{ "uniprot_canonical_ac": "O95644-1", "uniprot_ac": "O95644", "uniprot_id": "NFAC1_HUMAN", "mass": { "chemical_mass": 101243.0, "monoisotopic_mass": 101243.0 }, "refseq": { "ac": "NP_001265602", "name": "nuclear factor of activated T-cells, cytoplasmic 1 isoform J", "summary": "The product of this gene is a component of the nuclear factor of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation, and an inducible nuclear component. Proteins belonging to this family of transcription factors play a central role in inducible gene transcription during immune response. The product of this gene is an inducible nuclear component. It functions as a major molecular target for the immunosuppressive drugs such as cyclosporin A. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. Different isoforms of this protein may regulate inducible expression of different cytokine genes. [provided by RefSeq, Jul 2013].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265602" }, "gene_names": [ { "name": "NFATC1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O95644", "id": "O95644" }, { "name": "NF-ATC; NF-ATc1.2; NFAT2; NFATc", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265602", "id": "NP_001265602" }, { "name": "NFAT2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O95644", "id": "O95644" }, { "name": "NFATC1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265602", "id": "NP_001265602" }, { "name": "NFATC", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O95644", "id": "O95644" } ], "protein_names": [ { "name": "Nuclear factor of activated T-cells, cytoplasmic 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O95644" }, { "name": "NF-ATc1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95644" }, { "name": "NF-ATc", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95644" }, { "name": "NFAT transcription complex cytosolic component; nuclear factor of activated T-cells 'c'; nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265602", "id": "NP_001265602" }, { "name": "NFAT transcription complex cytosolic component", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95644" }, { "name": "NFATc1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95644" }, { "name": "NFATc", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95644" }, { "name": "nuclear factor of activated T-cells, cytoplasmic 1 isoform J", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265602", "id": "NP_001265602" } ], "function": [ { "annotation": "Clinical value of echocardiography combined with serum Cav-1, NFATc1, and PAI-1 in the diagnosis of Kawasaki disease complicated with coronary artery lesions.", "evidence": [ { "database": "RefSeq", "id": "NP_001265602", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265602" }, { "database": "PubMed", "id": "37758852", "url": "https://glygen.org/publication/PubMed/37758852" } ] }, { "annotation": "Exosome-targeted delivery of METTL14 regulates NFATc1 m6A methylation levels to correct osteoclast-induced bone resorption. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001265602", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265602" }, { "database": "PubMed", "id": "37957146", "url": "https://glygen.org/publication/PubMed/37957146" } ] }, { "annotation": "Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2 or IL-4 gene transcription. Also controls gene expression in embryonic cardiac cells. Could regulate not only the activation and proliferation but also the differentiation and programmed death of T-lymphocytes as well as lymphoid and non-lymphoid cells (PubMed:10358178). Required for osteoclastogenesis and regulates many genes important for osteoclast differentiation and function (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644#function" }, { "database": "PubMed", "id": "10358178", "url": "https://glygen.org/publication/PubMed/10358178" }, { "database": "UniProtKB", "id": "O88942", "url": "https://www.uniprot.org/uniprot/O88942#function" } ] }, { "annotation": "SIRT3-and FAK-mediated acetylation-phosphorylation crosstalk of NFATc1 regulates N[epsilon]-carboxymethyl-lysine-induced vascular calcification in diabetes mellitus.", "evidence": [ { "database": "RefSeq", "id": "NP_001265602", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265602" }, { "database": "PubMed", "id": "37392543", "url": "https://glygen.org/publication/PubMed/37392543" } ] }, { "annotation": "The product of this gene is a component of the nuclear factor of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation, and an inducible nuclear component. Proteins belonging to this family of transcription factors play a central role in inducible gene transcription during immune response. The product of this gene is an inducible nuclear component. It functions as a major molecular target for the immunosuppressive drugs such as cyclosporin A. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. Different isoforms of this protein may regulate inducible expression of different cytokine genes. [provided by RefSeq, Jul 2013].", "evidence": [ { "database": "RefSeq", "id": "NP_001265602", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265602" } ] }, { "annotation": "The role of NFATc1 in the progression and metastasis of prostate cancer: A review on the molecular mechanisms and signaling pathways. Review article", "evidence": [ { "database": "RefSeq", "id": "NP_001265602", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265602" }, { "database": "PubMed", "id": "37814550", "url": "https://glygen.org/publication/PubMed/37814550" } ] }, { "annotation": "USP7-mediated JUND suppresses RCAN2 transcription and elevates NFATC1 to enhance stem cell property in colorectal cancer.", "evidence": [ { "database": "RefSeq", "id": "NP_001265602", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265602" }, { "database": "PubMed", "id": "37535148", "url": "https://glygen.org/publication/PubMed/37535148" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "O95644", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95644" } ], "glycoeffect": [], "start_pos": 246, "end_pos": 246, "subjects_tested": "57", "subjects_positive": "1", "frequency": "1.8", "sequence_org": "V", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: patient freq. (1.8%). In dbSNP: rs773206226.", "chr_id": "18", "chr_pos": "79411011", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "V246", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [ { "start_pos": 169, "end_pos": 169, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on subcellular localization.", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ] }, { "start_pos": 172, "end_pos": 172, "sequence_org": "S", "sequence_mut": "A", "comment": "Partial nuclear translocation.", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" }, { "database": "PubMed", "id": "10652349", "url": "https://glygen.org/publication/PubMed/10652349" } ] }, { "start_pos": 187, "end_pos": 187, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on subcellular localization.", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" }, { "database": "PubMed", "id": "10652349", "url": "https://glygen.org/publication/PubMed/10652349" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "72.74", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000131196", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131196" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "71.5", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000131196", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131196" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "67.97", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000131196", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131196" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "71.09", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000131196", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131196" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "82.5", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000131196", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131196" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "74.7", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000131196", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131196" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "62.97", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000131196", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131196" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "76.44", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000131196", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131196" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "80.14", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000131196", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131196" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "78.01", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000131196", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131196" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "69.42", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000131196", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131196" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "78.78", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000131196", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131196" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "80.89", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000131196", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131196" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O95644", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95644" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O95644", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95644" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O95644", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95644" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O95644", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95644" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O95644", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95644" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O95644", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95644" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O95644", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95644" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O95644", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95644" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O95644", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95644" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O95644", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95644" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O95644", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95644" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O95644", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95644" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "common_name": "Human" } ], "gene": [ { "name": "NFATC1", "url": "https://www.uniprot.org/uniprot/O95644", "locus": { "chromosome": "18", "start_pos": 79529325, "end_pos": 79395856, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000131196", "url": "https://www.ensembl.org/id/ENSG00000131196" } ] } } ], "crossref": [ { "id": "ENSG00000131196", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131196", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O95644", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95644", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd07881", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd07881", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL3876", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3876", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "NFATC1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=NFATC1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "4772", "url": "https://www.ncbi.nlm.nih.gov/gene/4772", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "7775", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=7775", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O95644", "url": "https://www.ebi.ac.uk/intact/interactors/id:O95644*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002909", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002909", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008366", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008366", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008967", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008967", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011539", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011539", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014756", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014756", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR032397", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032397", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037059", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037059", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:4772", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:4772", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "600489", "url": "http://www.omim.org/entry/600489", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O95644", "url": "https://www.nextprot.org/entry/NX_O95644", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O95644", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95644", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "PFFHDVE", "url": "https://omabrowser.org/oma/group/PFFHDVE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5405363at2759", "url": "http://www.orthodb.org/?query=5405363at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12533", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12533", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12533:SF5", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12533:SF5", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1A66", "url": "https://www.rcsb.org/structure/1A66", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1NFA", "url": "https://www.rcsb.org/structure/1NFA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5SVE", "url": "https://www.rcsb.org/structure/5SVE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00554", "url": "http://pfam.xfam.org/family/PF00554", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF16179", "url": "http://pfam.xfam.org/family/PF16179", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O95644", "url": "https://pharos.nih.gov/targets/O95644", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O95644", "url": "http://purl.obolibrary.org/obo/PR_O95644", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-2025928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2025928", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5607763", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607763", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001265602", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265602", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "F5H4S8", "url": "https://www.uniprot.org/uniprot/F5H4S8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H4S8-1", "url": "https://www.uniprot.org/uniprot/F5H4S8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EQ04", "url": "https://www.uniprot.org/uniprot/K7EQ04", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EQ04-1", "url": "https://www.uniprot.org/uniprot/K7EQ04-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7ER53", "url": "https://www.uniprot.org/uniprot/K7ER53", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7ER53-1", "url": "https://www.uniprot.org/uniprot/K7ER53-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95644-1", "url": "https://www.uniprot.org/uniprot/O95644-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95644-10", "url": "https://www.uniprot.org/uniprot/O95644-10", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95644-11", "url": "https://www.uniprot.org/uniprot/O95644-11", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95644-17", "url": "https://www.uniprot.org/uniprot/O95644-17", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95644-2", "url": "https://www.uniprot.org/uniprot/O95644-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95644-3", "url": "https://www.uniprot.org/uniprot/O95644-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95644-4", "url": "https://www.uniprot.org/uniprot/O95644-4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95644-5", "url": "https://www.uniprot.org/uniprot/O95644-5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95644-6", "url": "https://www.uniprot.org/uniprot/O95644-6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95644-8", "url": "https://www.uniprot.org/uniprot/O95644-8", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEEEHYGYASSNVSPALPLPTAHSTLPAPCHNLQTSTPGIIPPADHPSGYGAALDGGPAGYFLSSGHTRPDGAPALESPRIEITSCLGLYHNNNQFFHDVEVEDVLPSSKRSPSTATLSLPSLEAYRDPSCLSPASSLSSRSCNSEASSYESNYSYPYASPQTSPWQSPCVSPKTTDPEEGFPRGLGACTLLGSPRHSPSTSPRASVTEESWLGARSSRPASPCNKRKYSLNGRQPPYSPHHSPTPSPHGSPRVSVTDDSWLGNTTQYTSSAIVAAINALTTDSSLDLGDGVPVKSRKTTLEQPPSVALKVEPVGEDLGSPPPPADFAPEDYSSFQHIRKGGFCDQYLAVPQHPYQWAKPKPLSPTSYMSPTLPALDWQLPSHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLMLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRSAQELPLVEKQSTDSYPVVGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVEIPPFRNQRITSPVHVSFYVCNGKRKRSQYQRFTYLPANVPIIKTEPTDDYEPAPTCGPVSQGLSPLPRPYYSQQLAMPPDPSSCLVAGFPPCPQRSTLMPAAPGVSPKLHDLSPAAYTKGVASPGHCHLGLPQPAGEAPAVQDVPRPVATHPGSPGQPPPALLPQQVSAPPSSSCPPGLEHSLCPSSPSPPLPPATQEPTCLQPCSPACPPATGRPQHLPSTVRRDESPTAGPRLLPEVHEDGSPNLAPIPVTVKREPEELDQLYLDDVNEIIRNDLSSTSTHS", "length": 943, "header": "sp|O95644-1|NFAC1_HUMAN Isoform 1 of Nuclear factor of activated T-cells, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=NFATC1 PE=1 SV=3 CANONICAL=O95644-1" }, "isoforms": [ { "isoform_ac": "F5H4S8-1", "url": "", "sequence": { "sequence": "MLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRSAQELPLVEKQSTDSYPVVGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVEIPPFRNQRITSPVHVSFYVCNGKRKRSQYQRFTYLPANVPIIKTEPTDDYEPAPTCGPVSQGLSPLPRPYYSQQLAMPPDPSSCLVAGFPPCPQRSTLMPAAPGVSPKLHDLSPAAYTKGVASPGHCHLGLPQPAGEAPAVQDVPRPVATHPGSPGQPPPALLPQQVSAPPSSSCPPGLEHSLCPSSPSPPLPPATQEPTCLQPCSPACPPATGRPQHLPSTVRRDESPTAGPRLLPEVHEDGSPNLAPIPVTVKREPEELDQLYLDDVNEIIRNDLSSTSTHS", "length": 471, "header": "tr|F5H4S8-1|NFAC1_HUMAN Computationally mapped isoform of Nuclear factor of activated T-cells, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=NFATC1 PE=1 SV=1 CANONICAL=O95644-1" }, "locus": { "chromosome": "18", "start_pos": 79527574, "end_pos": 79448812, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000545796.5", "url": "https://www.ensembl.org/id/ENST00000545796.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000439992.1", "url": "https://www.ensembl.org/id/ENSP00000439992.1" } ] } }, { "isoform_ac": "K7EQ04-1", "url": "", "sequence": { "sequence": "MTGLEDQEFDFEFLFEFNQRDEGAAAAAPARPCPPWTGSCRPTQARMSFGLRCSPSPTTEPTTRRRAAGGP", "length": 71, "header": "tr|K7EQ04-1|K7EQ04_HUMAN Computationally mapped isoform of Nuclear factor of activated T cells 1 OS=Homo sapiens OX=9606 GN=NFATC1 PE=4 SV=1 CANONICAL=O95644-1" }, "locus": { "chromosome": "18", "start_pos": 79433703, "end_pos": 79400392, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000590313.5", "url": "https://www.ensembl.org/id/ENST00000590313.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000467615.1", "url": "https://www.ensembl.org/id/ENSP00000467615.1" } ] } }, { "isoform_ac": "K7ER53-1", "url": "", "sequence": { "sequence": "MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEEEHYGYASSNVSPALPLPTAHSTLPAPCHNLQTSTPGIIPPADHPSGYGAALDGGPAGYFLSSGHTRPDGAPALESPRIEITSCLGLYHNNNQFFHDVEVEDVLPSSKRSPSTATLSLPSLEAYRDPSCLSPASSLSSRSCNSEASSYESNYSYPYASPQTSPWQSPCVSPKTTDPEEGFPRGLGACTLLGSPRHSPSTSPRASVTEESWLGARSSRPASPCNKRKYSLNGRQPPYSPHHSPTPSPHGSPRVSVTDDSWLGNTTQYTSSAIVAAINALTTDSSLDLGDGVPVKSRKTTLEQPPSVALKVEPVGEDLGSPPPPADFAPEDYSSFQHIRKGGFCDQYLAVPQHPYQWAKPKPLSPTSYMSPTLPALDWQLPSHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLMLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLRNSDIELRKGETDIGRKNTRPSAQLRSCLWWRSRARTAIRSWAGRRWSCLATTSCRTPRSFSWRKPQMATMSGRWKRKLTGTCASRILWWLRSRHFGIRG", "length": 639, "header": "tr|K7ER53-1|K7ER53_HUMAN Computationally mapped isoform of Nuclear factor of activated T cells 1 OS=Homo sapiens OX=9606 GN=NFATC1 PE=1 SV=1 CANONICAL=O95644-1" }, "locus": { "chromosome": "18", "start_pos": 79467492, "end_pos": 79396225, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000587635.5", "url": "https://www.ensembl.org/id/ENST00000587635.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000468111.1", "url": "https://www.ensembl.org/id/ENSP00000468111.1" } ] } }, { "isoform_ac": "O95644-1", "url": "", "sequence": { "sequence": "MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEEEHYGYASSNVSPALPLPTAHSTLPAPCHNLQTSTPGIIPPADHPSGYGAALDGGPAGYFLSSGHTRPDGAPALESPRIEITSCLGLYHNNNQFFHDVEVEDVLPSSKRSPSTATLSLPSLEAYRDPSCLSPASSLSSRSCNSEASSYESNYSYPYASPQTSPWQSPCVSPKTTDPEEGFPRGLGACTLLGSPRHSPSTSPRASVTEESWLGARSSRPASPCNKRKYSLNGRQPPYSPHHSPTPSPHGSPRVSVTDDSWLGNTTQYTSSAIVAAINALTTDSSLDLGDGVPVKSRKTTLEQPPSVALKVEPVGEDLGSPPPPADFAPEDYSSFQHIRKGGFCDQYLAVPQHPYQWAKPKPLSPTSYMSPTLPALDWQLPSHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLMLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRSAQELPLVEKQSTDSYPVVGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVEIPPFRNQRITSPVHVSFYVCNGKRKRSQYQRFTYLPANVPIIKTEPTDDYEPAPTCGPVSQGLSPLPRPYYSQQLAMPPDPSSCLVAGFPPCPQRSTLMPAAPGVSPKLHDLSPAAYTKGVASPGHCHLGLPQPAGEAPAVQDVPRPVATHPGSPGQPPPALLPQQVSAPPSSSCPPGLEHSLCPSSPSPPLPPATQEPTCLQPCSPACPPATGRPQHLPSTVRRDESPTAGPRLLPEVHEDGSPNLAPIPVTVKREPEELDQLYLDDVNEIIRNDLSSTSTHS", "length": 943, "header": "sp|O95644-1|NFAC1_HUMAN Isoform 1 of Nuclear factor of activated T-cells, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=NFATC1 PE=1 SV=3 CANONICAL=O95644-1" }, "locus": { "chromosome": "18", "start_pos": 79527574, "end_pos": 79396225, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000427363.7", "url": "https://www.ensembl.org/id/ENST00000427363.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000389377.2", "url": "https://www.ensembl.org/id/ENSP00000389377.2" } ] } }, { "isoform_ac": "O95644-10", "url": "", "sequence": { "sequence": "MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEEEHYGYASSNVSPALPLPTAHSTLPAPCHNLQTSTPGIIPPADHPSGYGAALDGGPAGYFLSSGHTRPDGAPALESPRIEITSCLGLYHNNNQFFHDVEVEDVLPSSKRSPSTATLSLPSLEAYRDPSCLSPASSLSSRSCNSEASSYESNYSYPYASPQTSPWQSPCVSPKTTDPEEGFPRGLGACTLLGSPRHSPSTSPRASVTEESWLGARSSRPASPCNKRKYSLNGRQPPYSPHHSPTPSPHGSPRVSVTDDSWLGNTTQYTSSAIVAAINALTTDSSLDLGDGVPVKSRKTTLEQPPSVALKVEPVGEDLGSPPPPADFAPEDYSSFQHIRKGGFCDQYLAVPQHPYQWAKPKPLSPTSYMSPTLPALDWQLPSHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLMLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRSAQELPLVEKQSTDSYPVVGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVEIPPFRNQRITSPVHVSFYVCNGKRKRSQYQRFTYLPANVNEIIRNDLSSTSTHS", "length": 713, "header": "sp|O95644-10|NFAC1_HUMAN Isoform 10 of Nuclear factor of activated T-cells, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=NFATC1 PE=1 SV=3 CANONICAL=O95644-1" }, "locus": { "chromosome": "18", "start_pos": 79527574, "end_pos": 79396225, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000542384.5", "url": "https://www.ensembl.org/id/ENST00000542384.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000442435.1", "url": "https://www.ensembl.org/id/ENSP00000442435.1" } ] } }, { "isoform_ac": "O95644-11", "url": "", "sequence": { "sequence": "MTGLEDQEFDFEFLFEFNQRDEGAAAAAPEHYGYASSNVSPALPLPTAHSTLPAPCHNLQTSTPGIIPPADHPSGYGAALDGGPAGYFLSSGHTRPDGAPALESPRIEITSCLGLYHNNNQFFHDVEVEDVLPSSKRSPSTATLSLPSLEAYRDPSCLSPASSLSSRSCNSEASSYESNYSYPYASPQTSPWQSPCVSPKTTDPEEGFPRGLGACTLLGSPRHSPSTSPRASVTEESWLGARSSRPASPCNKRKYSLNGRQPPYSPHHSPTPSPHGSPRVSVTDDSWLGNTTQYTSSAIVAAINALTTDSSLDLGDGVPVKSRKTTLEQPPSVALKVEPVGEDLGSPPPPADFAPEDYSSFQHIRKGGFCDQYLAVPQHPYQWAKPKPLSPTSYMSPTLPALDWQLPSHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLMLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRSAQELPLVEKQSTDSYPVVGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVEIPPFRNQRITSPVHVSFYVCNGKRKRSQYQRFTYLPANVNEIIRNDLSSTSTHS", "length": 700, "header": "sp|O95644-11|NFAC1_HUMAN Isoform 11 of Nuclear factor of activated T-cells, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=NFATC1 PE=1 SV=3 CANONICAL=O95644-1" }, "locus": { "chromosome": "18", "start_pos": 79527574, "end_pos": 79400392, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000586434.1", "url": "https://www.ensembl.org/id/ENST00000586434.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000466489.1", "url": "https://www.ensembl.org/id/ENSP00000466489.1" } ] } }, { "isoform_ac": "O95644-17", "url": "", "sequence": { "sequence": "MLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRSAQELPLVEKQSTDSYPVVGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVEIPPFRNQRITSPVHVSFYVCNGKRKRSQYQRFTYLPANVPIIKTEPTDDYEPAPTCGPVSQGLSPLPRPYYSQQLAMPPDPSSCLVAGFPPCPQRSTLMPAAPGVSPKLHDLSPAAYTKGVASPGHCHLGLPQPAGEAPAVQDVPRPVATHPGSPGQPPPALLPQQ", "length": 353, "header": "sp|O95644-17|NFAC1_HUMAN Isoform 17 of Nuclear factor of activated T-cells, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=NFATC1 PE=1 SV=3 CANONICAL=O95644-1" }, "locus": { "chromosome": "18", "start_pos": 79486630, "end_pos": 79448812, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000397790.6", "url": "https://www.ensembl.org/id/ENST00000397790.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000380892.2", "url": "https://www.ensembl.org/id/ENSP00000380892.2" } ] } }, { "isoform_ac": "O95644-2", "url": "", "sequence": { "sequence": "MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEEEHYGYASSNVSPALPLPTAHSTLPAPCHNLQTSTPGIIPPADHPSGYGAALDGGPAGYFLSSGHTRPDGAPALESPRIEITSCLGLYHNNNQFFHDVEVEDVLPSSKRSPSTATLSLPSLEAYRDPSCLSPASSLSSRSCNSEASSYESNYSYPYASPQTSPWQSPCVSPKTTDPEEGFPRGLGACTLLGSPRHSPSTSPRASVTEESWLGARSSRPASPCNKRKYSLNGRQPPYSPHHSPTPSPHGSPRVSVTDDSWLGNTTQYTSSAIVAAINALTTDSSLDLGDGVPVKSRKTTLEQPPSVALKVEPVGEDLGSPPPPADFAPEDYSSFQHIRKGGFCDQYLAVPQHPYQWAKPKPLSPTSYMSPTLPALDWQLPSHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLMLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRSAQELPLVEKQSTDSYPVVGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVEIPPFRNQRITSPVHVSFYVCNGKRKRSQYQRFTYLPANGNAIFLTVSREHERVGCFF", "length": 716, "header": "sp|O95644-2|NFAC1_HUMAN Isoform 2 of Nuclear factor of activated T-cells, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=NFATC1 PE=1 SV=3 CANONICAL=O95644-1" }, "locus": { "chromosome": "18", "start_pos": 79467638, "end_pos": 79396225, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000591814.5", "url": "https://www.ensembl.org/id/ENST00000591814.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000466194.1", "url": "https://www.ensembl.org/id/ENSP00000466194.1" } ] } }, { "isoform_ac": "O95644-3", "url": "", "sequence": { "sequence": "MTGLEDQEFDFEFLFEFNQRDEGAAAAAPEHYGYASSNVSPALPLPTAHSTLPAPCHNLQTSTPGIIPPADHPSGYGAALDGGPAGYFLSSGHTRPDGAPALESPRIEITSCLGLYHNNNQFFHDVEVEDVLPSSKRSPSTATLSLPSLEAYRDPSCLSPASSLSSRSCNSEASSYESNYSYPYASPQTSPWQSPCVSPKTTDPEEGFPRGLGACTLLGSPRHSPSTSPRASVTEESWLGARSSRPASPCNKRKYSLNGRQPPYSPHHSPTPSPHGSPRVSVTDDSWLGNTTQYTSSAIVAAINALTTDSSLDLGDGVPVKSRKTTLEQPPSVALKVEPVGEDLGSPPPPADFAPEDYSSFQHIRKGGFCDQYLAVPQHPYQWAKPKPLSPTSYMSPTLPALDWQLPSHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLMLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRSAQELPLVEKQSTDSYPVVGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVEIPPFRNQRITSPVHVSFYVCNGKRKRSQYQRFTYLPANGNAIFLTVSREHERVGCFF", "length": 703, "header": "sp|O95644-3|NFAC1_HUMAN Isoform 3 of Nuclear factor of activated T-cells, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=NFATC1 PE=1 SV=3 CANONICAL=O95644-1" }, "locus": { "chromosome": "18", "start_pos": 79467638, "end_pos": 79400392, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000592223.5", "url": "https://www.ensembl.org/id/ENST00000592223.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000467181.1", "url": "https://www.ensembl.org/id/ENSP00000467181.1" } ] } }, { "isoform_ac": "O95644-4", "url": "", "sequence": { "sequence": "MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEEEHYGYASSNVSPALPLPTAHSTLPAPCHNLQTSTPGIIPPADHPSGYGAALDGGPAGYFLSSGHTRPDGAPALESPRIEITSCLGLYHNNNQFFHDVEVEDVLPSSKRSPSTATLSLPSLEAYRDPSCLSPASSLSSRSCNSEASSYESNYSYPYASPQTSPWQSPCVSPKTTDPEEGFPRGLGACTLLGSPRHSPSTSPRASVTEESWLGARSSRPASPCNKRKYSLNGRQPPYSPHHSPTPSPHGSPRVSVTDDSWLGNTTQYTSSAIVAAINALTTDSSLDLGDGVPVKSRKTTLEQPPSVALKVEPVGEDLGSPPPPADFAPEDYSSFQHIRKGGFCDQYLAVPQHPYQWAKPKPLSPTSYMSPTLPALDWQLPSHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLMLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRSAQELPLVEKQSTDSYPVVGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVEIPPFRNQRITSPVHVSFYVCNGKRKRSQYQRFTYLPANVPIIKTEPTDDYEPAPTCGPVSQGLSPLPRPYYSQQLAMPPDPSSCLVAGFPPCPQRSTLMPAAPGVSPKLHDLSPAAYTKGVASPGHCHLGLPQPAGEAPAVQDVPRPVATHPGSPGQPPPALLPQQ", "length": 825, "header": "sp|O95644-4|NFAC1_HUMAN Isoform 4 of Nuclear factor of activated T-cells, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=NFATC1 PE=1 SV=3 CANONICAL=O95644-1" }, "locus": { "chromosome": "18", "start_pos": 79486630, "end_pos": 79396225, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000253506.9", "url": "https://www.ensembl.org/id/ENST00000253506.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000253506.5", "url": "https://www.ensembl.org/id/ENSP00000253506.5" } ] } }, { "isoform_ac": "O95644-5", "url": "", "sequence": { "sequence": "MTGLEDQEFDFEFLFEFNQRDEGAAAAAPEHYGYASSNVSPALPLPTAHSTLPAPCHNLQTSTPGIIPPADHPSGYGAALDGGPAGYFLSSGHTRPDGAPALESPRIEITSCLGLYHNNNQFFHDVEVEDVLPSSKRSPSTATLSLPSLEAYRDPSCLSPASSLSSRSCNSEASSYESNYSYPYASPQTSPWQSPCVSPKTTDPEEGFPRGLGACTLLGSPRHSPSTSPRASVTEESWLGARSSRPASPCNKRKYSLNGRQPPYSPHHSPTPSPHGSPRVSVTDDSWLGNTTQYTSSAIVAAINALTTDSSLDLGDGVPVKSRKTTLEQPPSVALKVEPVGEDLGSPPPPADFAPEDYSSFQHIRKGGFCDQYLAVPQHPYQWAKPKPLSPTSYMSPTLPALDWQLPSHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLMLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRSAQELPLVEKQSTDSYPVVGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVEIPPFRNQRITSPVHVSFYVCNGKRKRSQYQRFTYLPANVPIIKTEPTDDYEPAPTCGPVSQGLSPLPRPYYSQQLAMPPDPSSCLVAGFPPCPQRSTLMPAAPGVSPKLHDLSPAAYTKGVASPGHCHLGLPQPAGEAPAVQDVPRPVATHPGSPGQPPPALLPQQ", "length": 812, "header": "sp|O95644-5|NFAC1_HUMAN Isoform 5 of Nuclear factor of activated T-cells, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=NFATC1 PE=1 SV=3 CANONICAL=O95644-1" }, "locus": { "chromosome": "18", "start_pos": 79486630, "end_pos": 79400392, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000318065.9", "url": "https://www.ensembl.org/id/ENST00000318065.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000316553.5", "url": "https://www.ensembl.org/id/ENSP00000316553.5" } ] } }, { "isoform_ac": "O95644-6", "url": "", "sequence": { "sequence": "MTGLEDQEFDFEFLFEFNQRDEGAAAAAPEHYGYASSNVSPALPLPTAHSTLPAPCHNLQTSTPGIIPPADHPSGYGAALDGGPAGYFLSSGHTRPDGAPALESPRIEITSCLGLYHNNNQFFHDVEVEDVLPSSKRSPSTATLSLPSLEAYRDPSCLSPASSLSSRSCNSEASSYESNYSYPYASPQTSPWQSPCVSPKTTDPEEGFPRGLGACTLLGSPRHSPSTSPRASVTEESWLGARSSRPASPCNKRKYSLNGRQPPYSPHHSPTPSPHGSPRVSVTDDSWLGNTTQYTSSAIVAAINALTTDSSLDLGDGVPVKSRKTTLEQPPSVALKVEPVGEDLGSPPPPADFAPEDYSSFQHIRKGGFCDQYLAVPQHPYQWAKPKPLSPTSYMSPTLPALDWQLPSHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLMLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRSAQELPLVEKQSTDSYPVVGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVEIPPFRNQRITSPVHVSFYVCNGKRKRSQYQRFTYLPANVPIIKTEPTDDYEPAPTCGPVSQGLSPLPRPYYSQQLAMPPDPSSCLVAGFPPCPQRSTLMPAAPGVSPKLHDLSPAAYTKGVASPGHCHLGLPQPAGEAPAVQDVPRPVATHPGSPGQPPPALLPQQVSAPPSSSCPPGLEHSLCPSSPSPPLPPATQEPTCLQPCSPACPPATGRPQHLPSTVRRDESPTAGPRLLPEVHEDGSPNLAPIPVTVKREPEELDQLYLDDVNEIIRNDLSSTSTHS", "length": 930, "header": "sp|O95644-6|NFAC1_HUMAN Isoform 6 of Nuclear factor of activated T-cells, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=NFATC1 PE=1 SV=3 CANONICAL=O95644-1" }, "locus": { "chromosome": "18", "start_pos": 79527574, "end_pos": 79400392, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000329101.8", "url": "https://www.ensembl.org/id/ENST00000329101.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000327850.3", "url": "https://www.ensembl.org/id/ENSP00000327850.3" } ] } }, { "isoform_ac": "O95644-8", "url": "", "sequence": { "sequence": "MKSAEEEHYGYASSNVSPALPLPTAHSTLPAPCHNLQTSTPGIIPPADHPSGYGAALDGGPAGYFLSSGHTRPDGAPALESPRIEITSCLGLYHNNNQFFHDVEVEDVLPSSKRSPSTATLSLPSLEAYRDPSCLSPASSLSSRSCNSEASSYESNYSYPYASPQTSPWQSPCVSPKTTDPEEGFPRGLGACTLLGSPRHSPSTSPRASVTEESWLGARSSRPASPCNKRKYSLNGRQPPYSPHHSPTPSPHGSPRVSVTDDSWLGNTTQYTSSAIVAAINALTTDSSLDLGDGVPVKSRKTTLEQPPSVALKVEPVGEDLGSPPPPADFAPEDYSSFQHIRKGGFCDQYLAVPQHPYQWAKPKPLSPTSYMSPTLPALDWQLPSHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLMLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRSAQELPLVEKQSTDSYPVVGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVEIPPFRNQRITSPVHVSFYVCNGKRKRSQYQRFTYLPANGNAIFLTVSREHERVGCFF", "length": 680, "header": "sp|O95644-8|NFAC1_HUMAN Isoform 8 of Nuclear factor of activated T-cells, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=NFATC1 PE=1 SV=3 CANONICAL=O95644-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O95644", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95644" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "17882263", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17882263" } ] } ], "phosphorylation": [ { "start_pos": 117, "end_pos": 117, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "PRO", "id": "O95644", "url": "http://purl.obolibrary.org/obo/O95644" }, { "database": "iPTMnet", "id": "O95644", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95644" }, { "database": "PubMed", "id": "10866678", "url": "https://glygen.org/publication/PubMed/10866678" } ], "site_lbl": "Ser117" }, { "start_pos": 172, "end_pos": 172, "kinase_uniprot_canonical_ac": "P27361-1", "kinase_gene_name": "MAPK3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95644", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95644" }, { "database": "PubMed", "id": "10652349", "url": "https://glygen.org/publication/PubMed/10652349" } ], "site_lbl": "Ser172" }, { "start_pos": 172, "end_pos": 172, "kinase_uniprot_canonical_ac": "P53779-1", "kinase_gene_name": "MAPK10", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95644", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95644" }, { "database": "PubMed", "id": "10652349", "url": "https://glygen.org/publication/PubMed/10652349" } ], "site_lbl": "Ser172" }, { "start_pos": 172, "end_pos": 172, "kinase_uniprot_canonical_ac": "Q16539-1", "kinase_gene_name": "MAPK14", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95644", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95644" }, { "database": "PubMed", "id": "10652349", "url": "https://glygen.org/publication/PubMed/10652349" } ], "site_lbl": "Ser172" }, { "start_pos": 172, "end_pos": 172, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "PRO", "id": "O95644", "url": "http://purl.obolibrary.org/obo/O95644" }, { "database": "iPTMnet", "id": "O95644", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95644" }, { "database": "PubMed", "id": "10866678", "url": "https://glygen.org/publication/PubMed/10866678" }, { "database": "PubMed", "id": "24863062", "url": "https://glygen.org/publication/PubMed/24863062" } ], "site_lbl": "Ser172" }, { "start_pos": 175, "end_pos": 175, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "PRO", "id": "O95644", "url": "http://purl.obolibrary.org/obo/O95644" }, { "database": "iPTMnet", "id": "O95644", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95644" } ], "site_lbl": "Ser175" }, { "start_pos": 176, "end_pos": 176, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "PRO", "id": "O95644", "url": "http://purl.obolibrary.org/obo/O95644" }, { "database": "iPTMnet", "id": "O95644", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95644" } ], "site_lbl": "Ser176" }, { "start_pos": 178, "end_pos": 178, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "PRO", "id": "O95644", "url": "http://purl.obolibrary.org/obo/O95644" }, { "database": "iPTMnet", "id": "O95644", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95644" } ], "site_lbl": "Ser178" }, { "start_pos": 179, "end_pos": 179, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "PRO", "id": "O95644", "url": "http://purl.obolibrary.org/obo/O95644" }, { "database": "iPTMnet", "id": "O95644", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95644" } ], "site_lbl": "Ser179" }, { "start_pos": 181, "end_pos": 181, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "PRO", "id": "O95644", "url": "http://purl.obolibrary.org/obo/O95644" }, { "database": "iPTMnet", "id": "O95644", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95644" } ], "site_lbl": "Ser181" }, { "start_pos": 233, "end_pos": 233, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PRO", "id": "O95644", "url": "http://purl.obolibrary.org/obo/O95644" }, { "database": "iPTMnet", "id": "O95644", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95644" } ], "site_lbl": "Ser233" }, { "start_pos": 237, "end_pos": 237, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" }, { "database": "PRO", "id": "O95644", "url": "http://purl.obolibrary.org/obo/O95644" }, { "database": "iPTMnet", "id": "O95644", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95644" } ], "site_lbl": "Ser237" }, { "start_pos": 241, "end_pos": 241, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "PRO", "id": "O95644", "url": "http://purl.obolibrary.org/obo/O95644" }, { "database": "iPTMnet", "id": "O95644", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95644" } ], "site_lbl": "Ser241" }, { "start_pos": 245, "end_pos": 245, "kinase_uniprot_canonical_ac": "P17612-1", "kinase_gene_name": "PRKACA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95644", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95644" }, { "database": "PubMed", "id": "12351631", "url": "https://glygen.org/publication/PubMed/12351631" } ], "site_lbl": "Ser245" }, { "start_pos": 245, "end_pos": 245, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" }, { "database": "phospho.ELM", "id": "O95644", "url": "http://phospho.elm.eu.org/byAccession/O95644.html" }, { "database": "iPTMnet", "id": "O95644", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95644" }, { "database": "PubMed", "id": "9072970", "url": "https://glygen.org/publication/PubMed/9072970" }, { "database": "PubMed", "id": "12351631", "url": "https://glygen.org/publication/PubMed/12351631" } ], "site_lbl": "Ser245" }, { "start_pos": 257, "end_pos": 257, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "PRO", "id": "O95644", "url": "http://purl.obolibrary.org/obo/O95644" }, { "database": "iPTMnet", "id": "O95644", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95644" } ], "site_lbl": "Ser257" }, { "start_pos": 261, "end_pos": 261, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95644", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95644" }, { "database": "PubMed", "id": "28235034", "url": "https://glygen.org/publication/PubMed/28235034" } ], "site_lbl": "Ser261" }, { "start_pos": 269, "end_pos": 269, "kinase_uniprot_canonical_ac": "P17612-1", "kinase_gene_name": "PRKACA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95644", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95644" }, { "database": "PubMed", "id": "12351631", "url": "https://glygen.org/publication/PubMed/12351631" } ], "site_lbl": "Ser269" }, { "start_pos": 269, "end_pos": 269, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" }, { "database": "phospho.ELM", "id": "O95644", "url": "http://phospho.elm.eu.org/byAccession/O95644.html" }, { "database": "iPTMnet", "id": "O95644", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95644" }, { "database": "PubMed", "id": "9072970", "url": "https://glygen.org/publication/PubMed/9072970" }, { "database": "PubMed", "id": "12351631", "url": "https://glygen.org/publication/PubMed/12351631" } ], "site_lbl": "Ser269" }, { "start_pos": 278, "end_pos": 278, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "PRO", "id": "O95644", "url": "http://purl.obolibrary.org/obo/O95644" }, { "database": "iPTMnet", "id": "O95644", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95644" }, { "database": "PubMed", "id": "28235034", "url": "https://glygen.org/publication/PubMed/28235034" } ], "site_lbl": "Ser278" }, { "start_pos": 286, "end_pos": 286, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "PRO", "id": "O95644", "url": "http://purl.obolibrary.org/obo/O95644" }, { "database": "iPTMnet", "id": "O95644", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95644" } ], "site_lbl": "Ser286" }, { "start_pos": 290, "end_pos": 290, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "PRO", "id": "O95644", "url": "http://purl.obolibrary.org/obo/O95644" }, { "database": "iPTMnet", "id": "O95644", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95644" } ], "site_lbl": "Ser290" }, { "start_pos": 294, "end_pos": 294, "kinase_uniprot_canonical_ac": "P17252-1", "kinase_gene_name": "PRKCA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95644", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95644" }, { "database": "PubMed", "id": "12351631", "url": "https://glygen.org/publication/PubMed/12351631" } ], "site_lbl": "Ser294" }, { "start_pos": 294, "end_pos": 294, "kinase_uniprot_canonical_ac": "P17612-1", "kinase_gene_name": "PRKACA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95644", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95644" }, { "database": "PubMed", "id": "12351631", "url": "https://glygen.org/publication/PubMed/12351631" } ], "site_lbl": "Ser294" }, { "start_pos": 294, "end_pos": 294, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" }, { "database": "phospho.ELM", "id": "O95644", "url": "http://phospho.elm.eu.org/byAccession/O95644.html" }, { "database": "iPTMnet", "id": "O95644", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95644" }, { "database": "PubMed", "id": "12351631", "url": "https://glygen.org/publication/PubMed/12351631" } ], "site_lbl": "Ser294" }, { "start_pos": 403, "end_pos": 403, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95644", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95644" }, { "database": "PubMed", "id": "28235034", "url": "https://glygen.org/publication/PubMed/28235034" } ], "site_lbl": "Ser403" }, { "start_pos": 409, "end_pos": 409, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95644", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95644" }, { "database": "PubMed", "id": "28235034", "url": "https://glygen.org/publication/PubMed/28235034" } ], "site_lbl": "Ser409" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Alternative polyadenylation events contribute to the induction of NF-ATc in effector T cells.", "journal": "Immunity", "date": "1999", "authors": "Chuvpilo S, Zimmer M, Kerstan A, Gl\u00f6ckner J, Avots A, Escher C, Fischer C, Inashkina I, Jankevics E, Berberich-Siebelt F, Schmitt E, Serfling E", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "reference": [ { "type": "PubMed", "id": "10072078", "url": "https://glygen.org/publication/PubMed/10072078" } ] }, { "title": "Generic signals and specific outcomes: signaling through Ca2+, calcineurin, and NF-AT.", "journal": "Cell", "date": "1999", "authors": "Crabtree G R", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "reference": [ { "type": "PubMed", "id": "10089876", "url": "https://glygen.org/publication/PubMed/10089876" } ] }, { "title": "Multiple NF-ATc isoforms with individual transcriptional properties are synthesized in T lymphocytes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999-06-15", "authors": "Chuvpilo S, Avots A, Berberich-Siebelt F, Gl\u00f6ckner J, Fischer C, Kerstan A, Escher C, Inashkina I, Hlubek F, Jankevics E, Brabletz T, Serfling E", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "reference": [ { "type": "PubMed", "id": "10358178", "url": "https://glygen.org/publication/PubMed/10358178" } ] }, { "title": "WRM-1 activates the LIT-1 protein kinase to transduce anterior/posterior polarity signals in C. elegans.", "journal": "Cell", "date": "1999", "authors": "Rocheleau CE, Yasuda J, Shin TH, Lin R, Sawa H, Okano H, Priess JR, Davis RJ, Mello CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "10380924", "url": "https://glygen.org/publication/PubMed/10380924" } ] }, { "title": "MAP kinase and Wnt pathways converge to downregulate an HMG-domain repressor in Caenorhabditis elegans.", "journal": "Nature", "date": "1999", "authors": "Meneghini MD, Ishitani T, Carter JC, Hisamoto N, Ninomiya-Tsuji J, Thorpe CJ, Hamill DR, Matsumoto K, Bowerman B", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "10391246", "url": "https://glygen.org/publication/PubMed/10391246" } ] }, { "title": "The TAK1-NLK-MAPK-related pathway antagonizes signalling between beta-catenin and transcription factor TCF.", "journal": "Nature", "date": "1999", "authors": "Ishitani T, Ninomiya-Tsuji J, Nagai S, Nishita M, Meneghini M, Barker N, Waterman M, Bowerman B, Clevers H, Shibuya H, Matsumoto K", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "10391247", "url": "https://glygen.org/publication/PubMed/10391247" } ] }, { "title": "Protein kinase C is differentially stimulated by Wnt and Frizzled homologs in a G-protein-dependent manner.", "journal": "Current biology : CB", "date": "1999", "authors": "Sheldahl LC, Park M, Malbon CC, Moon RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "10395542", "url": "https://glygen.org/publication/PubMed/10395542" } ] }, { "title": "MOM-4, a MAP kinase kinase kinase-related protein, activates WRM-1/LIT-1 kinase to transduce anterior/posterior polarity signals in C. elegans.", "journal": "Molecular cell", "date": "1999", "authors": "Shin TH, Yasuda J, Rocheleau CE, Lin R, Soto M, Bei Y, Davis RJ, Mello CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "10488343", "url": "https://glygen.org/publication/PubMed/10488343" } ] }, { "title": "Activation of a frizzled-2/beta-adrenergic receptor chimera promotes Wnt signaling and differentiation of mouse F9 teratocarcinoma cells via Galphao and Galphat.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Liu X, Liu T, Slusarski DC, Yang-Snyder J, Malbon CC, Moon RT, Wang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "10588714", "url": "https://glygen.org/publication/PubMed/10588714" } ] }, { "title": "Identification of amino acid residues and protein kinases involved in the regulation of NFATc subcellular localization.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Porter CM, Havens MA, Clipstone NA", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" }, { "database": "iPTMnet", "id": "O95644", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95644" } ], "reference": [ { "type": "PubMed", "id": "10652349", "url": "https://glygen.org/publication/PubMed/10652349" } ] }, { "title": "Ca(2+)/calmodulin-dependent protein kinase II is stimulated by Wnt and Frizzled homologs and promotes ventral cell fates in Xenopus.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Kuhl M, Sheldahl LC, Malbon CC, Moon RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "10777564", "url": "https://glygen.org/publication/PubMed/10777564" } ] }, { "title": "The Wnt/Ca2+ pathway: a new vertebrate Wnt signaling pathway takes shape.", "journal": "Trends in genetics : TIG", "date": "2000", "authors": "Kuhl M, Sheldahl LC, Park M, Miller JR, Moon RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "10858654", "url": "https://glygen.org/publication/PubMed/10858654" } ] }, { "title": "A second calcineurin binding site on the NFAT regulatory domain.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Park S, Uesugi M, Verdine GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "10860980", "url": "https://glygen.org/publication/PubMed/10860980" } ] }, { "title": "c-Jun NH(2)-terminal kinase inhibits targeting of the protein phosphatase calcineurin to NFATc1.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Chow CW, Dong C, Flavell RA, Davis RJ", "evidence": [ { "database": "iPTMnet", "id": "O95644-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95644-1" } ], "reference": [ { "type": "PubMed", "id": "10866678", "url": "https://glygen.org/publication/PubMed/10866678" } ] }, { "title": "Structure, function, and control of phosphoinositide-specific phospholipase C.", "journal": "Physiological reviews", "date": "2000", "authors": "Rebecchi MJ, Pentyala SN", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "11015615", "url": "https://glygen.org/publication/PubMed/11015615" } ] }, { "title": "Calcineurin: form and function.", "journal": "Physiological reviews", "date": "2000", "authors": "Rusnak F, Mertz P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "11015619", "url": "https://glygen.org/publication/PubMed/11015619" } ] }, { "title": "Concerted dephosphorylation of the transcription factor NFAT1 induces a conformational switch that regulates transcriptional activity.", "journal": "Molecular cell", "date": "2000", "authors": "Okamura H, Aramburu J, Garcia-Rodriguez C, Viola JP, Raghavan A, Tahiliani M, Zhang X, Qin J, Hogan PG, Rao A", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "11030334", "url": "https://glygen.org/publication/PubMed/11030334" } ] }, { "title": "Characterization of DNA binding, transcriptional activation, and regulated nuclear association of recombinant human NFATp.", "journal": "BMC immunology", "date": "2000", "authors": "Kim LJ, Ferguson HA, Seto AG, Goodrich JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2025928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2025928" } ], "reference": [ { "type": "PubMed", "id": "11231878", "url": "https://glygen.org/publication/PubMed/11231878" } ] }, { "title": "Regulation of phosphoinositide-specific phospholipase C.", "journal": "Annual review of biochemistry", "date": "2001", "authors": "Rhee SG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "11395409", "url": "https://glygen.org/publication/PubMed/11395409" } ] }, { "title": "Wnt signaling and heterotrimeric G-proteins: strange bedfellows or a classic romance?", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Malbon CC, Wang H, Moon RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "11563835", "url": "https://glygen.org/publication/PubMed/11563835" } ] }, { "title": "The Wnt/calcium pathway activates NF-AT and promotes ventral cell fate in Xenopus embryos.", "journal": "Nature", "date": "2002", "authors": "Saneyoshi T, Kume S, Amasaki Y, Mikoshiba K", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "12015605", "url": "https://glygen.org/publication/PubMed/12015605" } ] }, { "title": "Wnt5a signaling directly affects cell motility and invasion of metastatic melanoma.", "journal": "Cancer cell", "date": "2002", "authors": "Weeraratna AT, Jiang Y, Hostetter G, Rosenblatt K, Duray P, Bittner M, Trent JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "12086864", "url": "https://glygen.org/publication/PubMed/12086864" } ] }, { "title": "Protein kinase A negatively modulates the nuclear accumulation of NF-ATc1 by priming for subsequent phosphorylation by glycogen synthase kinase-3.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Sheridan CM, Heist EK, Beals CR, Crabtree GR, Gardner P", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" }, { "database": "iPTMnet", "id": "O95644", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95644" } ], "reference": [ { "type": "PubMed", "id": "12351631", "url": "https://glygen.org/publication/PubMed/12351631" } ] }, { "title": "Signaling of rat Frizzled-2 through phosphodiesterase and cyclic GMP.", "journal": "Science (New York, N.Y.)", "date": "2002", "authors": "Ahumada A, Slusarski DC, Liu X, Moon RT, Malbon CC, Wang HY", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "12471263", "url": "https://glygen.org/publication/PubMed/12471263" } ] }, { "title": "The TAK1-NLK mitogen-activated protein kinase cascade functions in the Wnt-5a/Ca(2+) pathway to antagonize Wnt/beta-catenin signaling.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Ishitani T, Kishida S, Hyodo-Miura J, Ueno N, Yasuda J, Waterman M, Shibuya H, Moon RT, Ninomiya-Tsuji J, Matsumoto K", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "12482967", "url": "https://glygen.org/publication/PubMed/12482967" } ] }, { "title": "Regulation of lymphoid enhancer factor 1/T-cell factor by mitogen-activated protein kinase-related Nemo-like kinase-dependent phosphorylation in Wnt/beta-catenin signaling.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Ishitani T, Ninomiya-Tsuji J, Matsumoto K", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "12556497", "url": "https://glygen.org/publication/PubMed/12556497" } ] }, { "title": "Identification of phosphorylation sites within the SH3 domains of Tec family tyrosine kinases.", "journal": "Biochimica et biophysica acta", "date": "2003", "authors": "Nore BF, Mattsson PT, Antonsson P, Backesjo CM, Westlund A, Lennartsson J, Hansson H, Low P, Ronnstrand L, Smith CI", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "12573241", "url": "https://glygen.org/publication/PubMed/12573241" } ] }, { "title": "Activation of Gbetagamma signaling downstream of Wnt-11/Xfz7 regulates Cdc42 activity during Xenopus gastrulation.", "journal": "Developmental biology", "date": "2003", "authors": "Penzo-Mendez A, Umbhauer M, Djiane A, Boucaut JC, Riou JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "12729560", "url": "https://glygen.org/publication/PubMed/12729560" } ] }, { "title": "Transcriptional regulation by calcium, calcineurin, and NFAT.", "journal": "Genes & development", "date": "2003", "authors": "Hogan PG, Chen L, Nardone J, Rao A", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "12975316", "url": "https://glygen.org/publication/PubMed/12975316" } ] }, { "title": "Wnt-frizzled signaling to G-protein-coupled effectors.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2004", "authors": "Wang HY, Malbon CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "14704854", "url": "https://glygen.org/publication/PubMed/14704854" } ] }, { "title": "Frizzleds: new members of the superfamily of G-protein-coupled receptors.", "journal": "Frontiers in bioscience : a journal and virtual library", "date": "2004", "authors": "Malbon CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "14977528", "url": "https://glygen.org/publication/PubMed/14977528" } ] }, { "title": "PDE6 is an effector for the Wnt/Ca2+/cGMP-signalling pathway in development.", "journal": "Biochemical Society transactions", "date": "2004", "authors": "Wang H, Lee Y, Malbon CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "15494017", "url": "https://glygen.org/publication/PubMed/15494017" } ] }, { "title": "The biology of cyclic GMP-dependent protein kinases.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Hofmann F", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "15545263", "url": "https://glygen.org/publication/PubMed/15545263" } ] }, { "title": "Regulatory interactions between the amino terminus of G-protein betagamma subunits and the catalytic domain of phospholipase Cbeta2.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Bonacci TM, Ghosh M, Malik S, Smrcka AV", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "15611108", "url": "https://glygen.org/publication/PubMed/15611108" } ] }, { "title": "A genome-wide Drosophila RNAi screen identifies DYRK-family kinases as regulators of NFAT.", "journal": "Nature", "date": "2006", "authors": "Gwack Y, Sharma S, Nardone J, Tanasa B, Iuga A, Srikanth S, Okamura H, Bolton D, Feske S, Hogan PG, Rao A", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "reference": [ { "type": "PubMed", "id": "16511445", "url": "https://glygen.org/publication/PubMed/16511445" } ] }, { "title": "Wnt-5a/Ca2+-induced NFAT activity is counteracted by Wnt-5a/Yes-Cdc42-casein kinase 1alpha signaling in human mammary epithelial cells.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Dejmek J, Safholm A, Kamp Nielsen C, Andersson T, Leandersson K", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "16880514", "url": "https://glygen.org/publication/PubMed/16880514" } ] }, { "title": "Suppression of cyclic GMP-dependent protein kinase is essential to the Wnt/cGMP/Ca2+ pathway.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Ma L, Wang HY", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "16920709", "url": "https://glygen.org/publication/PubMed/16920709" } ] }, { "title": "The consensus coding sequences of human breast and colorectal cancers.", "journal": "Science (New York, N.Y.)", "date": "2006", "authors": "Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "reference": [ { "type": "PubMed", "id": "16959974", "url": "https://glygen.org/publication/PubMed/16959974" } ] }, { "title": "Calcineurin is a common target of cyclophilin-cyclosporin A and FKBP-FK506 complexes.", "journal": "Cell", "date": "1991", "authors": "Liu J, Farmer JD Jr, Lane WS, Friedman J, Weissman I, Schreiber SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2025928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2025928" } ], "reference": [ { "type": "PubMed", "id": "1715244", "url": "https://glygen.org/publication/PubMed/1715244" } ] }, { "title": "The Wnt5A/protein kinase C pathway mediates motility in melanoma cells via the inhibition of metastasis suppressors and initiation of an epithelial to mesenchymal transition.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Dissanayake SK, Wade M, Johnson CE, O'Connell MP, Leotlela PD, French AD, Shah KV, Hewitt KJ, Rosenthal DT, Indig FE, Jiang Y, Nickoloff BJ, Taub DD, Trent JM, Moon RT, Bittner M, Weeraratna AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "17426020", "url": "https://glygen.org/publication/PubMed/17426020" } ] }, { "title": "Structure of the calcineurin-NFAT complex: defining a T cell activation switch using solution NMR and crystal coordinates.", "journal": "Structure (London, England : 1993)", "date": "2007", "authors": "Takeuchi K, Roehrl MH, Sun ZY, Wagner G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "17502104", "url": "https://glygen.org/publication/PubMed/17502104" } ] }, { "title": "Mitogen-activated protein kinase p38 regulates the Wnt/cyclic GMP/Ca2+ non-canonical pathway.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Ma L, Wang HY", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "17684012", "url": "https://glygen.org/publication/PubMed/17684012" } ] }, { "title": "Requirement for O-linked N-acetylglucosaminyltransferase in lymphocytes activation.", "journal": "The EMBO journal", "date": "2007", "authors": "Golks A, Tran TT, Goetschy JF, Guerini D", "evidence": [ { "database": "O-GlcNAc Database", "id": "O95644", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95644" } ], "reference": [ { "type": "PubMed", "id": "17882263", "url": "https://glygen.org/publication/PubMed/17882263" } ] }, { "title": "NFAT binding and regulation of T cell activation by the cytoplasmic scaffolding Homer proteins.", "journal": "Science", "date": "2008", "authors": "Huang GN, Huso DL, Bouyain S, Tu J, McCorkell KA, May MJ, Zhu Y, Lutz M, Collins S, Dehoff M, Kang S, Whartenby K, Powell J, Leahy D, Worley PF", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "reference": [ { "type": "PubMed", "id": "18218901", "url": "https://glygen.org/publication/PubMed/18218901" } ] }, { "title": "The secondary structure of calcineurin regulatory region and conformational change induced by calcium/calmodulin binding.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Shen X, Li H, Ou Y, Tao W, Dong A, Kong J, Ji C, Yu S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "18296442", "url": "https://glygen.org/publication/PubMed/18296442" } ] }, { "title": "Signal transducing membrane complexes of photoreceptor outer segments.", "journal": "Vision research", "date": "2008", "authors": "Wensel TG", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "18456304", "url": "https://glygen.org/publication/PubMed/18456304" } ] }, { "title": "G protein betagamma subunits: central mediators of G protein-coupled receptor signaling.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2008", "authors": "Smrcka AV", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "18488142", "url": "https://glygen.org/publication/PubMed/18488142" } ] }, { "title": "Alternative splicing and expression of human and mouse NFAT genes.", "journal": "Genomics", "date": "2008", "authors": "Vihma Hanna, Pruunsild Priit, Timmusk T\u00f5nis", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "reference": [ { "type": "PubMed", "id": "18675896", "url": "https://glygen.org/publication/PubMed/18675896" } ] }, { "title": "Wnt5A activates the calpain-mediated cleavage of filamin A.", "journal": "The Journal of investigative dermatology", "date": "2009", "authors": "O'Connell MP, Fiori JL, Baugher KM, Indig FE, French AD, Camilli TC, Frank BP, Earley R, Hoek KS, Hasskamp JH, Elias EG, Taub DD, Bernier M, Weeraratna AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "19177143", "url": "https://glygen.org/publication/PubMed/19177143" } ] }, { "title": "Proximal events in Wnt signal transduction.", "journal": "Nature reviews. Molecular cell biology", "date": "2009", "authors": "Angers S, Moon RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "19536106", "url": "https://glygen.org/publication/PubMed/19536106" } ] }, { "title": "NFAT proteins: emerging roles in cancer progression.", "journal": "Nature reviews. Cancer", "date": "2009", "authors": "Mancini M, Toker A", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "19851316", "url": "https://glygen.org/publication/PubMed/19851316" } ] }, { "title": "cGMP-phosphodiesterase 6, transducin and Wnt5a/Frizzled-2-signaling control cGMP and Ca(2+) homeostasis in melanoma cells.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2010", "authors": "Bazhin AV, Tambor V, Dikov B, Philippov PP, Schadendorf D, Eichmuller SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "19946729", "url": "https://glygen.org/publication/PubMed/19946729" } ] }, { "title": "Homodimerization of Nemo-like kinase is essential for activation and nuclear localization.", "journal": "Molecular biology of the cell", "date": "2011", "authors": "Ishitani S, Inaba K, Matsumoto K, Ishitani T", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "21118996", "url": "https://glygen.org/publication/PubMed/21118996" } ] }, { "title": "Wnt/Ca2+ signaling pathway: a brief overview.", "journal": "Acta biochimica et biophysica Sinica", "date": "2011", "authors": "De A", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "21903638", "url": "https://glygen.org/publication/PubMed/21903638" } ] }, { "title": "TAK1, more than just innate immunity.", "journal": "IUBMB life", "date": "2012", "authors": "Dai L, Aye Thu C, Liu XY, Xi J, Cheung PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "22941947", "url": "https://glygen.org/publication/PubMed/22941947" } ] }, { "title": "The complex world of WNT receptor signalling.", "journal": "Nature reviews. Molecular cell biology", "date": "2012", "authors": "Niehrs C", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "23151663", "url": "https://glygen.org/publication/PubMed/23151663" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" }, { "database": "iPTMnet", "id": "O95644", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95644" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "The way Wnt works: components and mechanism.", "journal": "Growth factors (Chur, Switzerland)", "date": "2013", "authors": "Saito-Diaz K, Chen TW, Wang X, Thorne CA, Wallace HA, Page-McCaw A, Lee E", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "23256519", "url": "https://glygen.org/publication/PubMed/23256519" } ] }, { "title": "miR-92b controls glioma proliferation and invasion through regulating Wnt/beta-catenin signaling via Nemo-like kinase.", "journal": "Neuro-oncology", "date": "2013", "authors": "Wang K, Wang X, Zou J, Zhang A, Wan Y, Pu P, Song Z, Qian C, Chen Y, Yang S, Wang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "23416699", "url": "https://glygen.org/publication/PubMed/23416699" } ] }, { "title": "Structural studies on the regulation of Ca2+/calmodulin dependent protein kinase II.", "journal": "Current opinion in structural biology", "date": "2013", "authors": "Stratton MM, Chao LH, Schulman H, Kuriyan J", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "23632248", "url": "https://glygen.org/publication/PubMed/23632248" } ] }, { "title": "Nemo-like kinase (NLK) inhibits the progression of NSCLC via negatively modulating WNT signaling pathway.", "journal": "Journal of cellular biochemistry", "date": "2014", "authors": "Lv L, Wan C, Chen B, Li M, Liu Y, Ni T, Yang Y, Liu Y, Cong X, Mao G, Xue Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "23904219", "url": "https://glygen.org/publication/PubMed/23904219" } ] }, { "title": "FK-506, a novel immunosuppressant isolated from a Streptomyces. I. Fermentation, isolation, and physico-chemical and biological characteristics.", "journal": "The Journal of antibiotics", "date": "1987", "authors": "Kino T, Hatanaka H, Hashimoto M, Nishiyama M, Goto T, Okuhara M, Kohsaka M, Aoki H, Imanaka H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2025928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2025928" } ], "reference": [ { "type": "PubMed", "id": "2445721", "url": "https://glygen.org/publication/PubMed/2445721" } ] }, { "title": "Counter-regulation of T cell effector function by differentially activated p38.", "journal": "The Journal of experimental medicine", "date": "2014", "authors": "Alam MS, Gaida MM, Ogawa Y, Kolios AG, Lasitschka F, Ashwell JD", "evidence": [ { "database": "iPTMnet", "id": "O95644", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95644" } ], "reference": [ { "type": "PubMed", "id": "24863062", "url": "https://glygen.org/publication/PubMed/24863062" } ] }, { "title": "K-Ras Promotes Tumorigenicity through Suppression of Non-canonical Wnt Signaling.", "journal": "Cell", "date": "2015", "authors": "Wang MT, Holderfield M, Galeas J, Delrosario R, To MD, Balmain A, McCormick F", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "26590425", "url": "https://glygen.org/publication/PubMed/26590425" } ] }, { "title": "NFATc1 phosphorylation by DYRK1A increases its protein stability.", "journal": "PloS one", "date": "2017", "authors": "Liu Heng, Wang Ketao, Chen Shuai, Sun Qian, Zhang Yuankai, Chen Long, Sun Xiulian", "evidence": [ { "database": "iPTMnet", "id": "O95644", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95644" } ], "reference": [ { "type": "PubMed", "id": "28235034", "url": "https://glygen.org/publication/PubMed/28235034" } ] }, { "title": "Purification and characterization of membrane-bound phospholipase C specific for phosphoinositides from human platelets.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Banno Y, Yada Y, Nozawa Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "2841328", "url": "https://glygen.org/publication/PubMed/2841328" } ] }, { "title": "Rapamycin and FK506 derivative TH2849 could ameliorate neurodegenerative diseases through autophagy with low immunosuppressive effect.", "journal": "CNS neuroscience & therapeutics", "date": "2019", "authors": "Ding L, Nan WH, Zhu XB, Li XM, Zhou LY, Chen HJ, Yu L, Ullah Khan F, Zhong HB, Shi XJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2025928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2025928" } ], "reference": [ { "type": "PubMed", "id": "30294901", "url": "https://glygen.org/publication/PubMed/30294901" } ] }, { "title": "A triarylphosphine-trimethylpiperidine reagent for the one-step derivatization and enrichment of protein post-translational modifications and identification by mass spectrometry.", "journal": "Chemical communications (Cambridge, England)", "date": "2018", "authors": "Huo B, Zhang W, Zhao X, Dong H, Yu Y, Wang J, Qian X, Qin W", "evidence": [ { "database": "O-GlcNAc Database", "id": "O95644", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95644" } ], "reference": [ { "type": "PubMed", "id": "30379171", "url": "https://glygen.org/publication/PubMed/30379171" } ] }, { "title": "SIRT3-and FAK-mediated acetylation-phosphorylation crosstalk of NFATc1 regulates N\u03b5-carboxymethyl-lysine-induced vascular calcification in diabetes mellitus.", "journal": "Atherosclerosis", "date": "2023-07", "authors": "Sun Zhen, Zhang Lili, Yin Kai, Zang Guangyao, Qian Yongjiang, Mao Xiang, Li Lihua, Jing Qing, Wang Zhongqun", "evidence": [ { "database": "RefSeq", "id": "NP_001265602", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265602" } ], "reference": [ { "type": "PubMed", "id": "37392543", "url": "https://glygen.org/publication/PubMed/37392543" } ] }, { "title": "USP7-mediated JUND suppresses RCAN2 transcription and elevates NFATC1 to enhance stem cell property in colorectal cancer.", "journal": "Cell biology and toxicology", "date": "2023-08-03", "authors": "Chang Yunli, Chen Lingling, Tang Jie, Chen Guoyu, Ji Jieru, Xu Ming", "evidence": [ { "database": "RefSeq", "id": "NP_001265602", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265602" } ], "reference": [ { "type": "PubMed", "id": "37535148", "url": "https://glygen.org/publication/PubMed/37535148" } ] }, { "title": "Clinical value of echocardiography combined with serum Cav-1, NFATc1, and PAI-1 in the diagnosis of Kawasaki disease complicated with coronary artery lesions.", "journal": "Heart and vessels", "date": "2024-01", "authors": "Zhang Yanxia, Liu Jieqiong", "evidence": [ { "database": "RefSeq", "id": "NP_001265602", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265602" } ], "reference": [ { "type": "PubMed", "id": "37758852", "url": "https://glygen.org/publication/PubMed/37758852" } ] }, { "title": "The role of NFATc1 in the progression and metastasis of prostate cancer: A review on the molecular mechanisms and signaling pathways.", "journal": "Cell biology international", "date": "2023-12", "authors": "Hasani Samaneh, Fathabadi Farshid, Saeidi Saman, Mohajernoei Pouya, Hesari Zahra", "evidence": [ { "database": "RefSeq", "id": "NP_001265602", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265602" } ], "reference": [ { "type": "PubMed", "id": "37814550", "url": "https://glygen.org/publication/PubMed/37814550" } ] }, { "title": "Exosome-targeted delivery of METTL14 regulates NFATc1 m6A methylation levels to correct osteoclast-induced bone resorption.", "journal": "Cell death & disease", "date": "2023-11-13", "authors": "Yang Jin-Gang, Sun Bao, Wang Zheng, Li Xing, Gao Jia-Hui, Qian Jia-Jun, Li Jiang, Wei Wen-Jia, Zhang Ping, Wang Wei", "evidence": [ { "database": "RefSeq", "id": "NP_001265602", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265602" } ], "reference": [ { "type": "PubMed", "id": "37957146", "url": "https://glygen.org/publication/PubMed/37957146" } ] }, { "title": "Tyrosine phosphorylation and activation of Bruton tyrosine kinase upon Fc epsilon RI cross-linking.", "journal": "Molecular and cellular biology", "date": "1994", "authors": "Kawakami Y, Yao L, Miura T, Tsukada S, Witte ON, Kawakami T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "7518558", "url": "https://glygen.org/publication/PubMed/7518558" } ] }, { "title": "Phosphorylation of the transcription factor NFATp inhibits its DNA binding activity in cyclosporin A-treated human B and T cells.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Park J, Yaseen NR, Hogan PG, Rao A, Sharma S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2025928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2025928" } ], "reference": [ { "type": "PubMed", "id": "7657645", "url": "https://glygen.org/publication/PubMed/7657645" } ] }, { "title": "NF-AT components define a family of transcription factors targeted in T-cell activation.", "journal": "Nature", "date": "1994", "authors": "Northrop J P, Ho S N, Chen L, Thomas D J, Timmerman L A, Nolan G P, Admon A, Crabtree G R", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "reference": [ { "type": "PubMed", "id": "8202141", "url": "https://glygen.org/publication/PubMed/8202141" } ] }, { "title": "Identification of a physical interaction between calcineurin and nuclear factor of activated T cells (NFATp).", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Wesselborg S, Fruman DA, Sagoo JK, Bierer BE, Burakoff SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2025928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2025928" } ], "reference": [ { "type": "PubMed", "id": "8576111", "url": "https://glygen.org/publication/PubMed/8576111" } ] }, { "title": "Activation of BTK by a phosphorylation mechanism initiated by SRC family kinases.", "journal": "Science (New York, N.Y.)", "date": "1996", "authors": "Rawlings DJ, Scharenberg AM, Park H, Wahl MI, Lin S, Kato RM, Fluckiger AC, Witte ON, Kinet JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "8629002", "url": "https://glygen.org/publication/PubMed/8629002" } ] }, { "title": "Regulation of Btk function by a major autophosphorylation site within the SH3 domain.", "journal": "Immunity", "date": "1996", "authors": "Park H, Wahl MI, Afar DE, Turck CW, Rawlings DJ, Tam C, Scharenberg AM, Kinet JP, Witte ON", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "8630736", "url": "https://glygen.org/publication/PubMed/8630736" } ] }, { "title": "Calcineurin binds the transcription factor NFAT1 and reversibly regulates its activity.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Loh C, Shaw KT, Carew J, Viola JP, Luo C, Perrino BA, Rao A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "8631904", "url": "https://glygen.org/publication/PubMed/8631904" } ] }, { "title": "Role of kinases and the phosphatase calcineurin in the nuclear shuttling of transcription factor NF-AT4.", "journal": "Nature", "date": "1996", "authors": "Shibasaki F, Price ER, Milan D, McKeon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-2025928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2025928" } ], "reference": [ { "type": "PubMed", "id": "8684469", "url": "https://glygen.org/publication/PubMed/8684469" } ] }, { "title": "Characterization of a new isoform of the NFAT (nuclear factor of activated T cells) gene family member NFATc.", "journal": "J. Biol. Chem.", "date": "1996", "authors": "Park J, Takeuchi A, Sharma S", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "reference": [ { "type": "PubMed", "id": "8702849", "url": "https://glygen.org/publication/PubMed/8702849" } ] }, { "title": "Interaction of calcineurin with a domain of the transcription factor NFAT1 that controls nuclear import.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Luo C, Shaw KT, Raghavan A, Aramburu J, Garcia-Cozar F, Perrino BA, Hogan PG, Rao A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "8799126", "url": "https://glygen.org/publication/PubMed/8799126" } ] }, { "title": "Unusual Rel-like architecture in the DNA-binding domain of the transcription factor NFATc.", "journal": "Nature", "date": "1997", "authors": "Wolfe S A, Zhou P, D\u00f6tsch V, Chen L, You A, Ho S N, Crabtree G R, Wagner G, Verdine G L", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "reference": [ { "type": "PubMed", "id": "8990122", "url": "https://glygen.org/publication/PubMed/8990122" } ] }, { "title": "Nuclear export of NF-ATc enhanced by glycogen synthase kinase-3.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Beals CR, Sheridan CM, Turck CW, Gardner P, Crabtree GR", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" }, { "database": "iPTMnet", "id": "O95644", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95644" } ], "reference": [ { "type": "PubMed", "id": "9072970", "url": "https://glygen.org/publication/PubMed/9072970" } ] }, { "title": "Modulation of embryonic intracellular Ca2+ signaling by Wnt-5A.", "journal": "Developmental biology", "date": "1997", "authors": "Slusarski DC, Yang-Snyder J, Busa WB, Moon RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "9073455", "url": "https://glygen.org/publication/PubMed/9073455" } ] }, { "title": "Nuclear localization of NF-ATc by a calcineurin-dependent, cyclosporin-sensitive intramolecular interaction.", "journal": "Genes & development", "date": "1997", "authors": "Beals CR, Clipstone NA, Ho SN, Crabtree GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2025928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2025928" } ], "reference": [ { "type": "PubMed", "id": "9106655", "url": "https://glygen.org/publication/PubMed/9106655" } ] }, { "title": "Expression of NFAT-family proteins in normal human T cells.", "journal": "Mol. Cell. Biol.", "date": "1997", "authors": "Lyakh L, Ghosh P, Rice N R", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "reference": [ { "type": "PubMed", "id": "9111316", "url": "https://glygen.org/publication/PubMed/9111316" } ] }, { "title": "Evidence that calcineurin is rate-limiting for primary human lymphocyte activation.", "journal": "The Journal of clinical investigation", "date": "1997", "authors": "Batiuk TD, Kung L, Halloran PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2025928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2025928" } ], "reference": [ { "type": "PubMed", "id": "9312192", "url": "https://glygen.org/publication/PubMed/9312192" } ] }, { "title": "Interaction of Wnt and a Frizzled homologue triggers G-protein-linked phosphatidylinositol signalling.", "journal": "Nature", "date": "1997", "authors": "Slusarski DC, Corces VG, Moon RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "9389482", "url": "https://glygen.org/publication/PubMed/9389482" } ] }, { "title": "Solution structure of the core NFATC1/DNA complex.", "journal": "Cell", "date": "1998", "authors": "Zhou P, Sun L J, D\u00f6tsch V, Wagner G, Verdine G L", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "reference": [ { "type": "PubMed", "id": "9506523", "url": "https://glygen.org/publication/PubMed/9506523" } ] }, { "title": "Two-site interaction of nuclear factor of activated T cells with activated calcineurin.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Garcia-Cozar FJ, Okamura H, Aramburu JF, Shaw KT, Pelletier L, Showalter R, Villafranca E, Rao A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2025928", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2025928" } ], "reference": [ { "type": "PubMed", "id": "9727000", "url": "https://glygen.org/publication/PubMed/9727000" } ] } ], "pathway": [ { "id": "hsa:4772", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:4772", "resource": "KEGG Pathway" }, { "id": "R-HSA-2025928", "name": "Calcineurin activates NFAT", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2025928", "resource": "Reactome", "description": "Calcineurin activates NFAT" }, { "id": "R-HSA-2871809", "name": "FCERI mediated Ca+2 mobilization", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809", "resource": "Reactome", "description": "FCERI mediated Ca+2 mobilization" }, { "id": "R-HSA-4086398", "name": "Ca2+ pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398", "resource": "Reactome", "description": "Ca2+ pathway" }, { "id": "R-HSA-5607763", "name": "CLEC7A (Dectin-1) induces NFAT activation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607763", "resource": "Reactome", "description": "CLEC7A (Dectin-1) induces NFAT activation" } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZE20-1", "protein_name": "Nuclear factor of activated T-cells 1", "gene_name": "Nfatc1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MPSTSFPVPSKFPLGPPAAVCGSGETLRPAPLAGGTMKAAEEEHYSYASPSVTSTLPLPTAHSALPAACHDLQTSTPGISAVPSANHPSGYGGAVDSGPSGYFLSSGNTRPNGAPTLESPRIEITSYLGLHHGSNQFFHDVEVEDVLPSCKRSPSTATLHLPSLEAYRDPSCLSPASSLSSRSCNSEASSYESNYSYPYASPQTSPWQSPCVSPKTTDPEEGFPRSLGACHLLGSPRHSPSTSPRASVTEESWLGARGSRPTSPCNKRKYSLNGRQPSCSPHHSPTPSPHGSPRVSVTEDTWLGNTTQYTSSAIVAAINALTTDSTLDLGDGVPIKSRKTALEHVPSVALKVEPAGEDLGTTPPTSDFPPEEFAFQHLRKGAFCEQYLSVPQASYQWAKPKSLSPTSYMSPSLPALDWQLPSHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPVVQLHGYLENEPLTLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENNMRAIIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPSGRTLSLQVASNPIECSQRSAQELPLVEKQSTDSYPVIGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVLEIPPFRNQRITSPVQVSFYVCNGKRKRSQYQHFTYLPANVPIIKTEPTDDFEPALTCGPMSQGLSPLPRPYYSQQLTAPPDPGSCLVAGFAPCSQRNTLMPTSPNASPKLHDLSSPAYAKGLANPGHSGHLGLQPPASEAPTMQELPRPMAVQPNSPEQPTSVRLQPQVSPHLNSSCPLGLQQVLYPNSPSSPLPPAAHEPTCLQPSALPPDVGHRQQQPQKVHRNESPSILPEVCEDSDHNLAPVPVVIKQEPEELDQLYLDDVNEIIRNDLSSTIPHS", "length": 939 }, "evidence": [ { "id": "O95644", "url": "https://omabrowser.org/oma/group/O95644/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "O88942-1", "protein_name": "Nuclear factor of activated T-cells, cytoplasmic 1", "gene_name": "Nfatc1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MPNTSFPVPSKFPLGPPAAVCGSGETLRPAPPSGGTMKAAEEEHYSYVSPSVTSTLPLPTAHSALPAACHDLQTSTPGISAVPSANHPPSYGGAVDSGPSGYFLSSGNTRPNGAPTLESPRIEITSYLGLHHGSGQFFHDVEVEDVLPSCKRSPSTATLHLPSLEAYRDPSCLSPASSLSSRSCNSEASSYESNYSYPYASPQTSPWQSPCVSPKTTDPEEGFPRSLGACHLLGSPRHSPSTSPRASITEESWLGARGSRPTSPCNKRKYSLNGRQPSCSPHHSPTPSPHGSPRVSVTEDTWLGNTTQYTSSAIVAAINALTTDSTLDLGDGVPIKSRKTALEHAPSVALKVEPAGEDLGTTPPTSDFPPEEYTFQHLRKGAFCEQYLSVPQASYQWAKPKSLSPTSYMSPSLPALDWQLPSHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLTLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEIILSNTKVLEIPLLPENNMRAIIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPNGRTLSLQVASNPIECSQRSAQELPLVEKQSTDSYPVIGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVEIPPFRNQRITSPAQVSFYVCNGKRKRSQYQRFTYLPANGNSVFLTLSSESELRGGFY", "length": 717 }, "evidence": [ { "id": "45921304", "url": "http://www.informatics.jax.org/homology/45921304", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 11, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity", "id": "GO:0003700", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003700", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" }, { "name": "sequence-specific double-stranded DNA binding", "id": "GO:1990837", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990837", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" }, { "name": "nucleic acid binding", "id": "GO:0003676", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003676", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" }, { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" }, { "name": "mitogen-activated protein kinase p38 binding", "id": "GO:0048273", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048273", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" }, { "name": "DNA-binding transcription activator activity, RNA polymerase II-specific", "id": "GO:0001228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001228", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" }, { "name": "transcription coactivator binding", "id": "GO:0001223", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001223", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" }, { "name": "RNA polymerase II-specific DNA-binding transcription factor binding", "id": "GO:0061629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061629", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" }, { "name": "FK506 binding", "id": "GO:0005528", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005528", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 9, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" }, { "name": "nuclear body", "id": "GO:0016604", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016604", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" }, { "name": "perinuclear region of cytoplasm", "id": "GO:0048471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" }, { "name": "transcription regulator complex", "id": "GO:0005667", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005667", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" }, { "name": "chromatin", "id": "GO:0000785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000785", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" }, { "name": "sarcoplasm", "id": "GO:0016528", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016528", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 16, "go_terms": [ { "name": "negative regulation of vascular associated smooth muscle cell differentiation", "id": "GO:1905064", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905064", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" }, { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" }, { "name": "intracellular signal transduction", "id": "GO:0035556", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035556", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" }, { "name": "response to muscle activity", "id": "GO:0014850", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014850", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" }, { "name": "cellular response to transforming growth factor beta stimulus", "id": "GO:0071560", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071560", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" }, { "name": "negative regulation of Wnt signaling pathway", "id": "GO:0030178", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030178", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" }, { "name": "cellular response to tumor necrosis factor", "id": "GO:0071356", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071356", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" }, { "name": "positive regulation of DNA biosynthetic process", "id": "GO:2000573", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000573", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" }, { "name": "wound healing", "id": "GO:0042060", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042060", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" }, { "name": "skeletal muscle adaptation", "id": "GO:0043501", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043501", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" }, { "name": "aortic valve morphogenesis", "id": "GO:0003180", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003180", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" }, { "name": "pulmonary valve morphogenesis", "id": "GO:0003184", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003184", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" }, { "name": "calcineurin-NFAT signaling cascade", "id": "GO:0033173", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033173", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" }, { "name": "mononuclear cell differentiation", "id": "GO:1903131", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903131", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 192, "end_pos": 194, "annotation": "n_glycosylation_sequon" }, { "start_pos": 303, "end_pos": 305, "annotation": "n_glycosylation_sequon" }, { "start_pos": 51, "end_pos": 53, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylated by NFATC-kinase and GSK3B; phosphorylation induces NFATC1 nuclear exit and dephosphorylation by calcineurin promotes nuclear import. Phosphorylation by PKA and DYRK2 negatively modulates nuclear accumulation, and promotes subsequent phosphorylation by GSK3B or casein kinase 1.", "evidence": [ { "database": "UniProtKB", "id": "O95644", "url": "https://www.uniprot.org/uniprot/O95644" }, { "database": "PubMed", "id": "9072970", "url": "https://glygen.org/publication/PubMed/9072970" }, { "database": "PubMed", "id": "16511445", "url": "https://glygen.org/publication/PubMed/16511445" }, { "database": "PubMed", "id": "12351631", "url": "https://glygen.org/publication/PubMed/12351631" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [ 246 ], "glycation_sites": [], "phosphorylation_sites": [ 117, 172, 175, 176, 178, 179, 181, 233, 237, 241, 245, 257, 261, 269, 278, 286, 290, 294, 403, 409 ], "sequon_annotation_sites": [ { "start_pos": 192, "end_pos": 194 }, { "start_pos": 303, "end_pos": 305 }, { "start_pos": 51, "end_pos": 53 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 27 }, { "field": "total_sites", "count": 20 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 92 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }