{ "uniprot_canonical_ac": "O95628-1", "uniprot_ac": "O95628", "uniprot_id": "CNOT4_HUMAN", "mass": { "chemical_mass": 63510.0, "monoisotopic_mass": 63510.0 }, "refseq": { "ac": "NP_001008226", "name": "CCR4-NOT transcription complex subunit 4 isoform b", "summary": "The protein encoded by this gene is a subunit of the CCR4-NOT complex, a global transcriptional regulator. The encoded protein interacts with CNOT1 and has E3 ubiquitin ligase activity. Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jul 2010].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008226" }, "gene_names": [ { "name": "CNOT4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O95628", "id": "O95628" }, { "name": "CLONE243; NOT4; NOT4H", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008226", "id": "NP_001008226" }, { "name": "CNOT4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008226", "id": "NP_001008226" }, { "name": "NOT4", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O95628", "id": "O95628" } ], "protein_names": [ { "name": "CCR4-NOT transcription complex subunit 4", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O95628" }, { "name": "2.3.2.27", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95628" }, { "name": "CCR4-NOT transcription complex subunit 4 isoform b", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008226", "id": "NP_001008226" }, { "name": "CCR4-associated factor 4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95628" }, { "name": "E3 ubiquitin-protein ligase CNOT4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95628" }, { "name": "NOT4 (negative regulator of transcription 4, yeast) homolog; CCR4-associated factor 4; E3 ubiquitin-protein ligase CNOT4; potential transcriptional repressor NOT4Hp; RING-type E3 ubiquitin transferase CNOT4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008226", "id": "NP_001008226" }, { "name": "Potential transcriptional repressor NOT4Hp", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95628" }, { "name": "RING-type E3 ubiquitin transferase CNOT4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95628" } ], "function": [ { "annotation": "Aberrant expression of MYD88 via RNA-controlling CNOT4 and EXOSC3 in colonic mucosa impacts generation of colonic cancer.", "evidence": [ { "database": "RefSeq", "id": "NP_001008226", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008226" }, { "database": "PubMed", "id": "34626022", "url": "https://glygen.org/publication/PubMed/34626022" } ] }, { "annotation": "CNOT4 enhances the efficacy of anti-PD-1 immunotherapy in a model of non-small cell lung cancer.", "evidence": [ { "database": "RefSeq", "id": "NP_001008226", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008226" }, { "database": "PubMed", "id": "33034149", "url": "https://glygen.org/publication/PubMed/33034149" } ] }, { "annotation": "CNOT4 suppresses non-small cell lung cancer progression and is required for effector cytolytic T lymphocytes cell responses to lung cancer cells.", "evidence": [ { "database": "RefSeq", "id": "NP_001008226", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008226" }, { "database": "PubMed", "id": "33592572", "url": "https://glygen.org/publication/PubMed/33592572" } ] }, { "annotation": "CNOT4 suppresses nonsmall cell lung cancer progression by promoting the degradation of PAF1.", "evidence": [ { "database": "RefSeq", "id": "NP_001008226", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008226" }, { "database": "PubMed", "id": "37493105", "url": "https://glygen.org/publication/PubMed/37493105" } ] }, { "annotation": "Data show that binding of the CNOT4 RING finger to the ubiquitin-conjugating enzyme (E2) UbcH5B is highly selective", "evidence": [ { "database": "RefSeq", "id": "NP_001008226", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008226" }, { "database": "PubMed", "id": "15001359", "url": "https://glygen.org/publication/PubMed/15001359" } ] }, { "annotation": "Has E3 ubiquitin ligase activity, promoting ubiquitination and degradation of target proteins (PubMed:11823428, PubMed:22159038, PubMed:26575292). Involved in activation of the JAK/STAT pathway (PubMed:11823428, PubMed:22159038). Catalyzes ubiquitination of methylated RBM15 (PubMed:26575292). Plays a role in quality control of translation of mitochondrial outer membrane-localized mRNA (PubMed:29861391). As part of the PINK1-regulated signaling, upon mitochondria damage, ubiquitinates ABCE1 and thereby recruits autophagy receptors to the mitochondrial outer membrane to initiate mitophagy (PubMed:29861391).", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628#function" }, { "database": "PubMed", "id": "22159038", "url": "https://glygen.org/publication/PubMed/22159038" }, { "database": "PubMed", "id": "11823428", "url": "https://glygen.org/publication/PubMed/11823428" }, { "database": "PubMed", "id": "29861391", "url": "https://glygen.org/publication/PubMed/29861391" }, { "database": "PubMed", "id": "26575292", "url": "https://glygen.org/publication/PubMed/26575292" } ] }, { "annotation": "The Interplay between HGF/c-met Axis and Nox4 in BRAF Mutated Melanoma. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001008226", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008226" }, { "database": "PubMed", "id": "33451139", "url": "https://glygen.org/publication/PubMed/33451139" } ] }, { "annotation": "The protein encoded by this gene is a subunit of the CCR4-NOT complex, a global transcriptional regulator. The encoded protein interacts with CNOT1 and has E3 ubiquitin ligase activity. Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jul 2010].", "evidence": [ { "database": "RefSeq", "id": "NP_001008226", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008226" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs74772890", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs74772890" }, { "id": "rs74772890", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs74772890" }, { "id": "rs74772890", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs74772890" }, { "id": "rs74772890", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs74772890#frequency_tab" }, { "id": "rs74772890", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs74772890" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 317, "end_pos": 317, "sequence_org": "S", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->L).", "chr_id": "7", "chr_pos": "135395813", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.000399", "site_lbl": "S317", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs949639650", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs949639650" }, { "id": "rs949639650", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs949639650" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 331, "end_pos": 331, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "7", "chr_pos": "135395772", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T331", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O95628", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95628" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 375, "end_pos": 375, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "A", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->A).", "chr_id": "7", "chr_pos": "135395640", "ref_nt": "T", "alt_nt": "C", "minor_allelic_frequency": "", "site_lbl": "T375", "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "O95628", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95628" }, { "id": "rs1585577572", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1585577572" }, { "id": "rs1585577572", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1585577572" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 409, "end_pos": 409, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DVT->NVT).", "chr_id": "7", "chr_pos": "135394320", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "D409", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "O95628", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95628" }, { "id": "rs745842800", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745842800" }, { "id": "rs745842800", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745842800" }, { "id": "rs745842800", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745842800" }, { "id": "rs745842800", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs745842800#frequency_tab" }, { "id": "rs745842800", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745842800" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 463, "end_pos": 463, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NAN->NAS).", "chr_id": "7", "chr_pos": "135394157", "ref_nt": "T", "alt_nt": "C", "minor_allelic_frequency": "", "site_lbl": "N463", "disease": [ { "disease_id": "DOID:1319", "recommended_name": { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain." }, "synonyms": [ { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "BT - Brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult malignant brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm, adult", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of Brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of adult brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary malignant neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "tumor of the Brain", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "O95628", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95628" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 548, "end_pos": 548, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "K", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (KVS->NVS).", "chr_id": "7", "chr_pos": "135388878", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "K548", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [ { "start_pos": 16, "end_pos": 16, "sequence_org": "L", "sequence_mut": "A", "comment": "Abolishes interaction with E2 ubiquitin ligases.", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" }, { "database": "PubMed", "id": "11823428", "url": "https://glygen.org/publication/PubMed/11823428" } ] }, { "start_pos": 16, "end_pos": 16, "sequence_org": "L", "sequence_mut": "E", "comment": "Abolishes interaction with E2 ubiquitin ligases.", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" }, { "database": "PubMed", "id": "11823428", "url": "https://glygen.org/publication/PubMed/11823428" } ] }, { "start_pos": 17, "end_pos": 17, "sequence_org": "C", "sequence_mut": "A", "comment": "Abolishes interaction with E2 ubiquitin ligases.", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" }, { "database": "PubMed", "id": "11823428", "url": "https://glygen.org/publication/PubMed/11823428" } ] }, { "start_pos": 18, "end_pos": 18, "sequence_org": "M", "sequence_mut": "A", "comment": "Strongly reduces interaction with E2 ubiquitin ligases.", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" }, { "database": "PubMed", "id": "11823428", "url": "https://glygen.org/publication/PubMed/11823428" } ] }, { "start_pos": 33, "end_pos": 33, "sequence_org": "C", "sequence_mut": "R", "comment": "Abolishes interaction with E2 ubiquitin ligases.", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" }, { "database": "PubMed", "id": "11823428", "url": "https://glygen.org/publication/PubMed/11823428" } ] }, { "start_pos": 42, "end_pos": 42, "sequence_org": "W", "sequence_mut": "A", "comment": "Strongly reduces interaction with E2 ubiquitin ligases.", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" }, { "database": "PubMed", "id": "11823428", "url": "https://glygen.org/publication/PubMed/11823428" } ] }, { "start_pos": 44, "end_pos": 44, "sequence_org": "R", "sequence_mut": "A", "comment": "Strongly reduces interaction with E2 ubiquitin ligases.", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" }, { "database": "PubMed", "id": "11823428", "url": "https://glygen.org/publication/PubMed/11823428" } ] }, { "start_pos": 44, "end_pos": 44, "sequence_org": "R", "sequence_mut": "E", "comment": "Strongly reduces interaction with E2 ubiquitin ligases.", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" }, { "database": "PubMed", "id": "11823428", "url": "https://glygen.org/publication/PubMed/11823428" } ] }, { "start_pos": 45, "end_pos": 45, "sequence_org": "I", "sequence_mut": "A", "comment": "Strongly reduces interaction with E2 ubiquitin ligases.", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" }, { "database": "PubMed", "id": "11823428", "url": "https://glygen.org/publication/PubMed/11823428" } ] }, { "start_pos": 45, "end_pos": 45, "sequence_org": "I", "sequence_mut": "W", "comment": "Strongly reduces interaction with E2 ubiquitin ligases.", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" }, { "database": "PubMed", "id": "11823428", "url": "https://glygen.org/publication/PubMed/11823428" } ] }, { "start_pos": 49, "end_pos": 49, "sequence_org": "E", "sequence_mut": "A", "comment": "Strongly reduces interaction with E2 ubiquitin ligases.", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" }, { "database": "PubMed", "id": "15001359", "url": "https://glygen.org/publication/PubMed/15001359" }, { "database": "PubMed", "id": "11823428", "url": "https://glygen.org/publication/PubMed/11823428" } ] }, { "start_pos": 49, "end_pos": 49, "sequence_org": "E", "sequence_mut": "K", "comment": "Strongly reduced interaction with UBE2D2.", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" }, { "database": "PubMed", "id": "15001359", "url": "https://glygen.org/publication/PubMed/15001359" }, { "database": "PubMed", "id": "11823428", "url": "https://glygen.org/publication/PubMed/11823428" } ] }, { "start_pos": 54, "end_pos": 54, "sequence_org": "P", "sequence_mut": "A", "comment": "Strongly reduces interaction with E2 ubiquitin ligases.", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" }, { "database": "PubMed", "id": "11823428", "url": "https://glygen.org/publication/PubMed/11823428" } ] }, { "start_pos": 57, "end_pos": 57, "sequence_org": "R", "sequence_mut": "A", "comment": "Strongly reduces interaction with E2 ubiquitin ligases.", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" }, { "database": "PubMed", "id": "11823428", "url": "https://glygen.org/publication/PubMed/11823428" } ] }, { "start_pos": 57, "end_pos": 57, "sequence_org": "R", "sequence_mut": "E", "comment": "Strongly reduces interaction with E2 ubiquitin ligases.", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" }, { "database": "PubMed", "id": "11823428", "url": "https://glygen.org/publication/PubMed/11823428" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "79.57", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000080802", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000080802" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "80.75", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000080802", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000080802" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "80.65", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000080802", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000080802" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "65.23", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000080802", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000080802" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "85.66", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000080802", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000080802" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "82.86", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000080802", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000080802" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "70.8", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000080802", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000080802" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "83.63", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000080802", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000080802" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "83.15", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000080802", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000080802" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "74.8", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000080802", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000080802" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "83.65", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000080802", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000080802" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "81.71", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000080802", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000080802" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "82.42", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000080802", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000080802" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O95628", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95628" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O95628", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95628" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O95628", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95628" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O95628", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95628" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O95628", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95628" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O95628", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95628" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O95628", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95628" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O95628", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95628" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O95628", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95628" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O95628", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95628" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O95628", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95628" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O95628", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95628" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" } ], "common_name": "Human" } ], "gene": [ { "name": "CNOT4", "url": "https://www.uniprot.org/uniprot/O95628", "locus": { "chromosome": "7", "start_pos": 135361795, "end_pos": 135510145, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000080802", "url": "https://www.ensembl.org/id/ENSG00000080802" } ] } } ], "crossref": [ { "id": "ENSG00000080802", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000080802", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O95628", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95628", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd12438", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd12438", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd16618", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16618", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL4105770", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4105770", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "CNOT4", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CNOT4", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "4850", "url": "https://www.ncbi.nlm.nih.gov/gene/4850", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "7880", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=7880", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O95628", "url": "https://www.ebi.ac.uk/intact/interactors/id:O95628*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000504", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000504", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000571", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000571", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001841", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001841", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003954", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003954", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012677", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012677", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013083", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013083", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR034261", "url": "https://www.ebi.ac.uk/interpro/entry/IPR034261", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035979", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035979", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039515", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039515", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039780", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039780", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "604911", "url": "http://www.omim.org/entry/604911", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O95628", "url": "https://www.nextprot.org/entry/NX_O95628", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O95628", "url": "https://oglcnac.org/atlas/detail/O95628", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "O95628", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95628", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "QGHYHLF", "url": "https://omabrowser.org/oma/group/QGHYHLF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1748at2759", "url": "http://www.orthodb.org/?query=1748at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12603", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12603", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12603:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12603:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1E4U", "url": "https://www.rcsb.org/structure/1E4U", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1UR6", "url": "https://www.rcsb.org/structure/1UR6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00076", "url": "http://pfam.xfam.org/family/PF00076", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF14570", "url": "http://pfam.xfam.org/family/PF14570", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O95628", "url": "https://pharos.nih.gov/targets/O95628", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O95628", "url": "http://purl.obolibrary.org/obo/PR_O95628", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9820841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9820841", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001008226", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008226", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A9L9PY48", "url": "https://www.uniprot.org/uniprot/A0A9L9PY48", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A9L9PY48-1", "url": "https://www.uniprot.org/uniprot/A0A9L9PY48-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A9L9PY79", "url": "https://www.uniprot.org/uniprot/A0A9L9PY79", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A9L9PY79-1", "url": "https://www.uniprot.org/uniprot/A0A9L9PY79-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95628-1", "url": "https://www.uniprot.org/uniprot/O95628-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95628-10", "url": "https://www.uniprot.org/uniprot/O95628-10", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95628-2", "url": "https://www.uniprot.org/uniprot/O95628-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95628-3", "url": "https://www.uniprot.org/uniprot/O95628-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95628-4", "url": "https://www.uniprot.org/uniprot/O95628-4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95628-5", "url": "https://www.uniprot.org/uniprot/O95628-5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95628-6", "url": "https://www.uniprot.org/uniprot/O95628-6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95628-7", "url": "https://www.uniprot.org/uniprot/O95628-7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95628-8", "url": "https://www.uniprot.org/uniprot/O95628-8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95628-9", "url": "https://www.uniprot.org/uniprot/O95628-9", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPLSQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYFLKNMQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQRYDTPIDKPSDSLSIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFSFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVAGEEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA", "length": 575, "header": "sp|O95628-1|CNOT4_HUMAN Isoform 1 of CCR4-NOT transcription complex subunit 4 OS=Homo sapiens OX=9606 GN=CNOT4 PE=1 SV=3 CANONICAL=O95628-1" }, "isoforms": [ { "isoform_ac": "A0A9L9PY48-1", "url": "", "sequence": { "sequence": "MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPLSQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYFLKNMQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQSPIDKPSDSLSIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFSFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVAVHQRPTLPPPTA", "length": 551, "header": "tr|A0A9L9PY48-1|A0A9L9PY48_HUMAN Computationally mapped isoform of CCR4-NOT transcription complex subunit 4 OS=Homo sapiens OX=9606 GN=CNOT4 PE=1 SV=1 CANONICAL=O95628-1" }, "locus": { "chromosome": "7", "start_pos": 135438331, "end_pos": 135363902, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000707062.1", "url": "https://www.ensembl.org/id/ENST00000707062.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000516713.1", "url": "https://www.ensembl.org/id/ENSP00000516713.1" } ] } }, { "isoform_ac": "A0A9L9PY79-1", "url": "", "sequence": { "sequence": "MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPLSQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYFLKNMQCPKPDCMYLHELGDEAASFTKEEMQYKHALTSKNVDHTTY", "length": 244, "header": "tr|A0A9L9PY79-1|CNOT4_HUMAN Computationally mapped isoform of CCR4-NOT transcription complex subunit 4 OS=Homo sapiens OX=9606 GN=CNOT4 PE=1 SV=1 CANONICAL=O95628-1" }, "locus": { "chromosome": "7", "start_pos": 135438331, "end_pos": 135412840, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000707063.1", "url": "https://www.ensembl.org/id/ENST00000707063.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000516714.1", "url": "https://www.ensembl.org/id/ENSP00000516714.1" } ] } }, { "isoform_ac": "O95628-1", "url": "", "sequence": { "sequence": "MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPLSQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYFLKNMQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQRYDTPIDKPSDSLSIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFSFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVAGEEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA", "length": 575, "header": "sp|O95628-1|CNOT4_HUMAN Isoform 1 of CCR4-NOT transcription complex subunit 4 OS=Homo sapiens OX=9606 GN=CNOT4 PE=1 SV=3 CANONICAL=O95628-1" }, "locus": { "chromosome": "7", "start_pos": 135438331, "end_pos": 135388797, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000707064.1", "url": "https://www.ensembl.org/id/ENST00000707064.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000516715.1", "url": "https://www.ensembl.org/id/ENSP00000516715.1" } ] } }, { "isoform_ac": "O95628-10", "url": "", "sequence": { "sequence": "MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPLSQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYFLKNMQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQRYDTPIDKPSDSLSIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFSFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVADNSSSVESLNMKEWQDGLRALLPNININFGGLPNSSSPSNANHSAPTSNTATTDSLSWDSPGSWTDPAIITGIPASSGNSLDSLQDDNPPHWLKSLQALTEMDGPSAAPSQTHHSAPFSTQIPLHRASWNPYPPPSNPSSFHSPPPGFQTAFRPPSKTPTDLLQSSTLDRH", "length": 713, "header": "sp|O95628-10|CNOT4_HUMAN Isoform 10 of CCR4-NOT transcription complex subunit 4 OS=Homo sapiens OX=9606 GN=CNOT4 PE=1 SV=3 CANONICAL=O95628-1" }, "locus": { "chromosome": "7", "start_pos": 135438331, "end_pos": 135362888, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000541284.6", "url": "https://www.ensembl.org/id/ENST00000541284.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000445508.1", "url": "https://www.ensembl.org/id/ENSP00000445508.1" } ] } }, { "isoform_ac": "O95628-2", "url": "", "sequence": { "sequence": "MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPLSQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYFLKNMQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQSPIDKPSDSLSIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFSFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVAGEEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA", "length": 572, "header": "sp|O95628-2|CNOT4_HUMAN Isoform 2 of CCR4-NOT transcription complex subunit 4 OS=Homo sapiens OX=9606 GN=CNOT4 PE=1 SV=3 CANONICAL=O95628-1" }, "locus": { "chromosome": "7", "start_pos": 135438331, "end_pos": 135388797, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000428680.6", "url": "https://www.ensembl.org/id/ENST00000428680.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000399108.2", "url": "https://www.ensembl.org/id/ENSP00000399108.2" } ] } }, { "isoform_ac": "O95628-3", "url": "", "sequence": { "sequence": "MEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPLSQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYFLKNMQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQRYDTPIDKPSDSLSIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFSFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVAGEEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA", "length": 558, "header": "sp|O95628-3|CNOT4_HUMAN Isoform 3 of CCR4-NOT transcription complex subunit 4 OS=Homo sapiens OX=9606 GN=CNOT4 PE=1 SV=3 CANONICAL=O95628-1" }, "locus": {} }, { "isoform_ac": "O95628-4", "url": "", "sequence": { "sequence": "MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPLSQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYFLKNMQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQRYDTPIDKPSDSLSIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFSFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVAGIPASSGNSLDSLQDDNPPHWLKSLQALTEMDGPSAAPSQTHHSAPFSTQIPLHRASWNPYPPPSNPSSFHSPPPGFQTAFRPPSKTPTDLLQSSTLDRH", "length": 642, "header": "sp|O95628-4|CNOT4_HUMAN Isoform 4 of CCR4-NOT transcription complex subunit 4 OS=Homo sapiens OX=9606 GN=CNOT4 PE=1 SV=3 CANONICAL=O95628-1" }, "locus": { "chromosome": "7", "start_pos": 135438331, "end_pos": 135362888, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000423368.6", "url": "https://www.ensembl.org/id/ENST00000423368.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000406777.2", "url": "https://www.ensembl.org/id/ENSP00000406777.2" } ] } }, { "isoform_ac": "O95628-5", "url": "", "sequence": { "sequence": "MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPLSQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYFLKNMQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQRYDTPIDKPSDSLSIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLTEPIERKRLAVLKRR", "length": 433, "header": "sp|O95628-5|CNOT4_HUMAN Isoform 5 of CCR4-NOT transcription complex subunit 4 OS=Homo sapiens OX=9606 GN=CNOT4 PE=1 SV=3 CANONICAL=O95628-1" }, "locus": { "chromosome": "7", "start_pos": 135438331, "end_pos": 135384678, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000414802.5", "url": "https://www.ensembl.org/id/ENST00000414802.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000416532.1", "url": "https://www.ensembl.org/id/ENSP00000416532.1" } ] } }, { "isoform_ac": "O95628-6", "url": "", "sequence": { "sequence": "MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPLSQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYFLKNMQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQRYDTPIDKPSDSLSIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFSFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVADNSSSIESLNMKEWQDGLRALLPNININFGGLPNSSSPSNANHSAPTSNTATTDSLSWDSPGSWTDPAIITGIPASSGNSLDSLQDDNPPHWLKSLQALTEMDGPSAAPSQTHHSAPFSTQIPLHRASWNPYPPPSNPSSFHSPPPQIYYRVQHWTAIRQRGATIRKCRICPTLFSPSQPTTHSSLLISYVLKNPVPDQFFFSLTPDAMRSQGHYHLFINCKNFC", "length": 767, "header": "sp|O95628-6|CNOT4_HUMAN Isoform 6 of CCR4-NOT transcription complex subunit 4 OS=Homo sapiens OX=9606 GN=CNOT4 PE=1 SV=3 CANONICAL=O95628-1" }, "locus": {} }, { "isoform_ac": "O95628-7", "url": "", "sequence": { "sequence": "MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPLSQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYFLKNMQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQRYDTPIDKPSDSLSIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFSFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVAGIPASSGNSLDSLQDDNPPHWLKSLQALTEMDGQRCSITDPPQRPLQHTDPAAQSQLESLPSSFKPFQLPLPTPRLSDGLQTPQQNPHRFTTEFNTGPPLGKEEQPLENAGFVPLCFLPLSPPPTAPFSSLMF", "length": 675, "header": "sp|O95628-7|CNOT4_HUMAN Isoform 7 of CCR4-NOT transcription complex subunit 4 OS=Homo sapiens OX=9606 GN=CNOT4 PE=1 SV=3 CANONICAL=O95628-1" }, "locus": {} }, { "isoform_ac": "O95628-8", "url": "", "sequence": { "sequence": "MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPLSQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYFLKNMQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQSPIDKPSDSLSIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFSFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVAGIPASSGNSLDSLQDDNPPHWLKSLQALTEMDGPSAAPSQTHHSAPFSTQIPLHRASWNPYPPPSNPSSFHSPPPGFQTAFRPPSKTPTDLLQSSTLDRH", "length": 639, "header": "sp|O95628-8|CNOT4_HUMAN Isoform 8 of CCR4-NOT transcription complex subunit 4 OS=Homo sapiens OX=9606 GN=CNOT4 PE=1 SV=3 CANONICAL=O95628-1" }, "locus": { "chromosome": "7", "start_pos": 135438331, "end_pos": 135362888, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000361528.8", "url": "https://www.ensembl.org/id/ENST00000361528.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000354673.4", "url": "https://www.ensembl.org/id/ENSP00000354673.4" } ] } }, { "isoform_ac": "O95628-9", "url": "", "sequence": { "sequence": "MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPLSQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYFLKNMQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQSPIDKPSDSLSIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFSFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVADNSSSVESLNMKEWQDGLRALLPNININFGGLPNSSSPSNANHSAPTSNTATTDSLSWDSPGSWTDPAIITGIPASSGNSLDSLQDDNPPHWLKSLQALTEMDGPSAAPSQTHHSAPFSTQIPLHRASWNPYPPPSNPSSFHSPPPGFQTAFRPPSKTPTDLLQSSTLDRH", "length": 710, "header": "sp|O95628-9|CNOT4_HUMAN Isoform 9 of CCR4-NOT transcription complex subunit 4 OS=Homo sapiens OX=9606 GN=CNOT4 PE=1 SV=3 CANONICAL=O95628-1" }, "locus": { "chromosome": "7", "start_pos": 135438331, "end_pos": 135362888, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000451834.5", "url": "https://www.ensembl.org/id/ENST00000451834.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000388491.1", "url": "https://www.ensembl.org/id/ENSP00000388491.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 309, "start_aa": "Ser", "end_pos": 309, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser309", "evidence": [ { "id": "O95628", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95628" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "O95628", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O95628" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 316, "start_aa": "Ser", "end_pos": 316, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser316", "evidence": [ { "id": "O95628", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95628" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "O95628", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O95628" }, { "id": "32938750", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32938750" } ] }, { "glytoucan_ac": "G70994MS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 316, "start_aa": "Ser", "end_pos": 316, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser316", "evidence": [ { "id": "GLY_000142", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000142" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 317, "start_aa": "Ser", "end_pos": 317, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser317", "evidence": [ { "id": "O95628", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95628" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "O95628", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O95628" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 318, "start_aa": "Ser", "end_pos": 318, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser318", "evidence": [ { "id": "O95628", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95628" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "O95628", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O95628" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 321, "start_aa": "Ser", "end_pos": 321, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser321", "evidence": [ { "id": "O95628", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95628" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "O95628", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O95628" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 324, "start_aa": "Ser", "end_pos": 324, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser324", "evidence": [ { "id": "O95628", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95628" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "O95628", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O95628" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 331, "start_aa": "Thr", "end_pos": 331, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr331", "evidence": [ { "id": "O95628", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95628" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "O95628", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O95628" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 335, "start_aa": "Ser", "end_pos": 335, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser335", "evidence": [ { "id": "O95628", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O95628" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 375, "start_aa": "Thr", "end_pos": 375, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr375", "evidence": [ { "id": "O95628", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95628" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "O95628", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O95628" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 396, "start_aa": "Ser", "end_pos": 396, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser396", "evidence": [ { "id": "O95628", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95628" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "O95628", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O95628" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 435, "start_aa": "Ser", "end_pos": 435, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser435", "evidence": [ { "id": "O95628", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95628" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" } ] } ], "phosphorylation": [ { "start_pos": 301, "end_pos": 301, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "phospho.ELM", "id": "O95628", "url": "http://phospho.elm.eu.org/byAccession/O95628.html" }, { "database": "iPTMnet", "id": "O95628", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95628" }, { "database": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" } ], "site_lbl": "Ser301" }, { "start_pos": 324, "end_pos": 324, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "phospho.ELM", "id": "O95628", "url": "http://phospho.elm.eu.org/byAccession/O95628.html" }, { "database": "iPTMnet", "id": "O95628", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95628" } ], "site_lbl": "Ser324" }, { "start_pos": 432, "end_pos": 432, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "phospho.ELM", "id": "O95628", "url": "http://phospho.elm.eu.org/byAccession/O95628.html" }, { "database": "iPTMnet", "id": "O95628", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95628" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Ser432" }, { "start_pos": 490, "end_pos": 490, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "O95628", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95628" } ], "site_lbl": "Ser490" }, { "start_pos": 71, "end_pos": 71, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" }, { "database": "PubMed", "id": "17525332", "url": "https://glygen.org/publication/PubMed/17525332" }, { "database": "phospho.ELM", "id": "O95628", "url": "http://phospho.elm.eu.org/byAccession/O95628.html" }, { "database": "iPTMnet", "id": "O95628", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95628" } ], "site_lbl": "Ser71" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Isolation and characterization of human orthologs of yeast CCR4-NOT complex subunits.", "journal": "Nucleic Acids Res.", "date": "2000", "authors": "Albert TK, Lemaire M, van Berkum NL, Gentz R, Collart MA, Timmers HT", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" }, { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "10637334", "url": "https://glygen.org/publication/PubMed/10637334" } ] }, { "title": "Interaction between a poly(A)-specific ribonuclease and the 5' cap influences mRNA deadenylation rates in vitro.", "journal": "Molecular cell", "date": "2000", "authors": "Gao M, Fritz DT, Ford LP, Wilusz J", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "10882133", "url": "https://glygen.org/publication/PubMed/10882133" } ] }, { "title": "The structure of the C4C4 ring finger of human NOT4 reveals features distinct from those of C3HC4 RING fingers.", "journal": "J. Biol. Chem.", "date": "2001", "authors": "Hanzawa H, de Ruwe M J, Albert T K, van Der Vliet P C, Timmers H T, Boelens R", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" } ], "reference": [ { "type": "PubMed", "id": "11087754", "url": "https://glygen.org/publication/PubMed/11087754" } ] }, { "title": "The cap-to-tail guide to mRNA turnover.", "journal": "Nature reviews. Molecular cell biology", "date": "2001", "authors": "Wilusz CJ, Wormington M, Peltz SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "11283721", "url": "https://glygen.org/publication/PubMed/11283721" } ] }, { "title": "The human BTG2/TIS21/PC3 gene: genomic structure, transcriptional regulation and evaluation as a candidate tumor suppressor gene.", "journal": "Gene", "date": "2002", "authors": "Duriez C, Falette N, Audoynaud C, Moyret-Lalle C, Bensaad K, Courtois S, Wang Q, Soussi T, Puisieux A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "11814693", "url": "https://glygen.org/publication/PubMed/11814693" } ] }, { "title": "Identification of a ubiquitin-protein ligase subunit within the CCR4-NOT transcription repressor complex.", "journal": "The EMBO journal", "date": "2002", "authors": "Albert TK, Hanzawa H, Legtenberg YI, de Ruwe MJ, van den Heuvel FA, Collart MA, Boelens R, Timmers HT", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" } ], "reference": [ { "type": "PubMed", "id": "11823428", "url": "https://glygen.org/publication/PubMed/11823428" } ] }, { "title": "CCR4, a 3'-5' poly(A) RNA and ssDNA exonuclease, is the catalytic component of the cytoplasmic deadenylase.", "journal": "The EMBO journal", "date": "2002", "authors": "Chen J, Chiang YC, Denis CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "11889047", "url": "https://glygen.org/publication/PubMed/11889047" } ] }, { "title": "A positive feedback mechanism in the transcriptional activation of Apaf-1 by p53 and the coactivator Zac-1.", "journal": "Oncogene", "date": "2002", "authors": "Rozenfeld-Granot G, Krishnamurthy J, Kannan K, Toren A, Amariglio N, Givol D, Rechavi G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "11896574", "url": "https://glygen.org/publication/PubMed/11896574" } ] }, { "title": "Silencing of the novel p53 target gene Snk/Plk2 leads to mitotic catastrophe in paclitaxel (taxol)-exposed cells.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Burns TF, Fei P, Scata KA, Dicker DT, El-Deiry WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "12897130", "url": "https://glygen.org/publication/PubMed/12897130" } ] }, { "title": "Properties of a HeLa cell 3' exonuclease specific for degrading poly(A) tails of mammalian mRNA.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Astrom J, Astrom A, Virtanen A", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "1355481", "url": "https://glygen.org/publication/PubMed/1355481" } ] }, { "title": "Identification of a human cytoplasmic poly(A) nuclease complex stimulated by poly(A)-binding protein.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Uchida N, Hoshino S, Katada T", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "14583602", "url": "https://glygen.org/publication/PubMed/14583602" } ] }, { "title": "The enzymes and control of eukaryotic mRNA turnover.", "journal": "Nature structural & molecular biology", "date": "2004", "authors": "Parker R, Song H", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "14749774", "url": "https://glygen.org/publication/PubMed/14749774" } ] }, { "title": "Cdc25C phosphorylation on serine 191 by Plk3 promotes its nuclear translocation.", "journal": "Oncogene", "date": "2004", "authors": "Bahassi el M, Hennigan RF, Myer DL, Stambrook PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "14968113", "url": "https://glygen.org/publication/PubMed/14968113" } ] }, { "title": "An altered-specificity ubiquitin-conjugating enzyme/ubiquitin-protein ligase pair.", "journal": "Journal of molecular biology", "date": "2004", "authors": "Winkler GS, Albert TK, Dominguez C, Legtenberg YI, Boelens R, Timmers HT", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" }, { "database": "RefSeq", "id": "NP_001008226", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008226" } ], "reference": [ { "type": "PubMed", "id": "15001359", "url": "https://glygen.org/publication/PubMed/15001359" } ] }, { "title": "Large-scale characterization of HeLa cell nuclear phosphoproteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "O95628", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95628" } ], "reference": [ { "type": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" } ] }, { "title": "Messenger RNA decay in mammalian cells: the exonuclease perspective.", "journal": "Cell biochemistry and biophysics", "date": "2004", "authors": "Fritz DT, Bergman N, Kilpatrick WJ, Wilusz CJ, Wilusz J", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "15475613", "url": "https://glygen.org/publication/PubMed/15475613" } ] }, { "title": "Overexpression of RGC-32 in colon cancer and other tumors.", "journal": "Experimental and molecular pathology", "date": "2005", "authors": "Fosbrink M, Cudrici C, Niculescu F, Badea TC, David S, Shamsuddin A, Shin ML, Rus H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "15713436", "url": "https://glygen.org/publication/PubMed/15713436" } ] }, { "title": "Identification of novel p53 target genes in ionizing radiation response.", "journal": "Cancer research", "date": "2005", "authors": "Jen KY, Cheung VG", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "16140933", "url": "https://glygen.org/publication/PubMed/16140933" } ] }, { "title": "From birth to death: the complex lives of eukaryotic mRNAs.", "journal": "Science (New York, N.Y.)", "date": "2005", "authors": "Moore MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "16141059", "url": "https://glygen.org/publication/PubMed/16141059" } ] }, { "title": "Transcriptional silencing of Polo-like kinase 2 (SNK/PLK2) is a frequent event in B-cell malignancies.", "journal": "Blood", "date": "2006", "authors": "Syed N, Smith P, Sullivan A, Spender LC, Dyer M, Karran L, O'Nions J, Allday M, Hoffmann I, Crawford D, Griffin B, Farrell PJ, Crook T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "16160013", "url": "https://glygen.org/publication/PubMed/16160013" } ] }, { "title": "Concerted action of poly(A) nucleases and decapping enzyme in mammalian mRNA turnover.", "journal": "Nature structural & molecular biology", "date": "2005", "authors": "Yamashita A, Chang TC, Yamashita Y, Zhu W, Zhong Z, Chen CY, Shyu AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "16284618", "url": "https://glygen.org/publication/PubMed/16284618" } ] }, { "title": "Opposing polymerase-deadenylase activities regulate cytoplasmic polyadenylation.", "journal": "Molecular cell", "date": "2006", "authors": "Kim JH, Richter JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "17052452", "url": "https://glygen.org/publication/PubMed/17052452" } ] }, { "title": "RGC32, a novel p53-inducible gene, is located on centrosomes during mitosis and results in G2/M arrest.", "journal": "Oncogene", "date": "2007", "authors": "Saigusa K, Imoto I, Tanikawa C, Aoyagi M, Ohno K, Nakamura Y, Inazawa J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "17146433", "url": "https://glygen.org/publication/PubMed/17146433" } ] }, { "title": "The highways and byways of mRNA decay.", "journal": "Nature reviews. Molecular cell biology", "date": "2007", "authors": "Garneau NL, Wilusz J, Wilusz CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "17245413", "url": "https://glygen.org/publication/PubMed/17245413" } ] }, { "title": "ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" }, { "database": "iPTMnet", "id": "O95628", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95628" } ], "reference": [ { "type": "PubMed", "id": "17525332", "url": "https://glygen.org/publication/PubMed/17525332" } ] }, { "title": "Poly(A) nuclease interacts with the C-terminal domain of polyadenylate-binding protein domain from poly(A)-binding protein.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Siddiqui N, Mangus DA, Chang TC, Palermino JM, Shyu AB, Gehring K", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "17595167", "url": "https://glygen.org/publication/PubMed/17595167" } ] }, { "title": "The BTG2 protein is a general activator of mRNA deadenylation.", "journal": "The EMBO journal", "date": "2008", "authors": "Mauxion F, Faux C, Seraphin B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "18337750", "url": "https://glygen.org/publication/PubMed/18337750" } ] }, { "title": "Deadenylation is prerequisite for P-body formation and mRNA decay in mammalian cells.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Zheng D, Ezzeddine N, Chen CY, Zhu W, He X, Shyu AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "18625844", "url": "https://glygen.org/publication/PubMed/18625844" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" }, { "database": "iPTMnet", "id": "O95628", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95628" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "The many pathways of RNA degradation.", "journal": "Cell", "date": "2009", "authors": "Houseley J, Tollervey D", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "19239894", "url": "https://glygen.org/publication/PubMed/19239894" } ] }, { "title": "Structural basis for the antiproliferative activity of the Tob-hCaf1 complex.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Horiuchi M, Takeuchi K, Noda N, Muroya N, Suzuki T, Nakamura T, Kawamura-Tsuzuku J, Takahasi K, Yamamoto T, Inagaki F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "19276069", "url": "https://glygen.org/publication/PubMed/19276069" } ] }, { "title": "Human Ccr4-Not complexes contain variable deadenylase subunits.", "journal": "The Biochemical journal", "date": "2009", "authors": "Lau NC, Kolkman A, van Schaik FM, Mulder KW, Pijnappel WW, Heck AJ, Timmers HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "19558367", "url": "https://glygen.org/publication/PubMed/19558367" } ] }, { "title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.", "journal": "Science signaling", "date": "2009", "authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" }, { "database": "iPTMnet", "id": "O95628", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95628" } ], "reference": [ { "type": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" }, { "database": "iPTMnet", "id": "O95628", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95628" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Polo-like kinase 2-dependent phosphorylation of NPM/B23 on serine 4 triggers centriole duplication.", "journal": "PloS one", "date": "2010", "authors": "Krause A, Hoffmann I", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "20352051", "url": "https://glygen.org/publication/PubMed/20352051" } ] }, { "title": "PLK2 phosphorylation is critical for CPAP function in procentriole formation during the centrosome cycle.", "journal": "The EMBO journal", "date": "2010", "authors": "Chang J, Cizmecioglu O, Hoffmann I, Rhee K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "20531387", "url": "https://glygen.org/publication/PubMed/20531387" } ] }, { "title": "Not4 enhances JAK/STAT pathway-dependent gene expression in Drosophila and in human cells.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2012-03", "authors": "Gr\u00f6nholm Juha, Kaustio Meri, Myllym\u00e4ki Henna, Kallio Jenni, Saarikettu Juha, Kronhamn Jesper, Valanne Susanna, Silvennoinen Olli, R\u00e4met Mika", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" } ], "reference": [ { "type": "PubMed", "id": "22159038", "url": "https://glygen.org/publication/PubMed/22159038" } ] }, { "title": "Evidence providing new insights into TOB-promoted deadenylation and supporting a link between TOB's deadenylation-enhancing and antiproliferative activities.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Ezzeddine N, Chen CY, Shyu AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "22252318", "url": "https://glygen.org/publication/PubMed/22252318" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" }, { "database": "iPTMnet", "id": "O95628", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95628" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "The anti-proliferative activity of BTG/TOB proteins is mediated via the Caf1a (CNOT7) and Caf1b (CNOT8) deadenylase subunits of the Ccr4-not complex.", "journal": "PloS one", "date": "2012", "authors": "Doidge R, Mittal S, Aslam A, Winkler GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "23236473", "url": "https://glygen.org/publication/PubMed/23236473" } ] }, { "title": "Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Guo A, Gu H, Zhou J, Mulhern D, Wang Y, Lee KA, Yang V, Aguiar M, Kornhauser J, Jia X, Ren J, Beausoleil SA, Silva JC, Vemulapalli V, Bedford MT, Comb MJ", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" } ], "reference": [ { "type": "PubMed", "id": "24129315", "url": "https://glygen.org/publication/PubMed/24129315" } ] }, { "title": "Uridylation by TUT4 and TUT7 marks mRNA for degradation.", "journal": "Cell", "date": "2014", "authors": "Lim J, Ha M, Chang H, Kwon SC, Simanshu DK, Patel DJ, Kim VN", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "25480299", "url": "https://glygen.org/publication/PubMed/25480299" } ] }, { "title": "Cross-talk between PRMT1-mediated methylation and ubiquitylation on RBM15 controls RNA splicing.", "journal": "eLife", "date": "2015", "authors": "Zhang L, Tran NT, Su H, Wang R, Lu Y, Tang H, Aoyagi S, Guo A, Khodadadi-Jamayran A, Zhou D, Qian K, Hricik T, Cote J, Han X, Zhou W, Laha S, Abdel-Wahab O, Levine RL, Raffel G, Liu Y, Chen D, Li H, Townes T, Wang H, Deng H, Zheng YG, Leslie C, Luo M, Zhao X", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" } ], "reference": [ { "type": "PubMed", "id": "26575292", "url": "https://glygen.org/publication/PubMed/26575292" } ] }, { "title": "Quantitative proteomics identifies altered O-GlcNAcylation of structural, synaptic and memory-associated proteins in Alzheimer's disease.", "journal": "The Journal of pathology", "date": "2017", "authors": "Wang S, Yang F, Petyuk VA, Shukla AK, Monroe ME, Gritsenko MA, Rodland KD, Smith RD, Qian WJ, Gong CX, Liu T", "evidence": [ { "database": "O-GlcNAc Database", "id": "O95628", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95628" } ], "reference": [ { "type": "PubMed", "id": "28657654", "url": "https://glygen.org/publication/PubMed/28657654" } ] }, { "title": "Artificial Cysteine S-Glycosylation Induced by Per-O-Acetylated Unnatural Monosaccharides during Metabolic Glycan Labeling.", "journal": "Angewandte Chemie (International ed. in English)", "date": "2018", "authors": "Qin W, Qin K, Fan X, Peng L, Hong W, Zhu Y, Lv P, Du Y, Huang R, Han M, Cheng B, Liu Y, Zhou W, Wang C, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "O95628", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95628" } ], "reference": [ { "type": "PubMed", "id": "29237092", "url": "https://glygen.org/publication/PubMed/29237092" } ] }, { "title": "Mapping and Quantification of Over 2000 O-linked Glycopeptides in Activated Human T Cells with Isotope-Targeted Glycoproteomics (Isotag).", "journal": "Molecular & cellular proteomics : MCP", "date": "2018", "authors": "Woo CM, Lund PJ, Huang AC, Davis MM, Bertozzi CR, Pitteri SJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "O95628", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95628" }, { "database": "O-GlcNAc Atlas", "id": "O95628", "url": "https://oglcnac.org/atlas/detail/O95628" }, { "database": "GlyGen", "id": "GLY_000142", "url": "https://data.glygen.org/GLY_000142" } ], "reference": [ { "type": "PubMed", "id": "29351928", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "title": "Ubiquitination of ABCE1 by NOT4 in Response to Mitochondrial Damage Links Co-translational Quality Control to PINK1-Directed Mitophagy.", "journal": "Cell metabolism", "date": "2018", "authors": "Wu Z, Wang Y, Lim J, Liu B, Li Y, Vartak R, Stankiewicz T, Montgomery S, Lu B", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" } ], "reference": [ { "type": "PubMed", "id": "29861391", "url": "https://glygen.org/publication/PubMed/29861391" } ] }, { "title": "Quantitative Profiling of Protein O-GlcNAcylation Sites by an Isotope-Tagged Cleavable Linker.", "journal": "ACS chemical biology", "date": "2018", "authors": "Qin K, Zhu Y, Qin W, Gao J, Shao X, Wang YL, Zhou W, Wang C, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "O95628", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95628" }, { "database": "O-GlcNAc Atlas", "id": "O95628", "url": "https://oglcnac.org/atlas/detail/O95628" } ], "reference": [ { "type": "PubMed", "id": "30059200", "url": "https://glygen.org/publication/PubMed/30059200" } ] }, { "title": "A triarylphosphine-trimethylpiperidine reagent for the one-step derivatization and enrichment of protein post-translational modifications and identification by mass spectrometry.", "journal": "Chemical communications (Cambridge, England)", "date": "2018", "authors": "Huo B, Zhang W, Zhao X, Dong H, Yu Y, Wang J, Qian X, Qin W", "evidence": [ { "database": "O-GlcNAc Database", "id": "O95628", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95628" }, { "database": "O-GlcNAc Atlas", "id": "O95628", "url": "https://oglcnac.org/atlas/detail/O95628" } ], "reference": [ { "type": "PubMed", "id": "30379171", "url": "https://glygen.org/publication/PubMed/30379171" } ] }, { "title": "An Isotope-Coded Photocleavable Probe for Quantitative Profiling of Protein O-GlcNAcylation.", "journal": "ACS chemical biology", "date": "2019", "authors": "Li J, Li Z, Duan X, Qin K, Dang L, Sun S, Cai L, Hsieh-Wilson LC, Wu L, Yi W", "evidence": [ { "database": "O-GlcNAc Database", "id": "O95628", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95628" }, { "database": "O-GlcNAc Atlas", "id": "O95628", "url": "https://oglcnac.org/atlas/detail/O95628" } ], "reference": [ { "type": "PubMed", "id": "30620550", "url": "https://glygen.org/publication/PubMed/30620550" } ] }, { "title": "Aspartate Residues Far from the Active Site Drive O-GlcNAc Transferase Substrate Selection.", "journal": "Journal of the American Chemical Society", "date": "2019", "authors": "Joiner CM, Levine ZG, Aonbangkhen C, Woo CM, Walker S", "evidence": [ { "database": "O-GlcNAc Database", "id": "O95628", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95628" }, { "database": "O-GlcNAc Atlas", "id": "O95628", "url": "https://oglcnac.org/atlas/detail/O95628" } ], "reference": [ { "type": "PubMed", "id": "31373491", "url": "https://glygen.org/publication/PubMed/31373491" } ] }, { "title": "Next-generation unnatural monosaccharides reveal that ESRRB O-GlcNAcylation regulates pluripotency of mouse embryonic stem cells.", "journal": "Nature communications", "date": "2019", "authors": "Hao Y, Fan X, Shi Y, Zhang C, Sun DE, Qin K, Qin W, Zhou W, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "O95628", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95628" }, { "database": "O-GlcNAc Atlas", "id": "O95628", "url": "https://oglcnac.org/atlas/detail/O95628" } ], "reference": [ { "type": "PubMed", "id": "31492838", "url": "https://glygen.org/publication/PubMed/31492838" } ] }, { "title": "Homozygous Mutations in BTG4 Cause Zygotic Cleavage Failure and Female Infertility.", "journal": "American journal of human genetics", "date": "2020", "authors": "Zheng W, Zhou Z, Sha Q, Niu X, Sun X, Shi J, Zhao L, Zhang S, Dai J, Cai S, Meng F, Hu L, Gong F, Li X, Fu J, Shi R, Lu G, Chen B, Fan H, Wang L, Lin G, Sang Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-9820841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9820841" } ], "reference": [ { "type": "PubMed", "id": "32502391", "url": "https://glygen.org/publication/PubMed/32502391" } ] }, { "title": "A Chemoenzymatic Method Based on Easily Accessible Enzymes for Profiling Protein O-GlcNAcylation.", "journal": "Analytical chemistry", "date": "2020", "authors": "Xu S, Sun F, Wu R", "evidence": [ { "database": "O-GlcNAc Database", "id": "O95628", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95628" }, { "database": "O-GlcNAc Atlas", "id": "O95628", "url": "https://oglcnac.org/atlas/detail/O95628" } ], "reference": [ { "type": "PubMed", "id": "32574038", "url": "https://glygen.org/publication/PubMed/32574038" } ] }, { "title": "Methods for Enrichment and Assignment of N-Acetylglucosamine Modification Sites.", "journal": "Molecular & cellular proteomics : MCP", "date": "2021", "authors": "Maynard JC, Chalkley RJ", "evidence": [ { "database": "O-GlcNAc Atlas", "id": "O95628", "url": "https://oglcnac.org/atlas/detail/O95628" } ], "reference": [ { "type": "PubMed", "id": "32938750", "url": "https://glygen.org/publication/PubMed/32938750" } ] }, { "title": "CNOT4 enhances the efficacy of anti-PD-1 immunotherapy in a model of non-small cell lung cancer.", "journal": "FEBS open bio", "date": "2020", "authors": "Zhang B, Han S, Ma H, Chen S", "evidence": [ { "database": "RefSeq", "id": "NP_001008226", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008226" } ], "reference": [ { "type": "PubMed", "id": "33034149", "url": "https://glygen.org/publication/PubMed/33034149" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "O95628", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95628" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "The Interplay between HGF/c-met Axis and Nox4 in BRAF Mutated Melanoma.", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Beretti F, Farnetani F, Reggiani Bonetti L, Fabbiani L, Zavatti M, Maiorana A, Pellacani G, Maraldi T", "evidence": [ { "database": "RefSeq", "id": "NP_001008226", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008226" } ], "reference": [ { "type": "PubMed", "id": "33451139", "url": "https://glygen.org/publication/PubMed/33451139" } ] }, { "title": "CNOT4 suppresses non-small cell lung cancer progression and is required for effector cytolytic T lymphocytes cell responses to lung cancer cells.", "journal": "Molecular immunology", "date": "2021", "authors": "Zhang B, Chen S", "evidence": [ { "database": "RefSeq", "id": "NP_001008226", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008226" } ], "reference": [ { "type": "PubMed", "id": "33592572", "url": "https://glygen.org/publication/PubMed/33592572" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "O95628", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95628" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "Aberrant expression of MYD88 via RNA-controlling CNOT4 and EXOSC3 in colonic mucosa impacts generation of colonic cancer.", "journal": "Cancer science", "date": "2021", "authors": "Tsuda M, Noguchi M, Kurai T, Ichihashi Y, Ise K, Wang L, Ishida Y, Tanino M, Hirano S, Asaka M, Tanaka S", "evidence": [ { "database": "RefSeq", "id": "NP_001008226", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008226" } ], "reference": [ { "type": "PubMed", "id": "34626022", "url": "https://glygen.org/publication/PubMed/34626022" } ] }, { "title": "A novel homozygous missense variant in BTG4 causes zygotic cleavage failure and female infertility.", "journal": "Journal of assisted reproduction and genetics", "date": "2021", "authors": "Liu R, Zhou Y, Li Q, Chen B, Zhou Z, Wang L, Wang L, Sang Q, Jin L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9820841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9820841" } ], "reference": [ { "type": "PubMed", "id": "34647228", "url": "https://glygen.org/publication/PubMed/34647228" } ] }, { "title": "Highly Efficient Enrichment of O-GlcNAc Glycopeptides Based on Chemical Oxidation and Reversible Hydrazide Chemistry.", "journal": "Analytical chemistry", "date": "2021", "authors": "Chen Y, Qin H, Yue X, Zhou J, Liu L, Nie Y, Ye M", "evidence": [ { "database": "O-GlcNAc Atlas", "id": "O95628", "url": "https://oglcnac.org/atlas/detail/O95628" } ], "reference": [ { "type": "PubMed", "id": "34846842", "url": "https://glygen.org/publication/PubMed/34846842" } ] }, { "title": "Simultaneously Identifying and Distinguishing Glycoproteins with O-GlcNAc and O-GalNAc (the Tn Antigen) in Human Cancer Cells.", "journal": "Analytical chemistry", "date": "2022", "authors": "Xu S, Zheng J, Xiao H, Wu R", "evidence": [ { "database": "O-GlcNAc Database", "id": "O95628", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95628" } ], "reference": [ { "type": "PubMed", "id": "35132862", "url": "https://glygen.org/publication/PubMed/35132862" } ] }, { "title": "An Optimized Isotopic Photocleavable Tagging Strategy for Site-Specific and Quantitative Profiling of Protein O-GlcNAcylation in Colorectal Cancer Metastasis.", "journal": "ACS chemical biology", "date": "2022", "authors": "Liu J, Hao Y, Wang C, Jin Y, Yang Y, Gu J, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "O95628", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95628" } ], "reference": [ { "type": "PubMed", "id": "35254053", "url": "https://glygen.org/publication/PubMed/35254053" } ] }, { "title": "Endo-M Mediated Chemoenzymatic Approach Enables Reversible Glycopeptide Labeling for O-GlcNAcylation Analysis.", "journal": "Angewandte Chemie (International ed. in English)", "date": "2022", "authors": "Chen Y, Tang F, Qin H, Yue X, Nie Y, Huang W, Ye M", "evidence": [ { "database": "O-GlcNAc Database", "id": "O95628", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95628" } ], "reference": [ { "type": "PubMed", "id": "35289036", "url": "https://glygen.org/publication/PubMed/35289036" } ] }, { "title": "CNOT4 suppresses nonsmall cell lung cancer progression by promoting the degradation of PAF1.", "journal": "Molecular carcinogenesis", "date": "2023-10", "authors": "Zhang Biao, Zhao Bin, Han Song, Chen Shaomu", "evidence": [ { "database": "RefSeq", "id": "NP_001008226", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008226" } ], "reference": [ { "type": "PubMed", "id": "37493105", "url": "https://glygen.org/publication/PubMed/37493105" } ] }, { "title": "Identification of BTG2, an antiproliferative p53-dependent component of the DNA damage cellular response pathway.", "journal": "Nature genetics", "date": "1996", "authors": "Rouault JP, Falette N, Guehenneux F, Guillot C, Rimokh R, Wang Q, Berthet C, Moyret-Lalle C, Savatier P, Pain B, Shaw P, Berger R, Samarut J, Magaud JP, Ozturk M, Samarut C, Puisieux A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "8944033", "url": "https://glygen.org/publication/PubMed/8944033" } ] }, { "title": "Poly(A) tail shortening by a mammalian poly(A)-specific 3'-exoribonuclease.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Korner CG, Wahle E", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "9099687", "url": "https://glygen.org/publication/PubMed/9099687" } ] }, { "title": "Regulation of apoptosis and cell cycle arrest by Zac1, a novel zinc finger protein expressed in the pituitary gland and the brain.", "journal": "The EMBO journal", "date": "1997", "authors": "Spengler D, Villalba M, Hoffmann A, Pantaloni C, Houssami S, Bockaert J, Journot L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "9184226", "url": "https://glygen.org/publication/PubMed/9184226" } ] }, { "title": "hZAC encodes a zinc finger protein with antiproliferative properties and maps to a chromosomal region frequently lost in cancer.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Varrault A, Ciani E, Apiou F, Bilanges B, Hoffmann A, Pantaloni C, Bockaert J, Spengler D, Journot L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "9671765", "url": "https://glygen.org/publication/PubMed/9671765" } ] }, { "title": "Interaction of BTG1 and p53-regulated BTG2 gene products with mCaf1, the murine homolog of a component of the yeast CCR4 transcriptional regulatory complex.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Rouault JP, Prevot D, Berthet C, Birot AM, Billaud M, Magaud JP, Corbo L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "9712883", "url": "https://glygen.org/publication/PubMed/9712883" } ] } ], "pathway": [ { "id": "R-HSA-429947", "name": "Deadenylation of mRNA", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947", "resource": "Reactome", "description": "Deadenylation of mRNA" }, { "id": "R-HSA-6804115", "name": "TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115", "resource": "Reactome", "description": "TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain" }, { "id": "R-HSA-9820841", "name": "M-decay: degradation of maternal mRNAs by maternally stored factors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9820841", "resource": "Reactome", "description": "M-decay: degradation of maternal mRNAs by maternally stored factors" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A8I5ZNZ5-1", "protein_name": "CCR4-NOT transcription complex, subunit 4", "gene_name": "Cnot4", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPLSQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYFLKNMQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQRYDVPIDKPSDSLSIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSGLPPFPSSPQTPSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSSTSLQNSSSHTTSAKGPGSGFLHPAAPANANSLNSTFSVLPQRFPQFQQHRAVYNSFGFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPIAGEEEVKVSTMPLSASSHSLQQGQQPTSLHTTVA", "length": 575 }, "evidence": [ { "id": "45931412", "url": "http://www.informatics.jax.org/homology/45931412", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q8BT14-1", "protein_name": "CCR4-NOT transcription complex subunit 4", "gene_name": "Cnot4", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPLSQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYFLKNMQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQRYDTPIDKPSDSLSIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSGLPPFPSSPQTPSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNASSHTTTAKGPGSGFLHSAAPTNANSLNSTFSVLPQRFPQFQQHRAVYNSFGFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPIAGEEEVKVSTMPLSASSHSLQQGQQPTSLHTTVA", "length": 575 }, "evidence": [ { "id": "45931412", "url": "http://www.informatics.jax.org/homology/45931412", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" } ], "pmid": "" }, { "name": "ubiquitin-protein transferase activity", "id": "GO:0004842", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004842", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" } ], "pmid": "" }, { "name": "CCR4-NOT complex", "id": "GO:0030014", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030014", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "protein ubiquitination", "id": "GO:0016567", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016567", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" } ], "pmid": "" }, { "name": "regulation of megakaryocyte differentiation", "id": "GO:0045652", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045652", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" } ], "pmid": "" }, { "name": "ubiquitin-dependent protein catabolic process", "id": "GO:0006511", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006511", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" } ], "pmid": "" }, { "name": "protein autoubiquitination", "id": "GO:0051865", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051865", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" } ], "pmid": "" }, { "name": "nuclear-transcribed mRNA poly(A) tail shortening", "id": "GO:0000289", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000289", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 144, "end_pos": 146, "annotation": "n_glycosylation_sequon" }, { "start_pos": 145, "end_pos": 147, "annotation": "n_glycosylation_sequon" }, { "start_pos": 319, "end_pos": 321, "annotation": "n_glycosylation_sequon" }, { "start_pos": 438, "end_pos": 440, "annotation": "n_glycosylation_sequon" }, { "start_pos": 466, "end_pos": 468, "annotation": "n_glycosylation_sequon" }, { "start_pos": 512, "end_pos": 514, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Autoubiquitinated.", "evidence": [ { "database": "UniProtKB", "id": "O95628", "url": "https://www.uniprot.org/uniprot/O95628" }, { "database": "PubMed", "id": "15001359", "url": "https://glygen.org/publication/PubMed/15001359" }, { "database": "PubMed", "id": "11823428", "url": "https://glygen.org/publication/PubMed/11823428" } ] } ], "interactions": [], "reactions": [ { "id": "R-HSA-429955", "name": "CCR4-NOT complex deadenylates mRNA", "equation": "", "summary": "The CCR4-NOT complex hydrolyzes adenosine residues at the 3' end of polyadenylated mRNA, shortening the number of adenosine residues to about 10-15 residues and yielding adenosine 5'-monophosphate. CNOT6 and CNOT6L are the exoribonucleases responsible for hydrolysis. Activity of the CCR4-NOT complex is inhibited by PABP bound to the poly(A) tail of the mRNA. The trigger for activation of deadenylation by the CCR4-NOT complex is unknown. Complexes containing CNOT7 rather than CNOT8 appear to be responsible for cytoplasmic mRNA decay.", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [ "R-HSA-429861" ], "enzyme_list": [ "P60842-1", "Q9UIV1-1", "Q14240-1", "P38919-1", "Q96LI5-1", "Q9ULM6-1", "O95628-1", "Q9UFF9-1" ], "evidence": [ { "id": "R-HSA-429955", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429955" } ] }, { "id": "R-HSA-6798044", "name": "BTG2 binds CCR4-NOT complex", "equation": "", "summary": "BTG2, through its conserved BTG domain, binds catalytic subunits CNOT7 and CNOT8 of the CCR4-NOT complex and promotes mRNA deadenylation activity of the CCR4-NOT (Rouault et al. 1998, Mauxion et al. 2008, Doidge et al. 2012). The interaction with the CCR4-NOT is needed for the antiproliferative activity of BTG2 (Horiuchi et al. 2009, Doidge et al. 2012, Ezzeddine et al. 2012).", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9UIV1-1", "Q96LI5-1", "Q9ULM6-1", "O95628-1", "Q9UFF9-1" ], "evidence": [ { "id": "R-HSA-6798044", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798044" } ] }, { "id": "R-HSA-9817692", "name": "BTG4 binds CNOT7 of the CCR4-NOT complex, PABPN1L, and eIF4E of the mRNP", "equation": "", "summary": "BTG4 binds eIF4E of the mRNA-protein complex (mRNP) and CNOT7 (CAF1) and CNOT8 of the CCR4-NOT RNA deadenylase complex, thereby connecting maternal mRNPs with mRNA degradation (inferred from mouse homologs). The polyadenylate binding protein PABPN1L also mediates binding of BTG4 to mRNA (inferred from mouse homologs). In mouse oocytes lacking BTG4, shortening of mRNA polyadenylate tails, an initial step in mRNA degradation, is impaired and Btg4 KO embryos arrested at the 1-2 cell stage (Yu et al. 2016, Liu et al., 2016, Pasternak et al. 2016). Upon Btg4 siRNA knockdown, mouse oocytes precociously enter anaphase II (Pasternak et al. 2016). Of note, global deadenylation can still occur in mouse oocytes mutant for Btg4 mutant oocytes. However, BTG4 is required for selective gene de-adenylation and production of very short-tailed transcripts in mice (Xiong et al. 2022).", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P60842-1", "Q9UIV1-1", "Q14240-1", "P38919-1", "Q96LI5-1", "Q9ULM6-1", "O95628-1" ], "evidence": [ { "id": "R-HSA-9817692", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9817692" } ] }, { "id": "R-HSA-9819200", "name": "ZFP36L2 binds CNOT6L of CCR4-CNOT complex and an AU-rich element in mRNA", "equation": "", "summary": "In maturing oocytes ZFP36L2 binds AU-rich elements in specific maternal mRNAs and also CNOT6L, a catalytic component of the CCR4-NOT RNA deadenylase complex (inferred from mouse homologs). Knockout of CNOT6L prevents degradation of maternal transcripts related to translation in maturing oocytes (inferred from mouse oocytes). Depletion or knockout of ZFP36L2 causes defects in oocyte maturation (inferred from mouse oocytes) and prevents degradation of maternal mRNAs related to histone demethylation and regulation of transcription (inferred from mouse homologs), therefore ZFP36L2 is believed to regulate degradation of specific mRNAs in oocytes.", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9UIV1-1", "Q96LI5-1", "O95628-1", "Q9UFF9-1" ], "evidence": [ { "id": "R-HSA-9819200", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9819200" } ] }, { "id": "R-HSA-9822311", "name": "CCR4-NOT deadenylates mRNA in CCR4-NOT:BTG4:PABPN1L:mRNP", "equation": "", "summary": "BTG4 bound to PABPN1L and eIF4E of the mRNP recruits the CCR4-NOT complex via an interaction between BTG4 and CNOT7 of the CCR4-NOT complex (inferred from mouse homologs). CNOT7 then deadenylates the mRNA, targeting the mRNA for degradation (inferred from mouse homologs).", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P60842-1", "Q9UIV1-1", "Q14240-1", "P38919-1", "Q96LI5-1", "Q9ULM6-1", "O95628-1" ], "evidence": [ { "id": "R-HSA-9822311", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9822311" } ] }, { "id": "R-HSA-9822335", "name": "CCR4-NOT(CNOT6L) deadenylates mRNA in CCR4-NOT(CNOT6L):ZFP36L2:mRNA", "equation": "", "summary": "ZFP36L2 bound to AU-rich elements of specific mRNAs recruits the CCR4-NOT complex via an interaction between ZFP36L2 and CNOT6L of the CCR4-NOT complex (inferred from mouse homologs). CNOT6L then deadenylates the mRNA, targeting the mRNA for degradation (inferred from mouse homologs).", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9UIV1-1", "Q96LI5-1", "O95628-1", "Q9UFF9-1" ], "evidence": [ { "id": "R-HSA-9822335", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9822335" } ] } ], "reaction_participants": [ { "participant_id": "R-HSA-429861", "participant_name": "PAIP1 [cytosol]", "crossref": [ { "id": "Q9H074", "database": "GeneCards", "url": "" }, { "id": "ENSP00000339622", "database": "Ensembl", "url": "" }, { "id": "6YXJ", "database": "PDB", "url": "" }, { "id": "1JH4", "database": "PDB", "url": "" }, { "id": "XP_005248287.1", "database": "RefSeq", "url": "" }, { "id": "NP_006442.2", "database": "RefSeq", "url": "" }, { "id": "ENST00000306846", "database": "Ensembl", "url": "" }, { "id": "Q9H074", "database": "PRO", "url": "" }, { "id": "NP_899152.1", "database": "RefSeq", "url": "" }, { "id": "XP_016864445.1", "database": "RefSeq", "url": "" }, { "id": "3RK6", "database": "PDB", "url": "" }, { "id": "Q9H074", "database": "Pharos - Targets", "url": "" }, { "id": "ENST00000338972", "database": "Ensembl", "url": "" }, { "id": "3NTW", "database": "PDB", "url": "" }, { "id": "NP_877590.1", "database": "RefSeq", "url": "" }, { "id": "ENST00000436644", "database": "Ensembl", "url": "" }, { "id": "Q9H074", "database": "UniProt", "url": "" }, { "id": "ENSP00000302768", "database": "Ensembl", "url": "" }, { "id": "ENSP00000387729", "database": "Ensembl", "url": "" }, { "id": "ENSG00000172239-PAIP1", "database": "HPA", "url": "" }, { "id": "ENSG00000172239", "database": "Ensembl", "url": "" }, { "id": "ENSG00000172239", "database": "OpenTargets", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "O95628", "gene_name": "CNOT4", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "O95628", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95628" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "O95628", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95628" } ] } ] }, { "uniprot_ac": "P38919", "gene_name": "EIF4A3", "activity": [ { "ec_number": "3.6.4.13", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "P38919", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38919" } ] }, { "ec_number": "3.6.4.13", "activity": "", "evidence": [ { "id": "P38919", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38919" } ] } ] }, { "uniprot_ac": "P60842", "gene_name": "EIF4A1", "activity": [ { "ec_number": "3.6.4.13", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "P60842", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60842" } ] }, { "ec_number": "3.6.4.13", "activity": "", "evidence": [ { "id": "P60842", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60842" } ] } ] }, { "uniprot_ac": "Q14240", "gene_name": "EIF4A2", "activity": [ { "ec_number": "3.6.4.13", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "Q14240", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14240" } ] }, { "ec_number": "3.6.4.13", "activity": "", "evidence": [ { "id": "Q14240", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14240" } ] } ] }, { "uniprot_ac": "Q96LI5", "gene_name": "CNOT6L", "activity": [ { "ec_number": "3.1.13.4", "activity": "Exonucleolytic cleavage of poly(A) to 5'-AMP.", "evidence": [ { "id": "Q96LI5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96LI5" } ] }, { "ec_number": "3.1.13.4", "activity": "", "evidence": [ { "id": "Q96LI5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96LI5" } ] } ] }, { "uniprot_ac": "Q9UFF9", "gene_name": "CNOT8", "activity": [ { "ec_number": "3.1.13.4", "activity": "Exonucleolytic cleavage of poly(A) to 5'-AMP.", "evidence": [ { "id": "Q9UFF9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UFF9" } ] }, { "ec_number": "3.1.13.4", "activity": "", "evidence": [ { "id": "Q9UFF9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UFF9" } ] } ] }, { "uniprot_ac": "Q9UIV1", "gene_name": "CNOT7", "activity": [ { "ec_number": "3.1.13.4", "activity": "Exonucleolytic cleavage of poly(A) to 5'-AMP.", "evidence": [ { "id": "Q9UIV1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UIV1" } ] }, { "ec_number": "3.1.13.4", "activity": "", "evidence": [ { "id": "Q9UIV1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UIV1" } ] } ] }, { "uniprot_ac": "Q9ULM6", "gene_name": "CNOT6", "activity": [ { "ec_number": "3.1.13.4", "activity": "Exonucleolytic cleavage of poly(A) to 5'-AMP.", "evidence": [ { "id": "Q9ULM6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ULM6" } ] }, { "ec_number": "3.1.13.4", "activity": "", "evidence": [ { "id": "Q9ULM6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ULM6" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 309, 316, 317, 318, 321, 324, 331, 335, 375, 396, 435 ], "snv_sites": [ 317, 331, 375, 409, 463, 548 ], "glycation_sites": [], "phosphorylation_sites": [ 71, 301, 324, 432, 490 ], "sequon_annotation_sites": [ { "start_pos": 144, "end_pos": 146 }, { "start_pos": 145, "end_pos": 147 }, { "start_pos": 319, "end_pos": 321 }, { "start_pos": 438, "end_pos": 440 }, { "start_pos": 466, "end_pos": 468 }, { "start_pos": 512, "end_pos": 514 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 12 }, { "field": "total_sites", "count": 11 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 11 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 12 }, { "field": "total_sites", "count": 11 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 11 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 72 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }