532555" } ], "instances": [ { "best_biomarker_type": "diagnostic", "status": "measured 48 gene expression level", "disease": { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] }, "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "30532555", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30532555" } ] } ] } ], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 2790, 3746 ], "o_linked_sites": [ 1851, 3475, 3487, 4182 ], "snv_sites": [ 179, 242, 561, 581, 796, 984, 1020, 1048, 1076, 1150, 1771, 1772, 1784, 1809, 1851, 2085, 2232, 2274, 2290, 2300, 2792, 2798, 2841, 2861, 2870, 2928, 3030, 3310, 3438, 3475, 3487, 3526, 3544, 3554, 3571, 3622, 3623, 3675, 3744, 3746, 3748, 3793, 3906, 3945, 4283, 4374, 4438, 4628, 4808, 4809, 4812 ], "glycation_sites": [], "phosphorylation_sites": [ 272, 647, 1577, 1588, 1938, 1942, 1944, 1948, 2454, 2928, 2942, 4687, 4690, 4710, 4810, 4811, 4814, 4827 ], "sequon_annotation_sites": [ { "start_pos": 155, "end_pos": 157 }, { "start_pos": 1833, "end_pos": 1835 }, { "start_pos": 2488, "end_pos": 2490 }, { "start_pos": 2717, "end_pos": 2719 }, { "start_pos": 2790, "end_pos": 2792 }, { "start_pos": 3136, "end_pos": 3138 }, { "start_pos": 3291, "end_pos": 3293 }, { "start_pos": 370, "end_pos": 372 }, { "start_pos": 3746, "end_pos": 3748 }, { "start_pos": 4075, "end_pos": 4077 }, { "start_pos": 922, "end_pos": 924 }, { "start_pos": 977, "end_pos": 979 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_glycans", "count": 3 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 4 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_glycans", "count": 3 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 4 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 18 }, { "field": "total_sites", "count": 18 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 57 }, { "field": "total_sites", "count": 51 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 17 }, { "field": "total_sites", "count": 17 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 40 }, { "field": "total_sites", "count": 35 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 267 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }