{ "uniprot_canonical_ac": "O95630-1", "uniprot_ac": "O95630", "uniprot_id": "STABP_HUMAN", "mass": { "chemical_mass": 48077.0, "monoisotopic_mass": 48077.0 }, "refseq": { "ac": "NP_006454", "name": "STAM-binding protein isoform 1", "summary": "Cytokine-mediated signal transduction in the JAK-STAT cascade requires the involvement of adaptor molecules. One such signal-transducing adaptor molecule contains an SH3 domain that is required for induction of MYC and cell growth. The protein encoded by this gene binds to the SH3 domain of the signal-transducing adaptor molecule, and plays a critical role in cytokine-mediated signaling for MYC induction and cell cycle progression. Multiple alternatively spliced transcript variants encoding the same protein isoform have been found for this gene. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006454" }, "gene_names": [ { "name": "STAMBP", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O95630", "id": "O95630" }, { "name": "AMSH; MICCAP", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006454", "id": "NP_006454" }, { "name": "AMSH", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O95630", "id": "O95630" }, { "name": "STAMBP", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006454", "id": "NP_006454" } ], "protein_names": [ { "name": "STAM-binding protein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O95630" }, { "name": "3.4.19.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95630" }, { "name": "Associated molecule with the SH3 domain of STAM", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95630" }, { "name": "Endosome-associated ubiquitin isopeptidase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95630" }, { "name": "STAM-binding protein isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006454", "id": "NP_006454" }, { "name": "associated molecule with the SH3 domain of STAM; endosome-associated ubiquitin isopeptidase; testicular secretory protein Li 54", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006454", "id": "NP_006454" } ], "function": [ { "annotation": "Cytokine-mediated signal transduction in the JAK-STAT cascade requires the involvement of adaptor molecules. One such signal-transducing adaptor molecule contains an SH3 domain that is required for induction of MYC and cell growth. The protein encoded by this gene binds to the SH3 domain of the signal-transducing adaptor molecule, and plays a critical role in cytokine-mediated signaling for MYC induction and cell cycle progression. Multiple alternatively spliced transcript variants encoding the same protein isoform have been found for this gene. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_006454", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006454" } ] }, { "annotation": "STAM binding protein regulated by hsa_circ_0007334 exerts oncogenic potential in pancreatic cancer.", "evidence": [ { "database": "RefSeq", "id": "NP_006454", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006454" }, { "database": "PubMed", "id": "36089485", "url": "https://glygen.org/publication/PubMed/36089485" } ] }, { "annotation": "STAMBP promotes lung adenocarcinoma metastasis by regulating the EGFR/MAPK signaling pathway.", "evidence": [ { "database": "RefSeq", "id": "NP_006454", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006454" }, { "database": "PubMed", "id": "34102455", "url": "https://glygen.org/publication/PubMed/34102455" } ] }, { "annotation": "Structural and functional characterization of ubiquitin variant inhibitors for the JAMM-family deubiquitinases STAMBP and STAMBPL1.", "evidence": [ { "database": "RefSeq", "id": "NP_006454", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006454" }, { "database": "PubMed", "id": "34425109", "url": "https://glygen.org/publication/PubMed/34425109" } ] }, { "annotation": "The deubiquitinating enzyme STAMBP is a newly discovered driver of triple-negative breast cancer progression that maintains RAI14 protein stability.", "evidence": [ { "database": "RefSeq", "id": "NP_006454", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006454" }, { "database": "PubMed", "id": "36434041", "url": "https://glygen.org/publication/PubMed/36434041" } ] }, { "annotation": "The expression and clinical significance of STAMBP in breast cancer.", "evidence": [ { "database": "RefSeq", "id": "NP_006454", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006454" }, { "database": "PubMed", "id": "36309616", "url": "https://glygen.org/publication/PubMed/36309616" } ] }, { "annotation": "Zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains (PubMed:15314065, PubMed:23542699, PubMed:34425109). Does not cleave 'Lys-48'-linked polyubiquitin chains (PubMed:15314065). Plays a role in signal transduction for cell growth and MYC induction mediated by IL-2 and GM-CSF (PubMed:10383417). Potentiates BMP (bone morphogenetic protein) signaling by antagonizing the inhibitory action of SMAD6 and SMAD7 (PubMed:11483516). Has a key role in regulation of cell surface receptor-mediated endocytosis and ubiquitin-dependent sorting of receptors to lysosomes (PubMed:15314065, PubMed:17261583). Endosomal localization of STAMBP is required for efficient EGFR degradation but not for its internalization (PubMed:15314065, PubMed:17261583). Involved in the negative regulation of PI3K-AKT-mTOR and RAS-MAP signaling pathways (PubMed:23542699).", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630#function" }, { "database": "PubMed", "id": "15314065", "url": "https://glygen.org/publication/PubMed/15314065" }, { "database": "PubMed", "id": "23542699", "url": "https://glygen.org/publication/PubMed/23542699" }, { "database": "PubMed", "id": "11483516", "url": "https://glygen.org/publication/PubMed/11483516" }, { "database": "PubMed", "id": "10383417", "url": "https://glygen.org/publication/PubMed/10383417" }, { "database": "PubMed", "id": "17261583", "url": "https://glygen.org/publication/PubMed/17261583" }, { "database": "PubMed", "id": "34425109", "url": "https://glygen.org/publication/PubMed/34425109" } ] } ], "disease": [ { "disease_id": "MONDO:0013659", "recommended_name": { "id": "MONDO:0013659", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013659", "name": "microcephaly-capillary malformation syndrome", "description": "" }, "synonyms": [ { "id": "MONDO:0013659", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013659", "name": "MIC-CAP syndrome", "description": "" }, { "id": "MONDO:0013659", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013659", "name": "MIC-CM syndrome", "description": "" }, { "id": "MONDO:0013659", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013659", "name": "microcephaly-capillary malformation syndrome", "description": "" }, { "id": "MONDO:0013659", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013659", "name": "microcephaly-cutaneous capillary malformation syndrome", "description": "" }, { "id": "MONDO:0013659", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013659", "name": "MICCAP", "description": "" }, { "id": "MIM:614261", "resource": "MIM", "url": "https://www.omim.org/entry/614261", "name": "Microcephaly-capillary malformation syndrome", "description": "Microcephaly-capillary malformation syndrome" } ], "evidence": [ { "id": "614261", "database": "MIM", "url": "https://www.omim.org/entry/614261" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 348, "end_pos": 348, "sequence_org": "D", "sequence_mut": "A", "comment": "Promotes accumulation of ubiquitin on endosomes, ablates enzymatic activity toward polyubiquitin substrate and allows ubiquitinated STAM stabilization.", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" }, { "database": "PubMed", "id": "15314065", "url": "https://glygen.org/publication/PubMed/15314065" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "86.27", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000124356", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000124356" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "82.33", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000124356", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000124356" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "91.64", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000124356", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000124356" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "86.76", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000124356", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000124356" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "91.36", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000124356", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000124356" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "94.47", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000124356", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000124356" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "87.98", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000124356", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000124356" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "88.29", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000124356", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000124356" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "88.16", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000124356", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000124356" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "82.35", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000124356", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000124356" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "86.96", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000124356", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000124356" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "92.02", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000124356", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000124356" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "90.8", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000124356", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000124356" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O95630", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95630" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O95630", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95630" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O95630", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95630" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O95630", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95630" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O95630", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95630" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O95630", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95630" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O95630", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95630" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O95630", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95630" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O95630", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95630" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O95630", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95630" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O95630", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95630" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O95630", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95630" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" } ], "common_name": "Human" } ], "gene": [ { "name": "STAMBP", "url": "https://www.uniprot.org/uniprot/O95630", "locus": { "chromosome": "2", "start_pos": 73873659, "end_pos": 73828916, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000124356", "url": "https://www.ensembl.org/id/ENSG00000124356" } ] } } ], "crossref": [ { "id": "ENSG00000124356", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000124356", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd08066", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd08066", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL4105848", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4105848", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "STAMBP", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=STAMBP", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "10617", "url": "https://www.ncbi.nlm.nih.gov/gene/10617", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "16950", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=16950", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O95630", "url": "https://www.ebi.ac.uk/intact/interactors/id:O95630*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000555", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000555", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015063", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015063", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037518", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037518", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044098", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044098", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:10617", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10617", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "606247", "url": "http://www.omim.org/entry/606247", "database": "MIM", "categories": [ "Other" ] }, { "id": "614261", "url": "http://www.omim.org/entry/614261", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O95630", "url": "https://www.nextprot.org/entry/NX_O95630", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O95630", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95630", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "MKFMTLF", "url": "https://omabrowser.org/oma/group/MKFMTLF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5490729at2759", "url": "http://www.orthodb.org/?query=5490729at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12947", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12947", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12947:SF8", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12947:SF8", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2XZE", "url": "https://www.rcsb.org/structure/2XZE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3RZU", "url": "https://www.rcsb.org/structure/3RZU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3RZV", "url": "https://www.rcsb.org/structure/3RZV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5IXF", "url": "https://www.rcsb.org/structure/5IXF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF01398", "url": "http://pfam.xfam.org/family/PF01398", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF08969", "url": "http://pfam.xfam.org/family/PF08969", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O95630", "url": "https://pharos.nih.gov/targets/O95630", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O95630", "url": "http://purl.obolibrary.org/obo/PR_O95630", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-5689901", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689901", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_006454", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006454", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A804HHU9", "url": "https://www.uniprot.org/uniprot/A0A804HHU9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A804HHU9-1", "url": "https://www.uniprot.org/uniprot/A0A804HHU9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A804HHV2", "url": "https://www.uniprot.org/uniprot/A0A804HHV2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A804HHV2-1", "url": "https://www.uniprot.org/uniprot/A0A804HHV2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A804HI64", "url": "https://www.uniprot.org/uniprot/A0A804HI64", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A804HI64-1", "url": "https://www.uniprot.org/uniprot/A0A804HI64-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A804HIF8", "url": "https://www.uniprot.org/uniprot/A0A804HIF8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A804HIF8-1", "url": "https://www.uniprot.org/uniprot/A0A804HIF8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A804HII8", "url": "https://www.uniprot.org/uniprot/A0A804HII8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A804HII8-1", "url": "https://www.uniprot.org/uniprot/A0A804HII8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A804HIJ2", "url": "https://www.uniprot.org/uniprot/A0A804HIJ2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A804HIJ2-1", "url": "https://www.uniprot.org/uniprot/A0A804HIJ2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A804HIV0", "url": "https://www.uniprot.org/uniprot/A0A804HIV0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A804HIV0-1", "url": "https://www.uniprot.org/uniprot/A0A804HIV0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A804HJ64", "url": "https://www.uniprot.org/uniprot/A0A804HJ64", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A804HJ64-1", "url": "https://www.uniprot.org/uniprot/A0A804HJ64-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A804HJC8", "url": "https://www.uniprot.org/uniprot/A0A804HJC8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A804HJC8-1", "url": "https://www.uniprot.org/uniprot/A0A804HJC8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A804HJD9", "url": "https://www.uniprot.org/uniprot/A0A804HJD9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A804HJD9-1", "url": "https://www.uniprot.org/uniprot/A0A804HJD9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A804HJE8", "url": "https://www.uniprot.org/uniprot/A0A804HJE8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A804HJE8-1", "url": "https://www.uniprot.org/uniprot/A0A804HJE8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A804HJS0", "url": "https://www.uniprot.org/uniprot/A0A804HJS0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A804HJS0-1", "url": "https://www.uniprot.org/uniprot/A0A804HJS0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A804HKA6", "url": "https://www.uniprot.org/uniprot/A0A804HKA6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A804HKA6-1", "url": "https://www.uniprot.org/uniprot/A0A804HKA6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A804HKL2", "url": "https://www.uniprot.org/uniprot/A0A804HKL2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A804HKL2-1", "url": "https://www.uniprot.org/uniprot/A0A804HKL2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A804HL27", "url": "https://www.uniprot.org/uniprot/A0A804HL27", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A804HL27-1", "url": "https://www.uniprot.org/uniprot/A0A804HL27-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A804HL38", "url": "https://www.uniprot.org/uniprot/A0A804HL38", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A804HL38-1", "url": "https://www.uniprot.org/uniprot/A0A804HL38-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JEK5", "url": "https://www.uniprot.org/uniprot/C9JEK5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JEK5-1", "url": "https://www.uniprot.org/uniprot/C9JEK5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JK83", "url": "https://www.uniprot.org/uniprot/C9JK83", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JK83-1", "url": "https://www.uniprot.org/uniprot/C9JK83-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H5B9", "url": "https://www.uniprot.org/uniprot/F5H5B9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H5B9-1", "url": "https://www.uniprot.org/uniprot/F5H5B9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95630-1", "url": "https://www.uniprot.org/uniprot/O95630-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95630-2", "url": "https://www.uniprot.org/uniprot/O95630-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTITDLR", "length": 424, "header": "sp|O95630-1|STABP_HUMAN Isoform 1 of STAM-binding protein OS=Homo sapiens OX=9606 GN=STAMBP PE=1 SV=1 CANONICAL=O95630-1" }, "isoforms": [ { "isoform_ac": "A0A804HHU9-1", "url": "", "sequence": { "sequence": "MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTITDLR", "length": 421, "header": "tr|A0A804HHU9-1|STABP_HUMAN Computationally mapped isoform of STAM-binding protein OS=Homo sapiens OX=9606 GN=STAMBP PE=1 SV=1 CANONICAL=O95630-1" }, "locus": { "chromosome": "2", "start_pos": 73862256, "end_pos": 73830857, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000683391.1", "url": "https://www.ensembl.org/id/ENST00000683391.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000506772.1", "url": "https://www.ensembl.org/id/ENSP00000506772.1" } ] } }, { "isoform_ac": "A0A804HHV2-1", "url": "", "sequence": { "sequence": "MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTITDLR", "length": 394, "header": "tr|A0A804HHV2-1|A0A804HHV2_HUMAN Computationally mapped isoform of STAM binding protein OS=Homo sapiens OX=9606 GN=STAMBP PE=1 SV=1 CANONICAL=O95630-1" }, "locus": { "chromosome": "2", "start_pos": 73862256, "end_pos": 73830857, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000682352.1", "url": "https://www.ensembl.org/id/ENST00000682352.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000508197.1", "url": "https://www.ensembl.org/id/ENSP00000508197.1" } ] } }, { "isoform_ac": "A0A804HI64-1", "url": "", "sequence": { "sequence": "MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHNWIL", "length": 339, "header": "tr|A0A804HI64-1|A0A804HI64_HUMAN Computationally mapped isoform of STAM binding protein OS=Homo sapiens OX=9606 GN=STAMBP PE=1 SV=1 CANONICAL=O95630-1" }, "locus": { "chromosome": "2", "start_pos": 73860063, "end_pos": 73830857, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000683530.1", "url": "https://www.ensembl.org/id/ENST00000683530.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000506920.1", "url": "https://www.ensembl.org/id/ENSP00000506920.1" } ] } }, { "isoform_ac": "A0A804HIF8-1", "url": "", "sequence": { "sequence": "MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHA", "length": 336, "header": "tr|A0A804HIF8-1|A0A804HIF8_HUMAN Computationally mapped isoform of STAM binding protein OS=Homo sapiens OX=9606 GN=STAMBP PE=1 SV=1 CANONICAL=O95630-1" }, "locus": { "chromosome": "2", "start_pos": 73853037, "end_pos": 73830857, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000682998.1", "url": "https://www.ensembl.org/id/ENST00000682998.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000507046.1", "url": "https://www.ensembl.org/id/ENSP00000507046.1" } ] } }, { "isoform_ac": "A0A804HII8-1", "url": "", "sequence": { "sequence": "MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCPVLQ", "length": 410, "header": "tr|A0A804HII8-1|A0A804HII8_HUMAN Computationally mapped isoform of STAM binding protein OS=Homo sapiens OX=9606 GN=STAMBP PE=1 SV=1 CANONICAL=O95630-1" }, "locus": { "chromosome": "2", "start_pos": 73860545, "end_pos": 73830857, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000682423.1", "url": "https://www.ensembl.org/id/ENST00000682423.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000507643.1", "url": "https://www.ensembl.org/id/ENSP00000507643.1" } ] } }, { "isoform_ac": "A0A804HIJ2-1", "url": "", "sequence": { "sequence": "MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTITDLR", "length": 421, "header": "tr|A0A804HIJ2-1|A0A804HIJ2_HUMAN Computationally mapped isoform of STAM binding protein OS=Homo sapiens OX=9606 GN=STAMBP PE=1 SV=1 CANONICAL=O95630-1" }, "locus": { "chromosome": "2", "start_pos": 73862256, "end_pos": 73830857, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000683902.1", "url": "https://www.ensembl.org/id/ENST00000683902.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000507096.1", "url": "https://www.ensembl.org/id/ENSP00000507096.1" } ] } }, { "isoform_ac": "A0A804HIV0-1", "url": "", "sequence": { "sequence": "MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLVKRKKKPNSSLNRNCFFPSWHPVTLRENIQDEE", "length": 322, "header": "tr|A0A804HIV0-1|A0A804HIV0_HUMAN Computationally mapped isoform of STAM binding protein OS=Homo sapiens OX=9606 GN=STAMBP PE=1 SV=1 CANONICAL=O95630-1" }, "locus": { "chromosome": "2", "start_pos": 73850383, "end_pos": 73830857, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000683247.1", "url": "https://www.ensembl.org/id/ENST00000683247.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000507237.1", "url": "https://www.ensembl.org/id/ENSP00000507237.1" } ] } }, { "isoform_ac": "A0A804HJ64-1", "url": "", "sequence": { "sequence": "MAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTITDLR", "length": 289, "header": "tr|A0A804HJ64-1|A0A804HJ64_HUMAN Computationally mapped isoform of STAM binding protein OS=Homo sapiens OX=9606 GN=STAMBP PE=1 SV=1 CANONICAL=O95630-1" }, "locus": { "chromosome": "2", "start_pos": 73862256, "end_pos": 73847417, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000682851.1", "url": "https://www.ensembl.org/id/ENST00000682851.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000507371.1", "url": "https://www.ensembl.org/id/ENSP00000507371.1" } ] } }, { "isoform_ac": "A0A804HJC8-1", "url": "", "sequence": { "sequence": "MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESMVADYSPFSFTVPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTITDLR", "length": 435, "header": "tr|A0A804HJC8-1|A0A804HJC8_HUMAN Computationally mapped isoform of STAM binding protein OS=Homo sapiens OX=9606 GN=STAMBP PE=1 SV=1 CANONICAL=O95630-1" }, "locus": { "chromosome": "2", "start_pos": 73862256, "end_pos": 73830857, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000683877.1", "url": "https://www.ensembl.org/id/ENST00000683877.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000507446.1", "url": "https://www.ensembl.org/id/ENSP00000507446.1" } ] } }, { "isoform_ac": "A0A804HJD9-1", "url": "", "sequence": { "sequence": "MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKVGLHFHCCPSKSFRAAQTDFKIKVVVSASEYQILQ", "length": 128, "header": "tr|A0A804HJD9-1|A0A804HJD9_HUMAN Computationally mapped isoform of STAM binding protein OS=Homo sapiens OX=9606 GN=STAMBP PE=1 SV=1 CANONICAL=O95630-1" }, "locus": { "chromosome": "2", "start_pos": 73844993, "end_pos": 73830857, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000684703.1", "url": "https://www.ensembl.org/id/ENST00000684703.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000507569.1", "url": "https://www.ensembl.org/id/ENSP00000507569.1" } ] } }, { "isoform_ac": "A0A804HJE8-1", "url": "", "sequence": { "sequence": "MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITDRISLCHPGWSAVV", "length": 82, "header": "tr|A0A804HJE8-1|A0A804HJE8_HUMAN Computationally mapped isoform of STAM binding protein OS=Homo sapiens OX=9606 GN=STAMBP PE=1 SV=1 CANONICAL=O95630-1" }, "locus": { "chromosome": "2", "start_pos": 73843259, "end_pos": 73830857, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000684200.1", "url": "https://www.ensembl.org/id/ENST00000684200.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000507468.1", "url": "https://www.ensembl.org/id/ENSP00000507468.1" } ] } }, { "isoform_ac": "A0A804HJS0-1", "url": "", "sequence": { "sequence": "MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTITDLR", "length": 423, "header": "tr|A0A804HJS0-1|A0A804HJS0_HUMAN Computationally mapped isoform of STAM binding protein OS=Homo sapiens OX=9606 GN=STAMBP PE=1 SV=1 CANONICAL=O95630-1" }, "locus": { "chromosome": "2", "start_pos": 73862256, "end_pos": 73830857, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000683434.1", "url": "https://www.ensembl.org/id/ENST00000683434.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000507622.1", "url": "https://www.ensembl.org/id/ENSP00000507622.1" } ] } }, { "isoform_ac": "A0A804HKA6-1", "url": "", "sequence": { "sequence": "MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCPRDCCGQSSDHHRPSMSV", "length": 424, "header": "tr|A0A804HKA6-1|A0A804HKA6_HUMAN Computationally mapped isoform of STAM binding protein OS=Homo sapiens OX=9606 GN=STAMBP PE=1 SV=1 CANONICAL=O95630-1" }, "locus": { "chromosome": "2", "start_pos": 73862264, "end_pos": 73830857, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000682157.1", "url": "https://www.ensembl.org/id/ENST00000682157.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000507848.1", "url": "https://www.ensembl.org/id/ENSP00000507848.1" } ] } }, { "isoform_ac": "A0A804HKL2-1", "url": "", "sequence": { "sequence": "MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTITDLR", "length": 214, "header": "tr|A0A804HKL2-1|A0A804HKL2_HUMAN Computationally mapped isoform of STAM binding protein OS=Homo sapiens OX=9606 GN=STAMBP PE=1 SV=1 CANONICAL=O95630-1" }, "locus": { "chromosome": "2", "start_pos": 73862256, "end_pos": 73830857, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000684355.1", "url": "https://www.ensembl.org/id/ENST00000684355.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000507974.1", "url": "https://www.ensembl.org/id/ENSP00000507974.1" } ] } }, { "isoform_ac": "A0A804HL27-1", "url": "", "sequence": { "sequence": "MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCKPKLHCPFNVGIQPDPILGQHQ", "length": 428, "header": "tr|A0A804HL27-1|A0A804HL27_HUMAN Computationally mapped isoform of STAM binding protein OS=Homo sapiens OX=9606 GN=STAMBP PE=1 SV=1 CANONICAL=O95630-1" }, "locus": { "chromosome": "2", "start_pos": 73870208, "end_pos": 73830857, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000683852.1", "url": "https://www.ensembl.org/id/ENST00000683852.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000507717.1", "url": "https://www.ensembl.org/id/ENSP00000507717.1" } ] } }, { "isoform_ac": "A0A804HL38-1", "url": "", "sequence": { "sequence": "MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKFPQSMDCAMWWCLGGCAHSFSS", "length": 209, "header": "tr|A0A804HL38-1|A0A804HL38_HUMAN Computationally mapped isoform of STAM binding protein OS=Homo sapiens OX=9606 GN=STAMBP PE=1 SV=1 CANONICAL=O95630-1" }, "locus": { "chromosome": "2", "start_pos": 73849428, "end_pos": 73830857, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000683149.1", "url": "https://www.ensembl.org/id/ENST00000683149.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000507540.1", "url": "https://www.ensembl.org/id/ENSP00000507540.1" } ] } }, { "isoform_ac": "C9JEK5-1", "url": "", "sequence": { "sequence": "MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKPSDCHTTVRPAKPPVVDRSLKPGALSNSES", "length": 214, "header": "tr|C9JEK5-1|C9JEK5_HUMAN Computationally mapped isoform of STAM binding protein OS=Homo sapiens OX=9606 GN=STAMBP PE=1 SV=2 CANONICAL=O95630-1" }, "locus": { "chromosome": "2", "start_pos": 73847752, "end_pos": 73830857, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000424659.6", "url": "https://www.ensembl.org/id/ENST00000424659.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000390921.2", "url": "https://www.ensembl.org/id/ENSP00000390921.2" } ] } }, { "isoform_ac": "C9JK83-1", "url": "", "sequence": { "sequence": "MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEE", "length": 318, "header": "tr|C9JK83-1|C9JK83_HUMAN Computationally mapped isoform of STAM-binding protein OS=Homo sapiens OX=9606 GN=STAMBP PE=1 SV=1 CANONICAL=O95630-1" }, "locus": { "chromosome": "2", "start_pos": 73855660, "end_pos": 73830857, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000432295", "url": "https://www.ensembl.org/id/ENST00000432295" }, { "database": "Ensembl Peptide", "id": "ENSP00000413874", "url": "https://www.ensembl.org/id/ENSP00000413874" } ] } }, { "isoform_ac": "F5H5B9-1", "url": "", "sequence": { "sequence": "MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCPVLQ", "length": 380, "header": "tr|F5H5B9-1|F5H5B9_HUMAN Computationally mapped isoform of STAM binding protein OS=Homo sapiens OX=9606 GN=STAMBP PE=1 SV=2 CANONICAL=O95630-1" }, "locus": { "chromosome": "2", "start_pos": 73860545, "end_pos": 73830857, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000536064.2", "url": "https://www.ensembl.org/id/ENST00000536064.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000443502.2", "url": "https://www.ensembl.org/id/ENSP00000443502.2" } ] } }, { "isoform_ac": "O95630-1", "url": "", "sequence": { "sequence": "MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTITDLR", "length": 424, "header": "sp|O95630-1|STABP_HUMAN Isoform 1 of STAM-binding protein OS=Homo sapiens OX=9606 GN=STAMBP PE=1 SV=1 CANONICAL=O95630-1" }, "locus": { "chromosome": "2", "start_pos": 73862256, "end_pos": 73830857, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000683818.1", "url": "https://www.ensembl.org/id/ENST00000683818.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000507658.1", "url": "https://www.ensembl.org/id/ENSP00000507658.1" } ] } }, { "isoform_ac": "O95630-2", "url": "", "sequence": { "sequence": "MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHVETLWSLKSLHAP", "length": 348, "header": "sp|O95630-2|STABP_HUMAN Isoform 2 of STAM-binding protein OS=Homo sapiens OX=9606 GN=STAMBP PE=1 SV=1 CANONICAL=O95630-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O95630", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95630" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" } ] } ], "phosphorylation": [ { "start_pos": 243, "end_pos": 243, "kinase_uniprot_canonical_ac": "O00238-1", "kinase_gene_name": "BMPR1B", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95630", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95630" }, { "database": "PubMed", "id": "11483516", "url": "https://glygen.org/publication/PubMed/11483516" } ], "site_lbl": "Ser243" }, { "start_pos": 243, "end_pos": 243, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" }, { "database": "PubMed", "id": "11483516", "url": "https://glygen.org/publication/PubMed/11483516" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "phospho.ELM", "id": "O95630", "url": "http://phospho.elm.eu.org/byAccession/O95630.html" }, { "database": "iPTMnet", "id": "O95630", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95630" } ], "site_lbl": "Ser243" }, { "start_pos": 245, "end_pos": 245, "kinase_uniprot_canonical_ac": "O00238-1", "kinase_gene_name": "BMPR1B", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95630", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95630" }, { "database": "PubMed", "id": "11483516", "url": "https://glygen.org/publication/PubMed/11483516" } ], "site_lbl": "Ser245" }, { "start_pos": 245, "end_pos": 245, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" }, { "database": "PubMed", "id": "11483516", "url": "https://glygen.org/publication/PubMed/11483516" }, { "database": "phospho.ELM", "id": "O95630", "url": "http://phospho.elm.eu.org/byAccession/O95630.html" }, { "database": "iPTMnet", "id": "O95630", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95630" } ], "site_lbl": "Ser245" }, { "start_pos": 247, "end_pos": 247, "kinase_uniprot_canonical_ac": "O00238-1", "kinase_gene_name": "BMPR1B", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95630", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95630" }, { "database": "PubMed", "id": "11483516", "url": "https://glygen.org/publication/PubMed/11483516" } ], "site_lbl": "Ser247" }, { "start_pos": 247, "end_pos": 247, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" }, { "database": "PubMed", "id": "11483516", "url": "https://glygen.org/publication/PubMed/11483516" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "phospho.ELM", "id": "O95630", "url": "http://phospho.elm.eu.org/byAccession/O95630.html" }, { "database": "iPTMnet", "id": "O95630", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95630" } ], "site_lbl": "Ser247" }, { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "O00238-1", "kinase_gene_name": "BMPR1B", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95630", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95630" }, { "database": "PubMed", "id": "11483516", "url": "https://glygen.org/publication/PubMed/11483516" } ], "site_lbl": "Ser2" }, { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" }, { "database": "PubMed", "id": "11483516", "url": "https://glygen.org/publication/PubMed/11483516" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "phospho.ELM", "id": "O95630", "url": "http://phospho.elm.eu.org/byAccession/O95630.html" }, { "database": "iPTMnet", "id": "O95630", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95630" } ], "site_lbl": "Ser2" }, { "start_pos": 48, "end_pos": 48, "kinase_uniprot_canonical_ac": "O00238-1", "kinase_gene_name": "BMPR1B", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95630", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95630" }, { "database": "PubMed", "id": "11483516", "url": "https://glygen.org/publication/PubMed/11483516" } ], "site_lbl": "Ser48" }, { "start_pos": 48, "end_pos": 48, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" }, { "database": "PubMed", "id": "11483516", "url": "https://glygen.org/publication/PubMed/11483516" }, { "database": "phospho.ELM", "id": "O95630", "url": "http://phospho.elm.eu.org/byAccession/O95630.html" }, { "database": "iPTMnet", "id": "O95630", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95630" } ], "site_lbl": "Ser48" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Possible involvement of a novel STAM-associated molecule `AMSH` in intracellular signal transduction mediated by cytokines.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Tanaka N, Kaneko K, Asao H, Kasai H, Endo Y, Fujita T, Takeshita T, Sugamura K", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" }, { "database": "Reactome", "id": "R-HSA-5689901", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689901" } ], "reference": [ { "type": "PubMed", "id": "10383417", "url": "https://glygen.org/publication/PubMed/10383417" } ] }, { "title": "Promoting bone morphogenetic protein signaling through negative regulation of inhibitory Smads.", "journal": "The EMBO journal", "date": "2001", "authors": "Itoh F, Asao H, Sugamura K, Heldin CH, ten Dijke P, Itoh S", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" }, { "database": "iPTMnet", "id": "O95630-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95630-1" } ], "reference": [ { "type": "PubMed", "id": "11483516", "url": "https://glygen.org/publication/PubMed/11483516" } ] }, { "title": "A cryptic protease couples deubiquitination and degradation by the proteasome.", "journal": "Nature", "date": "2002", "authors": "Yao T, Cohen RE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689901", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689901" } ], "reference": [ { "type": "PubMed", "id": "12353037", "url": "https://glygen.org/publication/PubMed/12353037" } ] }, { "title": "MPN+, a putative catalytic motif found in a subset of MPN domain proteins from eukaryotes and prokaryotes, is critical for Rpn11 function.", "journal": "BMC Biochem.", "date": "2002", "authors": "Maytal-Kivity Vered, Reis Noa, Hofmann Kay, Glickman Michael H", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" } ], "reference": [ { "type": "PubMed", "id": "12370088", "url": "https://glygen.org/publication/PubMed/12370088" } ] }, { "title": "An RNF11: Smurf2 complex mediates ubiquitination of the AMSH protein.", "journal": "Oncogene", "date": "2004", "authors": "Li H, Seth A", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" } ], "reference": [ { "type": "PubMed", "id": "14755250", "url": "https://glygen.org/publication/PubMed/14755250" } ] }, { "title": "AMSH is an endosome-associated ubiquitin isopeptidase.", "journal": "The Journal of cell biology", "date": "2004", "authors": "McCullough J, Clague MJ, Urbe S", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" } ], "reference": [ { "type": "PubMed", "id": "15314065", "url": "https://glygen.org/publication/PubMed/15314065" } ] }, { "title": "Release of autoinhibition converts ESCRT-III components into potent inhibitors of HIV-1 budding.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2006", "authors": "Zamborlini A, Usami Y, Radoshitzky SR, Popova E, Palu G, Gottlinger H", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" } ], "reference": [ { "type": "PubMed", "id": "17146056", "url": "https://glygen.org/publication/PubMed/17146056" } ] }, { "title": "Targeting of AMSH to endosomes is required for epidermal growth factor receptor degradation.", "journal": "The Journal of biological chemistry", "date": "2007-03-30", "authors": "Ma Yu May, Boucrot Emmanuel, Vill\u00e9n Judit, Affar El Bachir, Gygi Steven P, G\u00f6ttlinger Heinrich G, Kirchhausen Tomas", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" } ], "reference": [ { "type": "PubMed", "id": "17261583", "url": "https://glygen.org/publication/PubMed/17261583" } ] }, { "title": "A histone H2A deubiquitinase complex coordinating histone acetylation and H1 dissociation in transcriptional regulation.", "journal": "Molecular cell", "date": "2007", "authors": "Zhu P, Zhou W, Wang J, Puc J, Ohgi KA, Erdjument-Bromage H, Tempst P, Glass CK, Rosenfeld MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689901", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689901" } ], "reference": [ { "type": "PubMed", "id": "17707232", "url": "https://glygen.org/publication/PubMed/17707232" } ] }, { "title": "Structural basis for specific cleavage of Lys 63-linked polyubiquitin chains.", "journal": "Nature", "date": "2008", "authors": "Sato Y, Yoshikawa A, Yamagata A, Mimura H, Yamashita M, Ookata K, Nureki O, Iwai K, Komada M, Fukai S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689901", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689901" } ], "reference": [ { "type": "PubMed", "id": "18758443", "url": "https://glygen.org/publication/PubMed/18758443" } ] }, { "title": "The Rap80-BRCC36 de-ubiquitinating enzyme complex antagonizes RNF8-Ubc13-dependent ubiquitination events at DNA double strand breaks.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Shao G, Lilli DR, Patterson-Fortin J, Coleman KA, Morrissey DE, Greenberg RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689901", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689901" } ], "reference": [ { "type": "PubMed", "id": "19202061", "url": "https://glygen.org/publication/PubMed/19202061" } ] }, { "title": "Discovery of novel human transcript variants by analysis of intronic single-block EST with polyadenylation site.", "journal": "BMC Genomics", "date": "2009", "authors": "Wang Pingzhang, Yu Peng, Gao Peng, Shi Taiping, Ma Dalong", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" } ], "reference": [ { "type": "PubMed", "id": "19906316", "url": "https://glygen.org/publication/PubMed/19906316" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" }, { "database": "iPTMnet", "id": "O95630", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95630" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Deubiquitination of NLRP3 by BRCC3 critically regulates inflammasome activity.", "journal": "Molecular cell", "date": "2013", "authors": "Py BF, Kim MS, Vakifahmetoglu-Norberg H, Yuan J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689901", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689901" } ], "reference": [ { "type": "PubMed", "id": "23246432", "url": "https://glygen.org/publication/PubMed/23246432" } ] }, { "title": "Proteome wide purification and identification of O-GlcNAc-modified proteins using click chemistry and mass spectrometry.", "journal": "Journal of proteome research", "date": "2013", "authors": "Hahne H, Sobotzki N, Nyberg T, Helm D, Borodkin VS, van Aalten DM, Agnew B, Kuster B", "evidence": [ { "database": "O-GlcNAc Database", "id": "O95630", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95630" } ], "reference": [ { "type": "PubMed", "id": "23301498", "url": "https://glygen.org/publication/PubMed/23301498" } ] }, { "title": "Mutations in STAMBP, encoding a deubiquitinating enzyme, cause microcephaly-capillary malformation syndrome.", "journal": "Nature genetics", "date": "2013", "authors": "McDonell LM, Mirzaa GM, Alcantara D, Schwartzentruber J, Carter MT, Lee LJ, Clericuzio CL, Graham JM Jr, Morris-Rosendahl DJ, Polster T, Acsadi G, Townshend S, Williams S, Halbert A, Isidor B, David A, Smyser CD, Paciorkowski AR, Willing M, Woulfe J, Das S, Beaulieu CL, Marcadier J, Geraghty MT, Frey BJ, Majewski J, Bulman DE, Dobyns WB, O'Driscoll M, Boycott KM", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" } ], "reference": [ { "type": "PubMed", "id": "23542699", "url": "https://glygen.org/publication/PubMed/23542699" } ] }, { "title": "STAMBP promotes lung adenocarcinoma metastasis by regulating the EGFR/MAPK signaling pathway.", "journal": "Neoplasia (New York, N.Y.)", "date": "2021", "authors": "Xu H, Yang X, Xuan X, Wu D, Zhang J, Xu X, Zhao Y, Ma C, Li D", "evidence": [ { "database": "RefSeq", "id": "NP_006454", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006454" } ], "reference": [ { "type": "PubMed", "id": "34102455", "url": "https://glygen.org/publication/PubMed/34102455" } ] }, { "title": "Structural and functional characterization of ubiquitin variant inhibitors for the JAMM-family deubiquitinases STAMBP and STAMBPL1.", "journal": "The Journal of biological chemistry", "date": "2021", "authors": "Guo Y, Liu Q, Mallette E, Caba C, Hou F, Fux J, LaPlante G, Dong A, Zhang Q, Zheng H, Tong Y, Zhang W", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" }, { "database": "RefSeq", "id": "NP_006454", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006454" } ], "reference": [ { "type": "PubMed", "id": "34425109", "url": "https://glygen.org/publication/PubMed/34425109" } ] }, { "title": "STAM binding protein regulated by hsa_circ_0007334 exerts oncogenic potential in pancreatic cancer.", "journal": "Pancreatology : official journal of the International Association of Pancreatology (IAP) ... [et al.]", "date": "2022-11", "authors": "Yu Shan, E Changyong, Yang Jinghui", "evidence": [ { "database": "RefSeq", "id": "NP_006454", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006454" } ], "reference": [ { "type": "PubMed", "id": "36089485", "url": "https://glygen.org/publication/PubMed/36089485" } ] }, { "title": "The expression and clinical significance of STAMBP in breast cancer.", "journal": "Molecular biology reports", "date": "2022-10-29", "authors": "Li Lei, Yang Xiaomei, He Mengfan, Xu Xinchun, Xuan Xiaofeng, Zhang Jieru, Zhang Ling, Xu Hui, Li Dawei", "evidence": [ { "database": "RefSeq", "id": "NP_006454", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006454" } ], "reference": [ { "type": "PubMed", "id": "36309616", "url": "https://glygen.org/publication/PubMed/36309616" } ] }, { "title": "The deubiquitinating enzyme STAMBP is a newly discovered driver of triple-negative breast cancer progression that maintains RAI14 protein stability.", "journal": "Experimental & molecular medicine", "date": "2022-11", "authors": "Yang Qianqian, Yan Ding, Zou Chaoying, Xue Qian, Lin Shuhui, Huang Qingtian, Li Xiaofen, Tang Daolin, Chen Xin, Liu Jinbao", "evidence": [ { "database": "RefSeq", "id": "NP_006454", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006454" } ], "reference": [ { "type": "PubMed", "id": "36434041", "url": "https://glygen.org/publication/PubMed/36434041" } ] } ], "pathway": [ { "id": "hsa:10617", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10617", "resource": "KEGG Pathway" }, { "id": "R-HSA-5689901", "name": "Metalloprotease DUBs", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689901", "resource": "Reactome", "description": "Metalloprotease DUBs" } ], "orthologs": [ { "uniprot_canonical_ac": "Q8R424-1", "protein_name": "STAM-binding protein", "gene_name": "Stambp", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSDHADVSLPPQDRVRILSQLGSAVELNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAIIPEKKDAVKKLKNVAFPKAEELKTELLKRYTKEYEQYKERKKKEEEELARNIAIQQELEKEKQRVAQQKQKQLEQEQFHAFEKMIQKQELEKERLKIVQEFGKVDPGPCGPLLPDLEKPCVDVAPSSPFSPTQTSDCNTTLRPAKPPVVDRSLKPGALSVIENVPTIEGLRHIVVPRNLCSEFLQLASANTAKGIETCGVLCGKLMRNEFTITHVLIPRQNGGPDYCHTENEEEIFFMQDDLGLLTLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESIAIVCSPKFQETGFFKLTDYGLQEISTCRQKGFHPHGRDPPLFCDCSHVTVKDRIVTITDLR", "length": 424 }, "evidence": [ { "id": "45919235", "url": "http://www.informatics.jax.org/homology/45919235", "database": "MGI" }, { "id": "O95630", "url": "https://omabrowser.org/oma/group/O95630/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9CQ26-1", "protein_name": "STAM-binding protein", "gene_name": "Stambp", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSDHGDVSLPPQDRVRILSQLGSAVELNEDIPPRRYYRSGVEIIRMASVYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAIIPEKKDAVKKLKSVAFPKAEELKTELLRRYTKEYEQYKERKKKEEEELARNIAIQQELEKEKQRVAQQKQKQLEQEQFHAFEEMIQRQELEKERLKIVQEFGKVDPGPCGPLLPDLEKPCVDVAPSSPFSPTQTPDCNTGMRPAKPPVVDRSLKPGALSVIENVPTIEGLRHIVVPRNLCSEFLQLASANTAKGIETCGVLCGKLMRNEFTITHVLIPRQNGGPDYCHTENEEEIFFMQDDLGLLTLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESIAIVCSPKFQETGFFKLTDYGLQEISTCRQKGFHPHGRDPPLFCDCSHVTVKDRIVTITDLR", "length": 424 }, "evidence": [ { "id": "45919235", "url": "http://www.informatics.jax.org/homology/45919235", "database": "MGI" }, { "id": "O95630", "url": "https://omabrowser.org/oma/group/O95630/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9VA71-1", "protein_name": "FI19924p1", "gene_name": "Q9VA71", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MSKAVNNMSMGDVEPQERMKHLSHCGNLIEVDKNMPVTRYYRSGTEMLRMANVYLREGNHENAFILYLRYMTLFIEKIRQHPDYGSVKAEVRDINRKIKDEIMPTTEKLRAKLLTHYQREYEQFLASKEAERVKELERERERERERQRQKEREKAGSSAIPSLIPANLHVLIDEGNQPSAPDLGLLDQVVYPNDFPTGANRSLPGSGLLLPAASEAAADKTTNSKPSFDRNQKPSYNRTDSLLAGSLRLVYVPGDTMEVFLKLALANTSKNIETCGVLAGHLSQNQLYITHIITPQQQGTPDSCNTMHEEQIFDVQDQMQLITLGWIHTHPTQTAFLSSVDLHTHCSYQIMMPEALAIVCAPKYNTTGFFILTPHYGLDYIAQCRQSGFHPHPNDPPLFMEAQHIRMDNQAKIKVIDLRR", "length": 420 }, "evidence": [ { "id": "O95630", "url": "https://omabrowser.org/oma/group/O95630/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 8, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" } ], "pmid": "" }, { "name": "endosome", "id": "GO:0005768", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005768", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" } ], "pmid": "" }, { "name": "early endosome", "id": "GO:0005769", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005769", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" } ], "pmid": "" }, { "name": "cleavage furrow", "id": "GO:0032154", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032154", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "metallopeptidase activity", "id": "GO:0008237", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008237", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" } ], "pmid": "" }, { "name": "K63-linked deubiquitinase activity", "id": "GO:0061578", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061578", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" } ], "pmid": "" }, { "name": "metal-dependent deubiquitinase activity", "id": "GO:0140492", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140492", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" } ], "pmid": "" }, { "name": "protein domain specific binding", "id": "GO:0019904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019904", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" } ], "pmid": "" }, { "name": "deubiquitinase activity", "id": "GO:0101005", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0101005", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 10, "go_terms": [ { "name": "negative regulation of Ras protein signal transduction", "id": "GO:0046580", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046580", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" } ], "pmid": "" }, { "name": "proteolysis", "id": "GO:0006508", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006508", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" } ], "pmid": "" }, { "name": "positive regulation of cell population proliferation", "id": "GO:0008284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008284", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" } ], "pmid": "" }, { "name": "protein deubiquitination", "id": "GO:0016579", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016579", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" } ], "pmid": "" }, { "name": "mitotic cytokinesis", "id": "GO:0000281", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000281", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" } ], "pmid": "" }, { "name": "negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction", "id": "GO:0051898", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051898", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" } ], "pmid": "" }, { "name": "receptor signaling pathway via JAK-STAT", "id": "GO:0007259", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007259", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" } ], "pmid": "" }, { "name": "negative regulation of hippocampal neuron apoptotic process", "id": "GO:0110091", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0110091", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" } ], "pmid": "" }, { "name": "hippocampal neuron apoptotic process", "id": "GO:0110088", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0110088", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" } ], "pmid": "" }, { "name": "protein modification by small protein conjugation or removal", "id": "GO:0070647", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070647", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "Phosphorylated after BMP type I receptor activation.", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" }, { "database": "PubMed", "id": "11483516", "url": "https://glygen.org/publication/PubMed/11483516" } ] }, { "annotation": "Ubiquitinated by SMURF2 in the presence of RNF11.", "evidence": [ { "database": "UniProtKB", "id": "O95630", "url": "https://www.uniprot.org/uniprot/O95630" }, { "database": "PubMed", "id": "14755250", "url": "https://glygen.org/publication/PubMed/14755250" } ] } ], "interactions": [], "reactions": [ { "id": "R-HSA-5693061", "name": "STAMBP binds STAM", "equation": "", "summary": "STAMBP (AMSH) was identified as an interacting partner of the SH3 domain of STAM (Tanaka et al. 1999) and later characterized as a Zn2+-dependent ubiquitin isopeptidase with a substrate preference for Lys-63-linked polyubiquitin chains (McCullough et al. 2004, 2006). ; ; At the N terminus STAMBP contains a nuclear localization signal and a microtubule-interacting and transport (MIT) domain that can interact with several chromatin-modifying proteins that are components of the Endosomal sorting complex required for transport (ESCRT) III complex (Sierra et al. 2010). STAMBP binds clathrin heavy chains, which anchors it to endosomes (McCullough et al. 2006, Nakamura et al. 2006) and contains a STAM-interacting motif that binds the SH3 domain of STAM, stimulating the deubiquitinating activity of STAMBP (McCullough et al. 2006, Kim et al. 2006, Sierra et al. 2010).", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O95630-1" ], "evidence": [ { "id": "R-HSA-5693061", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693061" } ] }, { "id": "R-HSA-5696547", "name": "STAMBPL1 is a deubiquitinase", "equation": "", "summary": "STAMBPL1 (AMSH-LP) has Lys-63 deubiquitinase activity (Sato et al. 2008) and positively regulates TGF-beta signaling (Ibarolla et al. 2004) but unlike STAMBP (AMSH1) it does not bind STAM (Kikuchi et al. 2003).", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O95630-1", "Q96FJ0-1" ], "evidence": [ { "id": "R-HSA-5696547", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696547" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "O95630", "gene_name": "STAMBP", "activity": [ { "ec_number": "3.4.19.-", "activity": "", "evidence": [ { "id": "O95630", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95630" } ] } ] }, { "uniprot_ac": "Q96FJ0", "gene_name": "STAMBPL1", "activity": [ { "ec_number": "3.4.19.-", "activity": "", "evidence": [ { "id": "Q96FJ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96FJ0" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 2, 48, 243, 245, 247 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 21 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }