{ "uniprot_canonical_ac": "O95639-1", "uniprot_ac": "O95639", "uniprot_id": "CPSF4_HUMAN", "mass": { "chemical_mass": 30255.0, "monoisotopic_mass": 30255.0 }, "refseq": { "ac": "NP_001075028", "name": "cleavage and polyadenylation specificity factor subunit 4 isoform 2", "summary": "Inhibition of the nuclear export of poly(A)-containing mRNAs caused by the influenza A virus NS1 protein requires its effector domain. The NS1 effector domain functionally interacts with the cellular 30 kDa subunit of cleavage and polyadenylation specific factor 4, an essential component of the 3' end processing machinery of cellular pre-mRNAs. In influenza virus-infected cells, the NS1 protein is physically associated with cleavage and polyadenylation specific factor 4, 30kD subunit. Binding of the NS1 protein to the 30 kDa protein in vitro prevents CPSF binding to the RNA substrate and inhibits 3' end cleavage and polyadenylation of host pre-mRNAs. Thus the NS1 protein selectively inhibits the nuclear export of cellular, and not viral, mRNAs. Multiple alternatively spliced transcript variants that encode different isoforms have been described for this gene. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001075028" }, "gene_names": [ { "name": "CPSF4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O95639", "id": "O95639" }, { "name": "CPSF30; NAR; NEB-1; NEB1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001075028", "id": "NP_001075028" }, { "name": "CPSF30", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O95639", "id": "O95639" }, { "name": "CPSF4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001075028", "id": "NP_001075028" }, { "name": "NAR", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O95639", "id": "O95639" }, { "name": "NEB1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O95639", "id": "O95639" } ], "protein_names": [ { "name": "Cleavage and polyadenylation specificity factor subunit 4", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O95639" }, { "name": "CPSF 30 kDa subunit", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95639" }, { "name": "Cleavage and polyadenylation specificity factor 30 kDa subunit", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95639" }, { "name": "NS1 effector domain-binding protein 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95639" }, { "name": "Neb-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95639" }, { "name": "No arches homolog", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95639" }, { "name": "cleavage and polyadenylation specificity factor subunit 4 isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001075028", "id": "NP_001075028" }, { "name": "no arches-like zinc finger protein; cleavage and polyadenylation specificity factor subunit 4; no arches homolog; CPSF 30 kDa subunit; cleavage and polyadenylation specific factor 4, 30kDa; NS1 effector domain-binding protein 1; cleavage and polyadenylation specificity factor 30 kDa subunit", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001075028", "id": "NP_001075028" } ], "function": [ { "annotation": "CPSF4 promotes triple negative breast cancer metastasis by upregulating MDM4. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001075028", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001075028" }, { "database": "PubMed", "id": "34006850", "url": "https://glygen.org/publication/PubMed/34006850" } ] }, { "annotation": "CPSF4 promotes tumor-initiating phenotype by enhancing VEGF/NRP2/TAZ signaling in lung cancer. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001075028", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001075028" }, { "database": "PubMed", "id": "36567417", "url": "https://glygen.org/publication/PubMed/36567417" } ] }, { "annotation": "CPSF4 regulates circRNA formation and microRNA mediated gene silencing in hepatocellular carcinoma.", "evidence": [ { "database": "RefSeq", "id": "NP_001075028", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001075028" }, { "database": "PubMed", "id": "34103682", "url": "https://glygen.org/publication/PubMed/34103682" } ] }, { "annotation": "Cleavage and Polyadenylation-Specific Factor 4 (CPSF4) Expression Is Associated with Enhanced Prostate Cancer Cell Migration and Cell Cycle Dysregulation, In Vitro. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001075028", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001075028" }, { "database": "PubMed", "id": "37629142", "url": "https://glygen.org/publication/PubMed/37629142" } ] }, { "annotation": "Component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. CPSF4 binds RNA polymers with a preference for poly(U).", "evidence": [ { "database": "UniProtKB", "id": "B7Z7B0", "url": "https://www.uniprot.org/uniprot/B7Z7B0#function" }, { "database": "UniProtKB", "id": "RU369008", "url": "https://www.uniprot.org/uniprot/RU369008#function" }, { "database": "UniProtKB", "id": "C9JEV9", "url": "https://www.uniprot.org/uniprot/C9JEV9#function" }, { "database": "UniProtKB", "id": "O95639", "url": "https://www.uniprot.org/uniprot/O95639#function" }, { "database": "PubMed", "id": "9224719", "url": "https://glygen.org/publication/PubMed/9224719" }, { "database": "PubMed", "id": "14749727", "url": "https://glygen.org/publication/PubMed/14749727" }, { "database": "UniProtKB", "id": "H7C016", "url": "https://www.uniprot.org/uniprot/H7C016#function" }, { "database": "UniProtKB", "id": "H7C419", "url": "https://www.uniprot.org/uniprot/H7C419#function" }, { "database": "UniProtKB", "id": "C9K0K2", "url": "https://www.uniprot.org/uniprot/C9K0K2#function" } ] }, { "annotation": "Inhibition of the nuclear export of poly(A)-containing mRNAs caused by the influenza A virus NS1 protein requires its effector domain. The NS1 effector domain functionally interacts with the cellular 30 kDa subunit of cleavage and polyadenylation specific factor 4, an essential component of the 3' end processing machinery of cellular pre-mRNAs. In influenza virus-infected cells, the NS1 protein is physically associated with cleavage and polyadenylation specific factor 4, 30kD subunit. Binding of the NS1 protein to the 30 kDa protein in vitro prevents CPSF binding to the RNA substrate and inhibits 3' end cleavage and polyadenylation of host pre-mRNAs. Thus the NS1 protein selectively inhibits the nuclear export of cellular, and not viral, mRNAs. Multiple alternatively spliced transcript variants that encode different isoforms have been described for this gene. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001075028", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001075028" } ] }, { "annotation": "Overproduced CPSF4 Promotes Cell Proliferation and Invasion via PI3K-AKT Signaling Pathway in Oral Squamous Cell Carcinoma.", "evidence": [ { "database": "RefSeq", "id": "NP_001075028", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001075028" }, { "database": "PubMed", "id": "33535057", "url": "https://glygen.org/publication/PubMed/33535057" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "O95639", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95639" } ], "glycoeffect": [], "start_pos": 168, "end_pos": 168, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "Q", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "7", "chr_pos": "99452373", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "R168", "disease": [ { "disease_id": "DOID:2531", "recommended_name": { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes." }, "synonyms": [ { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematologic malignancy", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematologic neoplasm", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematological tumors", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "blood cancer", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic and lymphoid system tumor", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic cancer", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic neoplasm", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic tumors", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "malignant hematopoietic neoplasm", "description": "" } ] }, { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "85.23", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000160917", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000160917" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "83.39", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000160917", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000160917" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "86.96", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000160917", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000160917" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "90.04", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000160917", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000160917" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "90.6", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000160917", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000160917" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "89.13", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000160917", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000160917" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "83.26", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000160917", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000160917" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "86.98", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000160917", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000160917" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "90.57", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000160917", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000160917" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "79.54", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000160917", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000160917" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "83.4", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000160917", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000160917" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "93.23", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000160917", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000160917" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "93.08", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000160917", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000160917" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O95639", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95639" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O95639", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95639" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O95639", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95639" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O95639", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95639" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O95639", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95639" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O95639", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95639" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O95639", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95639" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O95639", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95639" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O95639", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95639" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O95639", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95639" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O95639", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95639" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O95639", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95639" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95639", "url": "https://www.uniprot.org/uniprot/O95639" } ], "common_name": "Human" } ], "gene": [ { "name": "CPSF4", "url": "https://www.uniprot.org/uniprot/O95639", "locus": { "chromosome": "7", "start_pos": 99457373, "end_pos": 99438922, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000160917", "url": "https://www.ensembl.org/id/ENSG00000160917" } ] } } ], "crossref": [ { "id": "ENSG00000160917", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000160917", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O95639", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95639", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "CPSF4", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CPSF4", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "10898", "url": "https://www.ncbi.nlm.nih.gov/gene/10898", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "2327", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=2327", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "C9JEV9", "url": "https://www.ebi.ac.uk/intact/interactors/id:C9JEV9*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "O95639", "url": "https://www.ebi.ac.uk/intact/interactors/id:O95639*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000571", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000571", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001878", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001878", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036855", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036855", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036875", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036875", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR041686", "url": "https://www.ebi.ac.uk/interpro/entry/IPR041686", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR045348", "url": "https://www.ebi.ac.uk/interpro/entry/IPR045348", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:10898", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10898", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "603052", "url": "http://www.omim.org/entry/603052", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O95639", "url": "https://www.nextprot.org/entry/NX_O95639", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O95639", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95639", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "NSCKQYV", "url": "https://omabrowser.org/oma/group/NSCKQYV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "33612at2759", "url": "http://www.orthodb.org/?query=33612at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23102", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23102", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23102:SF18", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23102:SF18", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2D9N", "url": "https://www.rcsb.org/structure/2D9N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2RHK", "url": "https://www.rcsb.org/structure/2RHK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6DNH", "url": "https://www.rcsb.org/structure/6DNH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6FUW", "url": "https://www.rcsb.org/structure/6FUW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6URG", "url": "https://www.rcsb.org/structure/6URG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6URO", "url": "https://www.rcsb.org/structure/6URO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7K95", "url": "https://www.rcsb.org/structure/7K95", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7ZYH", "url": "https://www.rcsb.org/structure/7ZYH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8E3I", "url": "https://www.rcsb.org/structure/8E3I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8E3Q", "url": "https://www.rcsb.org/structure/8E3Q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00098", "url": "http://pfam.xfam.org/family/PF00098", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00642", "url": "http://pfam.xfam.org/family/PF00642", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF14608", "url": "http://pfam.xfam.org/family/PF14608", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF15663", "url": "http://pfam.xfam.org/family/PF15663", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O95639", "url": "https://pharos.nih.gov/targets/O95639", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O95639", "url": "http://purl.obolibrary.org/obo/PR_O95639", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-159231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159231", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-168315", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168315", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-72187", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72187", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-72203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72203", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-73856", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73856", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-77595", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-77595", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001075028", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001075028", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "B7Z7B0", "url": "https://www.uniprot.org/uniprot/B7Z7B0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B7Z7B0-1", "url": "https://www.uniprot.org/uniprot/B7Z7B0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JEV9", "url": "https://www.uniprot.org/uniprot/C9JEV9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JEV9-1", "url": "https://www.uniprot.org/uniprot/C9JEV9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9K0K2", "url": "https://www.uniprot.org/uniprot/C9K0K2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9K0K2-1", "url": "https://www.uniprot.org/uniprot/C9K0K2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WEL7", "url": "https://www.uniprot.org/uniprot/F8WEL7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WEL7-1", "url": "https://www.uniprot.org/uniprot/F8WEL7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7C016", "url": "https://www.uniprot.org/uniprot/H7C016", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7C016-1", "url": "https://www.uniprot.org/uniprot/H7C016-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7C419", "url": "https://www.uniprot.org/uniprot/H7C419", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7C419-1", "url": "https://www.uniprot.org/uniprot/H7C419-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95639", "url": "https://www.uniprot.org/uniprot/O95639", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95639-1", "url": "https://www.uniprot.org/uniprot/O95639-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95639-2", "url": "https://www.uniprot.org/uniprot/O95639-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95639-3", "url": "https://www.uniprot.org/uniprot/O95639-3", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPAKQSNNPPLQRSSSLIQLTSQNSSPNQQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFLSGQ", "length": 269, "header": "sp|O95639-1|CPSF4_HUMAN Isoform 1 of Cleavage and polyadenylation specificity factor subunit 4 OS=Homo sapiens OX=9606 GN=CPSF4 PE=1 SV=1 CANONICAL=O95639-1" }, "isoforms": [ { "isoform_ac": "B7Z7B0-1", "url": "", "sequence": { "sequence": "MCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPAKQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFLSGQ", "length": 191, "header": "tr|B7Z7B0-1|CPSF4_HUMAN Computationally mapped isoform of Cleavage and polyadenylation specificity factor subunit 4 OS=Homo sapiens OX=9606 GN=CPSF4 PE=1 SV=1 CANONICAL=O95639-1" }, "locus": { "chromosome": "7", "start_pos": 99456497, "end_pos": 99448126, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000441580.5", "url": "https://www.ensembl.org/id/ENST00000441580.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000402224.1", "url": "https://www.ensembl.org/id/ENSP00000402224.1" } ] } }, { "isoform_ac": "C9JEV9-1", "url": "", "sequence": { "sequence": "MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPAKRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFLSGQ", "length": 211, "header": "tr|C9JEV9-1|CPSF4_HUMAN Computationally mapped isoform of Cleavage and polyadenylation specificity factor subunit 4 OS=Homo sapiens OX=9606 GN=CPSF4 PE=1 SV=1 CANONICAL=O95639-1" }, "locus": { "chromosome": "7", "start_pos": 99456497, "end_pos": 99439083, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000451876.5", "url": "https://www.ensembl.org/id/ENST00000451876.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000396060.1", "url": "https://www.ensembl.org/id/ENSP00000396060.1" } ] } }, { "isoform_ac": "C9K0K2-1", "url": "", "sequence": { "sequence": "MCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFM", "length": 112, "header": "tr|C9K0K2-1|CPSF4_HUMAN Computationally mapped isoform of Cleavage and polyadenylation specificity factor subunit 4 OS=Homo sapiens OX=9606 GN=CPSF4 PE=1 SV=1 CANONICAL=O95639-1" }, "locus": { "chromosome": "7", "start_pos": 99450793, "end_pos": 99448126, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000412686.5", "url": "https://www.ensembl.org/id/ENST00000412686.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000401150.1", "url": "https://www.ensembl.org/id/ENSP00000401150.1" } ] } }, { "isoform_ac": "F8WEL7-1", "url": "", "sequence": { "sequence": "MDKSGAAVCEFFLKAACGKEETGFHRDSQDGLRASQDGLDLLTL", "length": 44, "header": "tr|F8WEL7-1|F8WEL7_HUMAN Computationally mapped isoform of Cleavage and polyadenylation specific factor 4 OS=Homo sapiens OX=9606 GN=CPSF4 PE=1 SV=1 CANONICAL=O95639-1" }, "locus": { "chromosome": "7", "start_pos": 99447846, "end_pos": 99439179, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000430038.5", "url": "https://www.ensembl.org/id/ENST00000430038.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000401496.1", "url": "https://www.ensembl.org/id/ENSP00000401496.1" } ] } }, { "isoform_ac": "H7C016-1", "url": "", "sequence": { "sequence": "TESGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRGFCKHALDLNCPWEPPSSPHCRSRHSLQQSREPRRSSGSCRVKTAARATGDPGHWSRSPVTSVARKDTTPTDAPKGTWPFSVDSDSSWSQLRAARGPRCWECAFNCFMRLLARLWLELARRHVGFITLRGHVC", "length": 229, "header": "tr|H7C016-1|H7C016_HUMAN Computationally mapped isoform of Cleavage and polyadenylation specificity factor subunit 4 OS=Homo sapiens OX=9606 GN=CPSF4 PE=1 SV=1 CANONICAL=O95639-1" }, "locus": { "chromosome": "7", "start_pos": 99456645, "end_pos": 99444785, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000452047.1", "url": "https://www.ensembl.org/id/ENST00000452047.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000392584.1", "url": "https://www.ensembl.org/id/ENSP00000392584.1" } ] } }, { "isoform_ac": "H7C419-1", "url": "", "sequence": { "sequence": "XKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPAKQSNNPPLQRSSSLIQLTSQNSSPNQQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCCCLSLLFPHFLLFPVWRERTLRQQMHQRALGLSQWTVTAAGASSEQPGGPAVGSVHLTVSCAC", "length": 193, "header": "tr|H7C419-1|H7C419_HUMAN Computationally mapped isoform of Cleavage and polyadenylation specificity factor subunit 4 OS=Homo sapiens OX=9606 GN=CPSF4 PE=1 SV=1 CANONICAL=O95639-1" }, "locus": { "chromosome": "7", "start_pos": 99456578, "end_pos": 99450325, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000440514.1", "url": "https://www.ensembl.org/id/ENST00000440514.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000415188.1", "url": "https://www.ensembl.org/id/ENSP00000415188.1" } ] } }, { "isoform_ac": "O95639-1", "url": "", "sequence": { "sequence": "MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPAKQSNNPPLQRSSSLIQLTSQNSSPNQQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFLSGQ", "length": 269, "header": "sp|O95639-1|CPSF4_HUMAN Isoform 1 of Cleavage and polyadenylation specificity factor subunit 4 OS=Homo sapiens OX=9606 GN=CPSF4 PE=1 SV=1 CANONICAL=O95639-1" }, "locus": { "chromosome": "7", "start_pos": 99456497, "end_pos": 99439083, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000292476.10", "url": "https://www.ensembl.org/id/ENST00000292476.10" }, { "database": "Ensembl Peptide", "id": "ENSP00000292476.5", "url": "https://www.ensembl.org/id/ENSP00000292476.5" } ] } }, { "isoform_ac": "O95639-2", "url": "", "sequence": { "sequence": "MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPAKQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFLSGQ", "length": 244, "header": "sp|O95639-2|CPSF4_HUMAN Isoform 2 of Cleavage and polyadenylation specificity factor subunit 4 OS=Homo sapiens OX=9606 GN=CPSF4 PE=1 SV=1 CANONICAL=O95639-1" }, "locus": { "chromosome": "7", "start_pos": 99456497, "end_pos": 99439083, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000436336.6", "url": "https://www.ensembl.org/id/ENST00000436336.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000395311.2", "url": "https://www.ensembl.org/id/ENSP00000395311.2" } ] } }, { "isoform_ac": "O95639-3", "url": "", "sequence": { "sequence": "MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPAKRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFLSGQ", "length": 243, "header": "sp|O95639-3|CPSF4_HUMAN Isoform 3 of Cleavage and polyadenylation specificity factor subunit 4 OS=Homo sapiens OX=9606 GN=CPSF4 PE=1 SV=1 CANONICAL=O95639-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O95639", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95639" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" } ] } ], "phosphorylation": [ { "start_pos": 200, "end_pos": 200, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95639", "url": "https://www.uniprot.org/uniprot/O95639" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O95639", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95639" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ], "site_lbl": "Ser200" }, { "start_pos": 202, "end_pos": 202, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95639", "url": "https://www.uniprot.org/uniprot/O95639" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "O95639", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95639" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "O95639", "url": "http://phospho.elm.eu.org/byAccession/O95639.html" } ], "site_lbl": "Ser202" }, { "start_pos": 212, "end_pos": 212, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95639", "url": "https://www.uniprot.org/uniprot/O95639" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "O95639", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95639" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "phospho.ELM", "id": "O95639", "url": "http://phospho.elm.eu.org/byAccession/O95639.html" } ], "site_lbl": "Ser212" }, { "start_pos": 267, "end_pos": 267, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95639", "url": "https://www.uniprot.org/uniprot/O95639" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O95639", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95639" } ], "site_lbl": "Ser267" }, { "start_pos": 7, "end_pos": 7, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95639", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95639" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser7" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Influenza A virus NS1 protein targets poly(A)-binding protein II of the cellular 3'-end processing machinery.", "journal": "The EMBO journal", "date": "1999", "authors": "Chen Z, Li Y, Krug RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-168315", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168315" } ], "reference": [ { "type": "PubMed", "id": "10205180", "url": "https://glygen.org/publication/PubMed/10205180" } ] }, { "title": "Formation of mRNA 3' ends in eukaryotes: mechanism, regulation, and interrelationships with other steps in mRNA synthesis.", "journal": "Microbiology and molecular biology reviews : MMBR", "date": "1999", "authors": "Zhao J, Hyman L, Moore C", "evidence": [ { "database": "Reactome", "id": "R-HSA-72187", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72187" } ], "reference": [ { "type": "PubMed", "id": "10357856", "url": "https://glygen.org/publication/PubMed/10357856" } ] }, { "title": "3'-End processing of pre-mRNA in eukaryotes.", "journal": "FEMS microbiology reviews", "date": "1999", "authors": "Wahle E, Ruegsegger U", "evidence": [ { "database": "Reactome", "id": "R-HSA-72187", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72187" } ], "reference": [ { "type": "PubMed", "id": "10371034", "url": "https://glygen.org/publication/PubMed/10371034" } ] }, { "title": "Localization in the nucleolus and coiled bodies of protein subunits of the ribonucleoprotein ribonuclease P.", "journal": "The Journal of cell biology", "date": "1999", "authors": "Jarrous N, Wolenski JS, Wesolowski D, Lee C, Altman S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "10444065", "url": "https://glygen.org/publication/PubMed/10444065" } ] }, { "title": "The protein Aly links pre-messenger-RNA splicing to nuclear export in metazoans.", "journal": "Nature", "date": "2000", "authors": "Zhou Z, Luo MJ, Straesser K, Katahira J, Hurt E, Reed R", "evidence": [ { "database": "Reactome", "id": "R-HSA-159231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159231" } ], "reference": [ { "type": "PubMed", "id": "11014198", "url": "https://glygen.org/publication/PubMed/11014198" } ] }, { "title": "The 3'-end-processing factor CPSF is required for the splicing of single-intron pre-mRNAs in vivo.", "journal": "RNA (New York, N.Y.)", "date": "2001", "authors": "Li Y, Chen ZY, Wang W, Baker CC, Krug RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-168315", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168315" } ], "reference": [ { "type": "PubMed", "id": "11421366", "url": "https://glygen.org/publication/PubMed/11421366" } ] }, { "title": "Protein-RNA interactions in the subunits of human nuclear RNase P.", "journal": "RNA (New York, N.Y.)", "date": "2001", "authors": "Jiang T, Guerrier-Takada C, Altman S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "11455963", "url": "https://glygen.org/publication/PubMed/11455963" } ] }, { "title": "A eubacterial origin for the human tRNA nucleotidyltransferase?", "journal": "Biological chemistry", "date": "2001", "authors": "Reichert AS, Thurlow DL, Morl M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "11727826", "url": "https://glygen.org/publication/PubMed/11727826" } ] }, { "title": "Human ribonuclease P: subunits, function, and intranuclear localization.", "journal": "RNA (New York, N.Y.)", "date": "2002", "authors": "Jarrous N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "11871657", "url": "https://glygen.org/publication/PubMed/11871657" } ] }, { "title": "TREX is a conserved complex coupling transcription with messenger RNA export.", "journal": "Nature", "date": "2002", "authors": "Strasser K, Masuda S, Mason P, Pfannstiel J, Oppizzi M, Rodriguez-Navarro S, Rondon AG, Aguilera A, Struhl K, Reed R, Hurt E", "evidence": [ { "database": "Reactome", "id": "R-HSA-72187", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72187" } ], "reference": [ { "type": "PubMed", "id": "11979277", "url": "https://glygen.org/publication/PubMed/11979277" } ] }, { "title": "Steady-state nuclear localization of exportin-t involves RanGTP binding and two distinct nuclear pore complex interaction domains.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Kuersten S, Arts GJ, Walther TC, Englmeier L, Mattaj IW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "12138183", "url": "https://glygen.org/publication/PubMed/12138183" } ] }, { "title": "Crystal structures of the Bacillus stearothermophilus CCA-adding enzyme and its complexes with ATP or CTP.", "journal": "Cell", "date": "2002", "authors": "Li F, Xiong Y, Wang J, Cho HD, Tomita K, Weiner AM, Steitz TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "12526808", "url": "https://glygen.org/publication/PubMed/12526808" } ] }, { "title": "Cellular antiviral responses against influenza A virus are countered at the posttranscriptional level by the viral NS1A protein via its binding to a cellular protein required for the 3' end processing of cellular pre-mRNAS.", "journal": "Virology", "date": "2003", "authors": "Noah DL, Twu KY, Krug RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-168315", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168315" } ], "reference": [ { "type": "PubMed", "id": "12667806", "url": "https://glygen.org/publication/PubMed/12667806" } ] }, { "title": "A candidate prostate cancer susceptibility gene encodes tRNA 3' processing endoribonuclease.", "journal": "Nucleic acids research", "date": "2003", "authors": "Takaku H, Minagawa A, Takagi M, Nashimoto M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "12711671", "url": "https://glygen.org/publication/PubMed/12711671" } ] }, { "title": "Crystal structure of the human CCA-adding enzyme: insights into template-independent polymerization.", "journal": "Journal of molecular biology", "date": "2003", "authors": "Augustin MA, Reichert AS, Betat H, Huber R, Morl M, Steegborn C", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "12729736", "url": "https://glygen.org/publication/PubMed/12729736" } ] }, { "title": "Molecular evidence that the eukaryotic THO/TREX complex is required for efficient transcription elongation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Rondon AG, Jimeno S, Garcia-Rubio M, Aguilera A", "evidence": [ { "database": "Reactome", "id": "R-HSA-72187", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72187" } ], "reference": [ { "type": "PubMed", "id": "12871933", "url": "https://glygen.org/publication/PubMed/12871933" } ] }, { "title": "Human Fip1 is a subunit of CPSF that binds to U-rich RNA elements and stimulates poly(A) polymerase.", "journal": "The EMBO journal", "date": "2004", "authors": "Kaufmann I, Martin G, Friedlein A, Langen H, Keller W", "evidence": [ { "database": "UniProtKB", "id": "O95639", "url": "https://www.uniprot.org/uniprot/O95639" } ], "reference": [ { "type": "PubMed", "id": "14749727", "url": "https://glygen.org/publication/PubMed/14749727" } ] }, { "title": "Identification of a human endonuclease complex reveals a link between tRNA splicing and pre-mRNA 3' end formation.", "journal": "Cell", "date": "2004", "authors": "Paushkin SV, Patel M, Furia BS, Peltz SW, Trotta CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "15109492", "url": "https://glygen.org/publication/PubMed/15109492" } ] }, { "title": "Nuclear export of mRNA: from the site of transcription to the cytoplasm.", "journal": "Experimental cell research", "date": "2004", "authors": "Erkmann JA, Kutay U", "evidence": [ { "database": "Reactome", "id": "R-HSA-159231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159231" } ], "reference": [ { "type": "PubMed", "id": "15120988", "url": "https://glygen.org/publication/PubMed/15120988" } ] }, { "title": "The N-terminal half-domain of the long form of tRNase Z is required for the RNase 65 activity.", "journal": "Nucleic acids research", "date": "2004", "authors": "Takaku H, Minagawa A, Takagi M, Nashimoto M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "15317868", "url": "https://glygen.org/publication/PubMed/15317868" } ] }, { "title": "Recruitment of the human TREX complex to mRNA during splicing.", "journal": "Genes & development", "date": "2005", "authors": "Masuda S, Das R, Cheng H, Hurt E, Dorman N, Reed R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72187", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72187" } ], "reference": [ { "type": "PubMed", "id": "15998806", "url": "https://glygen.org/publication/PubMed/15998806" } ] }, { "title": "Naturally occurring mutations in human mitochondrial pre-tRNASer(UCN) can affect the transfer ribonuclease Z cleavage site, processing kinetics, and substrate secondary structure.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Yan H, Zareen N, Levinger L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "16361254", "url": "https://glygen.org/publication/PubMed/16361254" } ] }, { "title": "Cleavage of pre-tRNAs by the splicing endonuclease requires a composite active site.", "journal": "Nature", "date": "2006", "authors": "Trotta CR, Paushkin SV, Patel M, Li H, Peltz SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "16710424", "url": "https://glygen.org/publication/PubMed/16710424" } ] }, { "title": "Human mRNA export machinery recruited to the 5' end of mRNA.", "journal": "Cell", "date": "2006", "authors": "Cheng H, Dufu K, Lee CS, Hsu JL, Dias A, Reed R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72187", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72187" } ], "reference": [ { "type": "PubMed", "id": "17190602", "url": "https://glygen.org/publication/PubMed/17190602" } ] }, { "title": "A splice variant of the human CCA-adding enzyme with modified activity.", "journal": "Journal of molecular biology", "date": "2007", "authors": "Lizano E, Schuster J, Muller M, Kelso J, Morl M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "17204286", "url": "https://glygen.org/publication/PubMed/17204286" } ] }, { "title": "Interaction of immobilized human exportin-t with calf liver tRNA.", "journal": "RNA biology", "date": "2006", "authors": "Li S, Sprinzl M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "17224653", "url": "https://glygen.org/publication/PubMed/17224653" } ] }, { "title": "CRM1-mediated nuclear export: to the pore and beyond.", "journal": "Trends in cell biology", "date": "2007", "authors": "Hutten S, Kehlenbach RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-159231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159231" } ], "reference": [ { "type": "PubMed", "id": "17317185", "url": "https://glygen.org/publication/PubMed/17317185" } ] }, { "title": "ATP-dependent recruitment of export factor Aly/REF onto intronless mRNAs by RNA helicase UAP56.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Taniguchi I, Ohno M", "evidence": [ { "database": "Reactome", "id": "R-HSA-72187", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72187" } ], "reference": [ { "type": "PubMed", "id": "17984224", "url": "https://glygen.org/publication/PubMed/17984224" } ] }, { "title": "A comparative analysis of CCA-adding enzymes from human and E. coli: differences in CCA addition and tRNA 3'-end repair.", "journal": "Biochimie", "date": "2008", "authors": "Lizano E, Scheibe M, Rammelt C, Betat H, Morl M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "18226598", "url": "https://glygen.org/publication/PubMed/18226598" } ] }, { "title": "Binding of ATP to UAP56 is necessary for mRNA export.", "journal": "Journal of cell science", "date": "2008", "authors": "Kota KP, Wagner SR, Huerta E, Underwood JM, Nickerson JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-72187", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72187" } ], "reference": [ { "type": "PubMed", "id": "18411249", "url": "https://glygen.org/publication/PubMed/18411249" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "O95639", "url": "https://www.uniprot.org/uniprot/O95639" }, { "database": "iPTMnet", "id": "O95639-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95639-1" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Functional analyses for tRNase Z variants: an aspartate and a histidine in the active site are essential for the catalytic activity.", "journal": "Biochimica et biophysica acta", "date": "2008", "authors": "Elbarbary RA, Takaku H, Nashimoto M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "18809514", "url": "https://glygen.org/publication/PubMed/18809514" } ] }, { "title": "THO/Sub2p functions to coordinate 3'-end processing with gene-nuclear pore association.", "journal": "Cell", "date": "2008", "authors": "Rougemaille M, Dieppois G, Kisseleva-Romanova E, Gudipati RK, Lemoine S, Blugeon C, Boulay J, Jensen TH, Stutz F, Devaux F, Libri D", "evidence": [ { "database": "Reactome", "id": "R-HSA-72187", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72187" } ], "reference": [ { "type": "PubMed", "id": "18957205", "url": "https://glygen.org/publication/PubMed/18957205" } ] }, { "title": "RNase P without RNA: identification and functional reconstitution of the human mitochondrial tRNA processing enzyme.", "journal": "Cell", "date": "2008", "authors": "Holzmann J, Frank P, Loffler E, Bennett KL, Gerner C, Rossmanith W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "18984158", "url": "https://glygen.org/publication/PubMed/18984158" } ] }, { "title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.", "journal": "Analytical chemistry", "date": "2009", "authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S", "evidence": [ { "database": "iPTMnet", "id": "O95639-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95639-1" } ], "reference": [ { "type": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ] }, { "title": "mRNA nuclear export at a glance.", "journal": "Journal of cell science", "date": "2009", "authors": "Carmody SR, Wente SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-159231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159231" } ], "reference": [ { "type": "PubMed", "id": "19494120", "url": "https://glygen.org/publication/PubMed/19494120" } ] }, { "title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Pan C, Olsen JV, Daub H, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O95639-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95639-1" } ], "reference": [ { "type": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ] }, { "title": "Phosphorylation dynamics during early differentiation of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Van Hoof D, Munoz J, Braam SR, Pinkse MW, Linding R, Heck AJ, Mummery CL, Krijgsveld J", "evidence": [ { "database": "iPTMnet", "id": "O95639-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95639-1" } ], "reference": [ { "type": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" } ] }, { "title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.", "journal": "Science signaling", "date": "2009", "authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK", "evidence": [ { "database": "UniProtKB", "id": "O95639", "url": "https://www.uniprot.org/uniprot/O95639" }, { "database": "iPTMnet", "id": "O95639", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95639" } ], "reference": [ { "type": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" } ] }, { "title": "UIF, a New mRNA export adaptor that works together with REF/ALY, requires FACT for recruitment to mRNA.", "journal": "Current biology : CB", "date": "2009", "authors": "Hautbergue GM, Hung ML, Walsh MJ, Snijders AP, Chang CT, Jones R, Ponting CP, Dickman MJ, Wilson SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-72187", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72187" } ], "reference": [ { "type": "PubMed", "id": "19836239", "url": "https://glygen.org/publication/PubMed/19836239" } ] }, { "title": "Exploring the human leukocyte phosphoproteome using a microfluidic reversed-phase-TiO2-reversed-phase high-performance liquid chromatography phosphochip coupled to a quadrupole time-of-flight mass spectrometer.", "journal": "Analytical chemistry", "date": "2010", "authors": "Raijmakers R, Kraiczek K, de Jong AP, Mohammed S, Heck AJ", "evidence": [ { "database": "iPTMnet", "id": "O95639-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95639-1" } ], "reference": [ { "type": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O95639-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95639-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Regulation of histone mRNA in the unperturbed cell cycle: evidence suggesting control at two posttranscriptional steps.", "journal": "Molecular and cellular biology", "date": "1991", "authors": "Harris ME, Bohni R, Schneiderman MH, Ramamurthy L, Schumperli D, Marzluff WF", "evidence": [ { "database": "Reactome", "id": "R-HSA-159231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159231" } ], "reference": [ { "type": "PubMed", "id": "2017161", "url": "https://glygen.org/publication/PubMed/2017161" } ] }, { "title": "The closely related RNA helicases, UAP56 and URH49, preferentially form distinct mRNA export machineries and coordinately regulate mitotic progression.", "journal": "Molecular biology of the cell", "date": "2010", "authors": "Yamazaki T, Fujiwara N, Yukinaga H, Ebisuya M, Shiki T, Kurihara T, Kioka N, Kambe T, Nagao M, Nishida E, Masuda S", "evidence": [ { "database": "Reactome", "id": "R-HSA-72187", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72187" } ], "reference": [ { "type": "PubMed", "id": "20573985", "url": "https://glygen.org/publication/PubMed/20573985" } ] }, { "title": "The nuclear pore complex and nuclear transport.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2010", "authors": "Wente SR, Rout MP", "evidence": [ { "database": "Reactome", "id": "R-HSA-159231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159231" } ], "reference": [ { "type": "PubMed", "id": "20630994", "url": "https://glygen.org/publication/PubMed/20630994" } ] }, { "title": "ATP is required for interactions between UAP56 and two conserved mRNA export proteins, Aly and CIP29, to assemble the TREX complex.", "journal": "Genes & development", "date": "2010", "authors": "Dufu K, Livingstone MJ, Seebacher J, Gygi SP, Wilson SA, Reed R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72187", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72187" } ], "reference": [ { "type": "PubMed", "id": "20844015", "url": "https://glygen.org/publication/PubMed/20844015" } ] }, { "title": "The poly A polymerase Star-PAP controls 3'-end cleavage by promoting CPSF interaction and specificity toward the pre-mRNA.", "journal": "EMBO J.", "date": "2010", "authors": "Laishram RS, Anderson RA", "evidence": [ { "database": "UniProtKB", "id": "O95639", "url": "https://www.uniprot.org/uniprot/O95639" } ], "reference": [ { "type": "PubMed", "id": "21102410", "url": "https://glygen.org/publication/PubMed/21102410" } ] }, { "title": "HSPC117 is the essential subunit of a human tRNA splicing ligase complex.", "journal": "Science (New York, N.Y.)", "date": "2011", "authors": "Popow J, Englert M, Weitzer S, Schleiffer A, Mierzwa B, Mechtler K, Trowitzsch S, Will CL, Luhrmann R, Soll D, Martinez J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "21311021", "url": "https://glygen.org/publication/PubMed/21311021" } ] }, { "title": "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.", "journal": "Science signaling", "date": "2011", "authors": "Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B", "evidence": [ { "database": "UniProtKB", "id": "O95639", "url": "https://www.uniprot.org/uniprot/O95639" }, { "database": "iPTMnet", "id": "O95639", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95639" } ], "reference": [ { "type": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" } ] }, { "title": "RNA binding properties of conserved protein subunits of human RNase P.", "journal": "Nucleic acids research", "date": "2011", "authors": "Reiner R, Alfiya-Mor N, Berrebi-Demma M, Wesolowski D, Altman S, Jarrous N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "21450806", "url": "https://glygen.org/publication/PubMed/21450806" } ] }, { "title": "Localization of human RNase Z isoforms: dual nuclear/mitochondrial targeting of the ELAC2 gene product by alternative translation initiation.", "journal": "PloS one", "date": "2011", "authors": "Rossmanith W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "21559454", "url": "https://glygen.org/publication/PubMed/21559454" } ] }, { "title": "Involvement of human ELAC2 gene product in 3' end processing of mitochondrial tRNAs.", "journal": "RNA biology", "date": "2011", "authors": "Brzezniak LK, Bijata M, Szczesny RJ, Stepien PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "21593607", "url": "https://glygen.org/publication/PubMed/21593607" } ] }, { "title": "The export factor Yra1 modulates mRNA 3' end processing.", "journal": "Nature structural & molecular biology", "date": "2011", "authors": "Johnson SA, Kim H, Erickson B, Bentley DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-72187", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72187" } ], "reference": [ { "type": "PubMed", "id": "21947206", "url": "https://glygen.org/publication/PubMed/21947206" } ] }, { "title": "New clues to understand the role of THO and other functionally related factors in mRNP biogenesis.", "journal": "Biochimica et biophysica acta", "date": "2012", "authors": "Luna R, Rondon AG, Aguilera A", "evidence": [ { "database": "Reactome", "id": "R-HSA-72187", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72187" } ], "reference": [ { "type": "PubMed", "id": "22207203", "url": "https://glygen.org/publication/PubMed/22207203" } ] }, { "title": "The proteins PDIP3 and ZC11A associate with the human TREX complex in an ATP-dependent manner and function in mRNA export.", "journal": "PloS one", "date": "2012", "authors": "Folco EG, Lee CS, Dufu K, Yamazaki T, Reed R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72187", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72187" } ], "reference": [ { "type": "PubMed", "id": "22928037", "url": "https://glygen.org/publication/PubMed/22928037" } ] }, { "title": "Exportin t and Exportin 5: tRNA and miRNA biogenesis - and beyond.", "journal": "Biological chemistry", "date": "2012", "authors": "Leisegang MS, Martin R, Ramirez AS, Bohnsack MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "22944664", "url": "https://glygen.org/publication/PubMed/22944664" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "O95639", "url": "https://www.uniprot.org/uniprot/O95639" }, { "database": "iPTMnet", "id": "O95639", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95639" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Aly and THO are required for assembly of the human TREX complex and association of TREX components with the spliced mRNA.", "journal": "Nucleic acids research", "date": "2013", "authors": "Chi B, Wang Q, Wu G, Tan M, Wang L, Shi M, Chang X, Cheng H", "evidence": [ { "database": "Reactome", "id": "R-HSA-72187", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72187" } ], "reference": [ { "type": "PubMed", "id": "23222130", "url": "https://glygen.org/publication/PubMed/23222130" } ] }, { "title": "Chtop is a component of the dynamic TREX mRNA export complex.", "journal": "The EMBO journal", "date": "2013", "authors": "Chang CT, Hautbergue GM, Walsh MJ, Viphakone N, van Dijk TB, Philipsen S, Wilson SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-72187", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72187" } ], "reference": [ { "type": "PubMed", "id": "23299939", "url": "https://glygen.org/publication/PubMed/23299939" } ] }, { "title": "Aiding and abetting cancer: mRNA export and the nuclear pore.", "journal": "Trends in cell biology", "date": "2013", "authors": "Culjkovic-Kraljacic B, Borden KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-159231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159231" } ], "reference": [ { "type": "PubMed", "id": "23582887", "url": "https://glygen.org/publication/PubMed/23582887" } ] }, { "title": "Specificity factors in cytoplasmic polyadenylation.", "journal": "Wiley interdisciplinary reviews. RNA", "date": "2013", "authors": "Charlesworth A, Meijer HA, de Moor CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-72203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72203" } ], "reference": [ { "type": "PubMed", "id": "23776146", "url": "https://glygen.org/publication/PubMed/23776146" } ] }, { "title": "Structural and biochemical studies of SLIP1-SLBP identify DBP5 and eIF3g as SLIP1-binding proteins.", "journal": "Nucleic acids research", "date": "2013", "authors": "von Moeller H, Lerner R, Ricciardi A, Basquin C, Marzluff WF, Conti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-159231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159231" } ], "reference": [ { "type": "PubMed", "id": "23804756", "url": "https://glygen.org/publication/PubMed/23804756" } ] }, { "title": "Accurate cleavage and polyadenylation of exogenous RNA substrate.", "journal": "Cell", "date": "1985", "authors": "Moore CL, Sharp PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-72187", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72187" } ], "reference": [ { "type": "PubMed", "id": "2408761", "url": "https://glygen.org/publication/PubMed/2408761" } ] }, { "title": "Recruitment of TREX to the transcription machinery by its direct binding to the phospho-CTD of RNA polymerase II.", "journal": "PLoS genetics", "date": "2013", "authors": "Meinel DM, Burkert-Kautzsch C, Kieser A, O'Duibhir E, Siebert M, Mayer A, Cramer P, Soding J, Holstege FC, Strasser K", "evidence": [ { "database": "Reactome", "id": "R-HSA-72187", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72187" } ], "reference": [ { "type": "PubMed", "id": "24244187", "url": "https://glygen.org/publication/PubMed/24244187" } ] }, { "title": "A METTL3-METTL14 complex mediates mammalian nuclear RNA N6-adenosine methylation.", "journal": "Nature chemical biology", "date": "2014", "authors": "Liu J, Yue Y, Han D, Wang X, Fu Y, Zhang L, Jia G, Yu M, Lu Z, Deng X, Dai Q, Chen W, He C", "evidence": [ { "database": "Reactome", "id": "R-HSA-72203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72203" } ], "reference": [ { "type": "PubMed", "id": "24316715", "url": "https://glygen.org/publication/PubMed/24316715" } ] }, { "title": "Mammalian WTAP is a regulatory subunit of the RNA N6-methyladenosine methyltransferase.", "journal": "Cell research", "date": "2014", "authors": "Ping XL, Sun BF, Wang L, Xiao W, Yang X, Wang WJ, Adhikari S, Shi Y, Lv Y, Chen YS, Zhao X, Li A, Yang Y, Dahal U, Lou XM, Liu X, Huang J, Yuan WP, Zhu XF, Cheng T, Zhao YL, Wang X, Rendtlew Danielsen JM, Liu F, Yang YG", "evidence": [ { "database": "Reactome", "id": "R-HSA-72203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72203" } ], "reference": [ { "type": "PubMed", "id": "24407421", "url": "https://glygen.org/publication/PubMed/24407421" } ] }, { "title": "Identification and characterization of an RNA molecule that copurifies with RNase P activity from HeLa cells.", "journal": "Genes & development", "date": "1989", "authors": "Bartkiewicz M, Gold H, Altman S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "2470644", "url": "https://glygen.org/publication/PubMed/2470644" } ] }, { "title": "Analysis of orthologous groups reveals archease and DDX1 as tRNA splicing factors.", "journal": "Nature", "date": "2014", "authors": "Popow J, Jurkin J, Schleiffer A, Martinez J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "24870230", "url": "https://glygen.org/publication/PubMed/24870230" } ] }, { "title": "Perturbation of m6A writers reveals two distinct classes of mRNA methylation at internal and 5' sites.", "journal": "Cell reports", "date": "2014", "authors": "Schwartz S, Mumbach MR, Jovanovic M, Wang T, Maciag K, Bushkin GG, Mertins P, Ter-Ovanesyan D, Habib N, Cacchiarelli D, Sanjana NE, Freinkman E, Pacold ME, Satija R, Mikkelsen TS, Hacohen N, Zhang F, Carr SA, Lander ES, Regev A", "evidence": [ { "database": "Reactome", "id": "R-HSA-72203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72203" } ], "reference": [ { "type": "PubMed", "id": "24981863", "url": "https://glygen.org/publication/PubMed/24981863" } ] }, { "title": "On-enzyme refolding permits small RNA and tRNA surveillance by the CCA-adding enzyme.", "journal": "Cell", "date": "2015", "authors": "Kuhn CD, Wilusz JE, Zheng Y, Beal PA, Joshua-Tor L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "25640237", "url": "https://glygen.org/publication/PubMed/25640237" } ] }, { "title": "Luzp4 defines a new mRNA export pathway in cancer cells.", "journal": "Nucleic acids research", "date": "2015", "authors": "Viphakone N, Cumberbatch MG, Livingstone MJ, Heath PR, Dickman MJ, Catto JW, Wilson SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-72187", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72187" } ], "reference": [ { "type": "PubMed", "id": "25662211", "url": "https://glygen.org/publication/PubMed/25662211" } ] }, { "title": "Nuclear export of messenger RNA.", "journal": "Genes", "date": "2015", "authors": "Katahira J", "evidence": [ { "database": "Reactome", "id": "R-HSA-72187", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72187" } ], "reference": [ { "type": "PubMed", "id": "25836925", "url": "https://glygen.org/publication/PubMed/25836925" } ] }, { "title": "Domain movements during CCA-addition: a new function for motif C in the catalytic core of the human tRNA nucleotidyltransferases.", "journal": "RNA biology", "date": "2015", "authors": "Ernst FG, Rickert C, Bluschke A, Betat H, Steinhoff HJ, Morl M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "25849199", "url": "https://glygen.org/publication/PubMed/25849199" } ] }, { "title": "A triarylphosphine-trimethylpiperidine reagent for the one-step derivatization and enrichment of protein post-translational modifications and identification by mass spectrometry.", "journal": "Chemical communications (Cambridge, England)", "date": "2018", "authors": "Huo B, Zhang W, Zhao X, Dong H, Yu Y, Wang J, Qian X, Qin W", "evidence": [ { "database": "O-GlcNAc Database", "id": "O95639", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95639" } ], "reference": [ { "type": "PubMed", "id": "30379171", "url": "https://glygen.org/publication/PubMed/30379171" } ] }, { "title": "Overproduced CPSF4 Promotes Cell Proliferation and Invasion via PI3K-AKT Signaling Pathway in Oral Squamous Cell Carcinoma.", "journal": "Journal of oral and maxillofacial surgery : official journal of the American Association of Oral and Maxillofacial Surgeons", "date": "2021", "authors": "Zhang M, Lin H, Ge X, Xu Y", "evidence": [ { "database": "RefSeq", "id": "NP_001075028", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001075028" } ], "reference": [ { "type": "PubMed", "id": "33535057", "url": "https://glygen.org/publication/PubMed/33535057" } ] }, { "title": "CPSF4 promotes triple negative breast cancer metastasis by upregulating MDM4.", "journal": "Signal transduction and targeted therapy", "date": "2021", "authors": "Lee K, Zheng Q, Lu Q, Xu F, Qin G, Zhai Q, Hong R, Chen M, Deng W, Wang S", "evidence": [ { "database": "RefSeq", "id": "NP_001075028", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001075028" } ], "reference": [ { "type": "PubMed", "id": "34006850", "url": "https://glygen.org/publication/PubMed/34006850" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "O95639", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95639" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "CPSF4 regulates circRNA formation and microRNA mediated gene silencing in hepatocellular carcinoma.", "journal": "Oncogene", "date": "2021", "authors": "Wang X, Dong J, Li X, Cheng Z, Zhu Q", "evidence": [ { "database": "RefSeq", "id": "NP_001075028", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001075028" } ], "reference": [ { "type": "PubMed", "id": "34103682", "url": "https://glygen.org/publication/PubMed/34103682" } ] }, { "title": "CPSF4 promotes tumor-initiating phenotype by enhancing VEGF/NRP2/TAZ signaling in lung cancer.", "journal": "Medical oncology (Northwood, London, England)", "date": "2022-12-26", "authors": "Song YingQiu, Sun Kai, Gong LiLan, Shi LinLi, Qin Tao, Wang ShuSen, Deng WuGuo, Chen WangBing, Zheng FeiMeng, Li GuiLing", "evidence": [ { "database": "RefSeq", "id": "NP_001075028", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001075028" } ], "reference": [ { "type": "PubMed", "id": "36567417", "url": "https://glygen.org/publication/PubMed/36567417" } ] }, { "title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.", "journal": "Journal of biomedical science", "date": "2023-05-22", "authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K", "evidence": [ { "database": "O-GlcNAc Database", "id": "O95639", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95639" } ], "reference": [ { "type": "PubMed", "id": "37217939", "url": "https://glygen.org/publication/PubMed/37217939" } ] }, { "title": "Cleavage and Polyadenylation-Specific Factor 4 (CPSF4) Expression Is Associated with Enhanced Prostate Cancer Cell Migration and Cell Cycle Dysregulation, In Vitro.", "journal": "International journal of molecular sciences", "date": "2023-08-19", "authors": "Choudhry Muhammad, Gamallat Yaser, Ghosh Sunita, Bismar Tarek A", "evidence": [ { "database": "RefSeq", "id": "NP_001075028", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001075028" } ], "reference": [ { "type": "PubMed", "id": "37629142", "url": "https://glygen.org/publication/PubMed/37629142" } ] }, { "title": "Specific RNA-cleaving activities from HeLa cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1980", "authors": "Ferrari S, Yehle CO, Robertson HD, Dickson E", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "6930639", "url": "https://glygen.org/publication/PubMed/6930639" } ] }, { "title": "Human mitochondrial tRNA processing.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Rossmanith W, Tullo A, Potuschak T, Karwan R, Sbisa E", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "7759547", "url": "https://glygen.org/publication/PubMed/7759547" } ] }, { "title": "Substrate recognition by human RNase P: identification of small, model substrates for the enzyme.", "journal": "The EMBO journal", "date": "1995", "authors": "Yuan Y, Altman S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "7828588", "url": "https://glygen.org/publication/PubMed/7828588" } ] }, { "title": "hnRNP proteins and the biogenesis of mRNA.", "journal": "Annual review of biochemistry", "date": "1993", "authors": "Dreyfuss G, Matunis MJ, Pinol-Roma S, Burd CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-72203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72203" } ], "reference": [ { "type": "PubMed", "id": "8352591", "url": "https://glygen.org/publication/PubMed/8352591" } ] }, { "title": "The 30-kD subunit of mammalian cleavage and polyadenylation specificity factor and its yeast homolog are RNA-binding zinc finger proteins.", "journal": "Genes & development", "date": "1997", "authors": "Barabino SM, Hubner W, Jenny A, Minvielle-Sebastia L, Keller W", "evidence": [ { "database": "UniProtKB", "id": "O95639", "url": "https://www.uniprot.org/uniprot/O95639" } ], "reference": [ { "type": "PubMed", "id": "9224719", "url": "https://glygen.org/publication/PubMed/9224719" } ] }, { "title": "Purification and cDNA cloning of the AdoMet-binding subunit of the human mRNA (N6-adenosine)-methyltransferase.", "journal": "RNA (New York, N.Y.)", "date": "1997", "authors": "Bokar JA, Shambaugh ME, Polayes D, Matera AG, Rottman FM", "evidence": [ { "database": "Reactome", "id": "R-HSA-72203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72203" } ], "reference": [ { "type": "PubMed", "id": "9409616", "url": "https://glygen.org/publication/PubMed/9409616" } ] }, { "title": "Identification of a nuclear export receptor for tRNA.", "journal": "Current biology : CB", "date": "1998", "authors": "Arts GJ, Fornerod M, Mattaj IW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "9512417", "url": "https://glygen.org/publication/PubMed/9512417" } ] }, { "title": "Influenza virus NS1 protein interacts with the cellular 30 kDa subunit of CPSF and inhibits 3'end formation of cellular pre-mRNAs.", "journal": "Mol. Cell", "date": "1998", "authors": "Nemeroff ME, Barabino SM, Li Y, Keller W, Krug RM", "evidence": [ { "database": "UniProtKB", "id": "O95639", "url": "https://www.uniprot.org/uniprot/O95639" }, { "database": "Reactome", "id": "R-HSA-168315", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168315" } ], "reference": [ { "type": "PubMed", "id": "9651582", "url": "https://glygen.org/publication/PubMed/9651582" } ] }, { "title": "Identification of a tRNA-specific nuclear export receptor.", "journal": "Molecular cell", "date": "1998", "authors": "Kutay U, Lipowsky G, Izaurralde E, Bischoff FR, Schwarzmaier P, Hartmann E, Gorlich D", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "9660920", "url": "https://glygen.org/publication/PubMed/9660920" } ] }, { "title": "Influenza virus inhibits cleavage of the HSP70 pre-mRNAs at the polyadenylation site.", "journal": "Virology", "date": "1999", "authors": "Shimizu K, Iguchi A, Gomyou R, Ono Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-168315", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168315" } ], "reference": [ { "type": "PubMed", "id": "9986787", "url": "https://glygen.org/publication/PubMed/9986787" } ] } ], "pathway": [ { "id": "hsa:10898", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10898", "resource": "KEGG Pathway" }, { "id": "R-HSA-159231", "name": "Transport of Mature mRNA Derived from an Intronless Transcript", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159231", "resource": "Reactome", "description": "Transport of Mature mRNA Derived from an Intronless Transcript" }, { "id": "R-HSA-168315", "name": "Inhibition of Host mRNA Processing and RNA Silencing", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168315", "resource": "Reactome", "description": "Inhibition of Host mRNA Processing and RNA Silencing" }, { "id": "R-HSA-6784531", "name": "tRNA processing in the nucleus", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531", "resource": "Reactome", "description": "tRNA processing in the nucleus" }, { "id": "R-HSA-72187", "name": "mRNA 3'-end processing", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72187", "resource": "Reactome", "description": "mRNA 3'-end processing" }, { "id": "R-HSA-72203", "name": "Processing of Capped Intron-Containing Pre-mRNA", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72203", "resource": "Reactome", "description": "Processing of Capped Intron-Containing Pre-mRNA" }, { "id": "R-HSA-73856", "name": "RNA Polymerase II Transcription Termination", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73856", "resource": "Reactome", "description": "RNA Polymerase II Transcription Termination" }, { "id": "R-HSA-77595", "name": "Processing of Intronless Pre-mRNAs", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-77595", "resource": "Reactome", "description": "Processing of Intronless Pre-mRNAs" } ], "orthologs": [ { "uniprot_canonical_ac": "Q5FVR7-1", "protein_name": "Cleavage and polyadenylation specificity factor subunit 4", "gene_name": "Cpsf4", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPTKRAPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFLSGQ", "length": 243 }, "evidence": [ { "id": "45916781", "url": "http://www.informatics.jax.org/homology/45916781", "database": "MGI" }, { "id": "O95639", "url": "https://omabrowser.org/oma/group/O95639/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q8BQZ5-1", "protein_name": "Cleavage and polyadenylation specificity factor subunit 4", "gene_name": "Cpsf4", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPTKRAPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFLSGQ", "length": 211 }, "evidence": [ { "id": "45916781", "url": "http://www.informatics.jax.org/homology/45916781", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9VPT8-1", "protein_name": "Cleavage and polyadenylation specificity factor subunit 4", "gene_name": "Clp", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MDILLANVSGLQFKAERDLIEQVGAIPLPFYGMDKSIAAVCNFITRNGQECDKGSACPFRHIRGDRTIVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSRFNACHNKECPFLHIDPQSKVKDCPWYKRGFCRHGPHCRHQHLRRVLCMDYLAGFCPEGPSCKHMHPHFELPPLAELGKDQLHKKLPTCHYCGELGHKANSCKQYVGSLEHRNNINAMDHSGGHSGGYSGHSGHIEGADDMQSNHHSQPHGPGFVKVPTPLEEITCYKCGNKGHYANKCPKGHLAFLSNQHSHK", "length": 296 }, "evidence": [ { "id": "O95639", "url": "https://omabrowser.org/oma/group/O95639/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "O95639", "url": "https://www.uniprot.org/uniprot/O95639" } ], "pmid": "" }, { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "O95639", "url": "https://www.uniprot.org/uniprot/O95639" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "O95639", "url": "https://www.uniprot.org/uniprot/O95639" } ], "pmid": "" }, { "name": "sequence-specific double-stranded DNA binding", "id": "GO:1990837", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990837", "evidence": [ { "database": "UniProtKB", "id": "O95639", "url": "https://www.uniprot.org/uniprot/O95639" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "mRNA cleavage and polyadenylation specificity factor complex", "id": "GO:0005847", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005847", "evidence": [ { "database": "UniProtKB", "id": "O95639", "url": "https://www.uniprot.org/uniprot/O95639" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "O95639", "url": "https://www.uniprot.org/uniprot/O95639" } ], "pmid": "" }, { "name": "intracellular membrane-bounded organelle", "id": "GO:0043231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "evidence": [ { "database": "UniProtKB", "id": "O95639", "url": "https://www.uniprot.org/uniprot/O95639" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "mRNA 3'-end processing", "id": "GO:0031124", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031124", "evidence": [ { "database": "UniProtKB", "id": "O95639", "url": "https://www.uniprot.org/uniprot/O95639" } ], "pmid": "" }, { "name": "mRNA processing", "id": "GO:0006397", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006397", "evidence": [ { "database": "UniProtKB", "id": "O95639", "url": "https://www.uniprot.org/uniprot/O95639" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 210, "end_pos": 212, "annotation": "n_glycosylation_sequon" }, { "start_pos": 229, "end_pos": 231, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [ 168 ], "glycation_sites": [], "phosphorylation_sites": [ 7, 200, 202, 212, 267 ], "sequon_annotation_sites": [ { "start_pos": 210, "end_pos": 212 }, { "start_pos": 229, "end_pos": 231 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 91 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }