{ "uniprot_canonical_ac": "O95470-1", "uniprot_ac": "O95470", "uniprot_id": "SGPL1_HUMAN", "mass": { "chemical_mass": 63524.0, "monoisotopic_mass": 63524.0 }, "refseq": { "ac": "NP_003892", "name": "sphingosine-1-phosphate lyase 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003892" }, "gene_names": [ { "name": "SGPL1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O95470", "id": "O95470" }, { "name": "KIAA1252", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O95470", "id": "O95470" }, { "name": "NPHS14; RENI; S1PL; SPL", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003892", "id": "NP_003892" }, { "name": "SGPL1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003892", "id": "NP_003892" } ], "protein_names": [ { "name": "Sphingosine-1-phosphate lyase 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O95470" }, { "name": "4.1.2.27", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95470" }, { "name": "S1PL", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95470" }, { "name": "SP-lyase 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95470" }, { "name": "SPL 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95470" }, { "name": "Sphingosine-1-phosphate aldolase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95470" }, { "name": "hSPL; SPL 1; SP-lyase 1; sphingosine-1-phosphate aldolase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003892", "id": "NP_003892" }, { "name": "hSPL", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95470" }, { "name": "sphingosine-1-phosphate lyase 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003892", "id": "NP_003892" } ], "function": [ { "annotation": "A rare cause of nephrotic syndrome-sphingosine-1-phosphate lyase (SGPL1) deficiency: 6 cases and a review of the literature. Review article", "evidence": [ { "database": "RefSeq", "id": "NP_003892", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003892" }, { "database": "PubMed", "id": "35748945", "url": "https://glygen.org/publication/PubMed/35748945" } ] }, { "annotation": "Cleaves phosphorylated sphingoid bases (PSBs), such as sphingosine-1-phosphate, into fatty aldehydes and phosphoethanolamine. Elevates stress-induced ceramide production and apoptosis (PubMed:11018465, PubMed:14570870, PubMed:24809814, PubMed:28165339). Required for global lipid homeostasis in liver and cholesterol homeostasis in fibroblasts. Involved in the regulation of pro-inflammatory response and neutrophil trafficking. Modulates neuronal autophagy via phosphoethanolamine production which regulates accumulation of aggregate-prone proteins such as APP (By similarity). Seems to play a role in establishing neuronal contact sites and axonal maintenance (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470#function" }, { "database": "PubMed", "id": "24809814", "url": "https://glygen.org/publication/PubMed/24809814" }, { "database": "PubMed", "id": "28165339", "url": "https://glygen.org/publication/PubMed/28165339" }, { "database": "PubMed", "id": "14570870", "url": "https://glygen.org/publication/PubMed/14570870" }, { "database": "PubMed", "id": "11018465", "url": "https://glygen.org/publication/PubMed/11018465" }, { "database": "UniProtKB", "id": "Q9V7Y2", "url": "https://www.uniprot.org/uniprot/Q9V7Y2#function" }, { "database": "UniProtKB", "id": "Q8R0X7", "url": "https://www.uniprot.org/uniprot/Q8R0X7#function" } ] }, { "annotation": "Influenza A virus NS1 induces degradation of sphingosine 1-phosphate lyase to obstruct the host innate immune response.", "evidence": [ { "database": "RefSeq", "id": "NP_003892", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003892" }, { "database": "PubMed", "id": "33730651", "url": "https://glygen.org/publication/PubMed/33730651" } ] }, { "annotation": "Loss of S1P Lyase Expression in Human Podocytes Causes a Reduction in Nephrin Expression That Involves PKCdelta Activation. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_003892", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003892" }, { "database": "PubMed", "id": "36834691", "url": "https://glygen.org/publication/PubMed/36834691" } ] }, { "annotation": "S1P Lyase Regulates Intestinal Stem Cell Quiescence via Ki-67 and FOXO3. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_003892", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003892" }, { "database": "PubMed", "id": "34073605", "url": "https://glygen.org/publication/PubMed/34073605" } ] }, { "annotation": "SGPL1 Deficiency: Nephrotic Syndrome with Lymphopenia.", "evidence": [ { "database": "RefSeq", "id": "NP_003892", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003892" }, { "database": "PubMed", "id": "36050428", "url": "https://glygen.org/publication/PubMed/36050428" } ] }, { "annotation": "Sphingosine-1-phosphate lyase is a dual modulator of sphingosine 1-phosphate and ceramide metabolism as well as a regulator of cell fate decisions", "evidence": [ { "database": "RefSeq", "id": "NP_003892", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003892" }, { "database": "PubMed", "id": "14570870", "url": "https://glygen.org/publication/PubMed/14570870" } ] } ], "disease": [ { "disease_id": "DOID:0080265", "recommended_name": { "id": "DOID:0080265", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080265", "name": "nephrotic syndrome type 14", "description": "A familial nephrotic syndrome that has_material_basis_in autosomal recessive inheritance of homozygous or compound heterozygous mutation in the sphingosine-1-phosphate lyase 1 (SGPL1) gene on chromosome 10q21." }, "synonyms": [ { "id": "MONDO:0033203", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033203", "name": "nephrotic syndrome 14", "description": "" }, { "id": "MONDO:0033203", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033203", "name": "nephrotic syndrome 14", "description": "" }, { "id": "MONDO:0033203", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033203", "name": "nephrotic syndrome, type 14", "description": "" }, { "id": "MONDO:0033203", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033203", "name": "primary adrenal insufficiency-steroid-resistant nephrotic syndrome due to SGPL1 deficiency", "description": "" }, { "id": "MONDO:0033203", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033203", "name": "NPHS14", "description": "" }, { "id": "MONDO:0033203", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033203", "name": "familial steroid-resistant nephrotic syndrome with adrenal insufficiency", "description": "" }, { "id": "MIM:617575", "resource": "MIM", "url": "https://www.omim.org/entry/617575", "name": "Nephrotic syndrome 14", "description": "Nephrotic syndrome 14" } ], "evidence": [ { "id": "617575", "database": "MIM", "url": "https://www.omim.org/entry/617575" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 132, "end_pos": 132, "sequence_org": "E", "sequence_mut": "G", "comment": "No effect on the sphinganine-1-phosphate aldolase activity; no effect on protein abundance.", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" }, { "database": "PubMed", "id": "28165339", "url": "https://glygen.org/publication/PubMed/28165339" } ] }, { "start_pos": 218, "end_pos": 218, "sequence_org": "C", "sequence_mut": "G", "comment": "Loss of sphinganine-1-phosphate aldolase activity.", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" }, { "database": "PubMed", "id": "11018465", "url": "https://glygen.org/publication/PubMed/11018465" } ] }, { "start_pos": 317, "end_pos": 317, "sequence_org": "C", "sequence_mut": "S", "comment": "Almost no sphinganine-1-phosphate aldolase activity.", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" }, { "database": "PubMed", "id": "11018465", "url": "https://glygen.org/publication/PubMed/11018465" } ] }, { "start_pos": 353, "end_pos": 353, "sequence_org": "K", "sequence_mut": "L", "comment": "Loss of sphinganine-1-phosphate aldolase activity.", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" }, { "database": "PubMed", "id": "14570870", "url": "https://glygen.org/publication/PubMed/14570870" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "84.4", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000166224", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000166224" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "89.31", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000166224", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000166224" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "85.79", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000166224", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000166224" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "70.63", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000166224", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000166224" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "83.33", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000166224", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000166224" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "90.34", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000166224", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000166224" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "80.7", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000166224", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000166224" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "89.38", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000166224", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000166224" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "87.93", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000166224", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000166224" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "76.14", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000166224", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000166224" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "91.59", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000166224", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000166224" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "87.3", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000166224", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000166224" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "85.91", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000166224", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000166224" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O95470", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95470" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O95470", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95470" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O95470", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95470" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O95470", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95470" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O95470", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95470" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O95470", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95470" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O95470", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95470" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O95470", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95470" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O95470", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95470" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O95470", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95470" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O95470", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95470" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O95470", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95470" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "common_name": "Human" } ], "gene": [ { "name": "SGPL1", "url": "https://www.uniprot.org/uniprot/O95470", "locus": { "chromosome": "10", "start_pos": 70895816, "end_pos": 70815905, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000166224", "url": "https://www.ensembl.org/id/ENSG00000166224" } ] } } ], "crossref": [ { "id": "ENSG00000166224", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000166224", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "4.1.2.27", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=4.1.2.27&UniProtAcc=O95470", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd06450", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd06450", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL3286061", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3286061", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "SGPL1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=SGPL1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "8879", "url": "https://www.ncbi.nlm.nih.gov/gene/8879", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "10817", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=10817", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O95470", "url": "https://www.ebi.ac.uk/intact/interactors/id:O95470*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002129", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002129", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015421", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015421", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015422", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015422", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015424", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015424", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:8879", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8879", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "603729", "url": "http://www.omim.org/entry/603729", "database": "MIM", "categories": [ "Other" ] }, { "id": "617575", "url": "http://www.omim.org/entry/617575", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O95470", "url": "https://www.nextprot.org/entry/NX_O95470", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O95470", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95470", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "FKDHQFT", "url": "https://omabrowser.org/oma/group/FKDHQFT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3024111at2759", "url": "http://www.orthodb.org/?query=3024111at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR42735:SF6", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR42735:SF6", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "4Q6R", "url": "https://www.rcsb.org/structure/4Q6R", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8AYF", "url": "https://www.rcsb.org/structure/8AYF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00282", "url": "http://pfam.xfam.org/family/PF00282", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O95470", "url": "https://pharos.nih.gov/targets/O95470", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O95470", "url": "http://purl.obolibrary.org/obo/PR_O95470", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_003892", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003892", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "18593", "url": "https://www.rhea-db.org/rhea/18593", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "33507", "url": "https://www.rhea-db.org/rhea/33507", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A8V8TLB6", "url": "https://www.uniprot.org/uniprot/A0A8V8TLB6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TLB6-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TLB6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TLU3", "url": "https://www.uniprot.org/uniprot/A0A8V8TLU3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TLU3-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TLU3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TLU8", "url": "https://www.uniprot.org/uniprot/A0A8V8TLU8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TLU8-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TLU8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TN35", "url": "https://www.uniprot.org/uniprot/A0A8V8TN35", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TN35-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TN35-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TN38", "url": "https://www.uniprot.org/uniprot/A0A8V8TN38", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TN38-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TN38-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7BXL7", "url": "https://www.uniprot.org/uniprot/H7BXL7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7BXL7-1", "url": "https://www.uniprot.org/uniprot/H7BXL7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95470-1", "url": "https://www.uniprot.org/uniprot/O95470-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPSTDLLMLKAFEPYLEILEVYSTKAKNYVNGHCTKYEPWQLIAWSVVWTLLIVWGYEFVFQPESLWSRFKKKCFKLTRKMPIIGRKIQDKLNKTKDDISKNMSFLKVDKEYVKALPSQGLSSSAVLEKLKEYSSMDAFWQEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSLFNGGPDSCGCVTSGGTESILMACKAYRDLAFEKGIKTPEIVAPQSAHAAFNKAASYFGMKIVRVPLTKMMEVDVRAMRRAISRNTAMLVCSTPQFPHGVIDPVPEVAKLAVKYKIPLHVDACLGGFLIVFMEKAGYPLEHPFDFRVKGVTSISADTHKYGYAPKGSSLVLYSDKKYRNYQFFVDTDWQGGIYASPTIAGSRPGGISAACWAALMHFGENGYVEATKQIIKTARFLKSELENIKGIFVFGNPQLSVIALGSRDFDIYRLSNLMTAKGWNLNQLQFPPSIHFCITLLHARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTTVDRNMVAELSSVFLDSLYSTDTVTQGSQMNGSPKPH", "length": 568, "header": "sp|O95470-1|SGPL1_HUMAN Isoform 1 of Sphingosine-1-phosphate lyase 1 OS=Homo sapiens OX=9606 GN=SGPL1 PE=1 SV=3 CANONICAL=O95470-1" }, "isoforms": [ { "isoform_ac": "A0A8V8TLB6-1", "url": "", "sequence": { "sequence": "MPSTDLLMLKAFEPYLEILEVYSTKAKNYVNGHCTKYEPWQLIAWSVVWTLLIVWGYEFVFQPESLWSRFKKKCFKLTRKMPIIGRKIQDKLNKTKDDISKNMSFLKVDKEYVKALPSQGLSSSAVLEKLKEYSSMDAFWQEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSLFNGGPDSCGCVTSGGTESILMACKAYRDLAFEKGIKTPEIVGRGH", "length": 240, "header": "tr|A0A8V8TLB6-1|A0A8V8TLB6_HUMAN Computationally mapped isoform of Sphingosine-1-phosphate lyase 1 OS=Homo sapiens OX=9606 GN=SGPL1 PE=1 SV=1 CANONICAL=O95470-1" }, "locus": { "chromosome": "10", "start_pos": 70869342, "end_pos": 70816854, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000697925.1", "url": "https://www.ensembl.org/id/ENST00000697925.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000513479.1", "url": "https://www.ensembl.org/id/ENSP00000513479.1" } ] } }, { "isoform_ac": "A0A8V8TLU3-1", "url": "", "sequence": { "sequence": "MPSTDLLMLKAFEPYLEILEVYSTKAKNYVNGHCTKYEPWQLIAWSVVWTLLIVWGYEFVFQPESLWSRFKKKCFKLTR", "length": 79, "header": "tr|A0A8V8TLU3-1|A0A8V8TLU3_HUMAN Computationally mapped isoform of Sphingosine-1-phosphate lyase 1 OS=Homo sapiens OX=9606 GN=SGPL1 PE=1 SV=1 CANONICAL=O95470-1" }, "locus": { "chromosome": "10", "start_pos": 70851186, "end_pos": 70816854, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000697929.1", "url": "https://www.ensembl.org/id/ENST00000697929.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000513483.1", "url": "https://www.ensembl.org/id/ENSP00000513483.1" } ] } }, { "isoform_ac": "A0A8V8TLU8-1", "url": "", "sequence": { "sequence": "MPIIGRKIQDKLNKTKDDISKNMSFLKVDKEYVKALPSQGLSSSAVLEKLKEYSSMDAFWQEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSLFNGGPDSCGCVTSGGTESILMACKAYRDLAFEKGIKTPEIVAPQSAHAAFNKAASYFGMKIVRVPLTKMMEVDVRVSCLWGRVGSSPMKDLPRI", "length": 209, "header": "tr|A0A8V8TLU8-1|A0A8V8TLU8_HUMAN Computationally mapped isoform of Sphingosine-1-phosphate lyase 1 OS=Homo sapiens OX=9606 GN=SGPL1 PE=1 SV=1 CANONICAL=O95470-1" }, "locus": { "chromosome": "10", "start_pos": 70893815, "end_pos": 70851190, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000697988.1", "url": "https://www.ensembl.org/id/ENST00000697988.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000513492.1", "url": "https://www.ensembl.org/id/ENSP00000513492.1" } ] } }, { "isoform_ac": "A0A8V8TN35-1", "url": "", "sequence": { "sequence": "MPIIGRKIQDKLNKTKDDISKNMSFLKVDKEYVKALPSQGLSSSAVLEKLKEYSSMDAFWQEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSLFNGGPDSCGCVTSGGTESILMACKAYRDLAFEKGIKTPEIVAPQSAHAAFNKAASYFGMKIVRVPLTKMMEVDVRAMRRAISRNTAMLVCSTPQFPHGVIDPVPEVAKLAVKYKIPLHVDACLGGFLIVFMEKAGYPLEHPFDFRVKGVTSISADTHKYGYAPKGSSLVLYSDKKYRNYQFFVDTDWQGGIYASPTIAGSRPGGISAACWAALMHFGENGYVEATKQIIKTARFLKSELENIKGIFVFGNPQLSVIALGSRDFDIYRLSNLMTAKGWNLNQLQFPPSIHFCITLLHARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTTVDRNMVAELSSVFLDSLYSTDTVTQGSQMNGSPKPH", "length": 488, "header": "tr|A0A8V8TN35-1|SGPL1_HUMAN Computationally mapped isoform of Sphingosine-1-phosphate lyase 1 OS=Homo sapiens OX=9606 GN=SGPL1 PE=1 SV=1 CANONICAL=O95470-1" }, "locus": { "chromosome": "10", "start_pos": 70877332, "end_pos": 70851190, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000697926.1", "url": "https://www.ensembl.org/id/ENST00000697926.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000513480.1", "url": "https://www.ensembl.org/id/ENSP00000513480.1" } ] } }, { "isoform_ac": "A0A8V8TN38-1", "url": "", "sequence": { "sequence": "MPSTDLLMLKAFEPYLEILEVYSTKAKNYVNGHCTKYEPWQLIAWSVVWTLLIVWGYEFVFQPESLWSRFKKKCFKLTRKMPIIGRKIQDKLNKTKDDISKNMSFLKVDKEYVKALPSQGLSSSAVLEKLKEYSSMGMMLGIYMLSTSLKRQVLSLFNVHIG", "length": 162, "header": "tr|A0A8V8TN38-1|A0A8V8TN38_HUMAN Computationally mapped isoform of Sphingosine-1-phosphate lyase 1 OS=Homo sapiens OX=9606 GN=SGPL1 PE=1 SV=1 CANONICAL=O95470-1" }, "locus": { "chromosome": "10", "start_pos": 70854932, "end_pos": 70816854, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000697989.1", "url": "https://www.ensembl.org/id/ENST00000697989.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000513493.1", "url": "https://www.ensembl.org/id/ENSP00000513493.1" } ] } }, { "isoform_ac": "H7BXL7-1", "url": "", "sequence": { "sequence": "ILEVYSTKAKNYVNGHCTKYEPWQLIAWSVVWTLLIVWGYEFVFQPESLWSRFKKKCFKLTRKMPIIGRKIQDKLNKTKDDISKNMSFLKVDKEYVKALPSQGLSSSAVLEKLKEYSSMDAFWQEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSLFNGGPDSCGCEALFLFCFSNMLAP", "length": 202, "header": "tr|H7BXL7-1|H7BXL7_HUMAN Computationally mapped isoform of Sphingosine-1-phosphate lyase 1 OS=Homo sapiens OX=9606 GN=SGPL1 PE=1 SV=1 CANONICAL=O95470-1" }, "locus": { "chromosome": "10", "start_pos": 70860434, "end_pos": 70844497, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000299297.8", "url": "https://www.ensembl.org/id/ENST00000299297.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000299297.4", "url": "https://www.ensembl.org/id/ENSP00000299297.4" } ] } }, { "isoform_ac": "O95470-1", "url": "", "sequence": { "sequence": "MPSTDLLMLKAFEPYLEILEVYSTKAKNYVNGHCTKYEPWQLIAWSVVWTLLIVWGYEFVFQPESLWSRFKKKCFKLTRKMPIIGRKIQDKLNKTKDDISKNMSFLKVDKEYVKALPSQGLSSSAVLEKLKEYSSMDAFWQEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSLFNGGPDSCGCVTSGGTESILMACKAYRDLAFEKGIKTPEIVAPQSAHAAFNKAASYFGMKIVRVPLTKMMEVDVRAMRRAISRNTAMLVCSTPQFPHGVIDPVPEVAKLAVKYKIPLHVDACLGGFLIVFMEKAGYPLEHPFDFRVKGVTSISADTHKYGYAPKGSSLVLYSDKKYRNYQFFVDTDWQGGIYASPTIAGSRPGGISAACWAALMHFGENGYVEATKQIIKTARFLKSELENIKGIFVFGNPQLSVIALGSRDFDIYRLSNLMTAKGWNLNQLQFPPSIHFCITLLHARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTTVDRNMVAELSSVFLDSLYSTDTVTQGSQMNGSPKPH", "length": 568, "header": "sp|O95470-1|SGPL1_HUMAN Isoform 1 of Sphingosine-1-phosphate lyase 1 OS=Homo sapiens OX=9606 GN=SGPL1 PE=1 SV=3 CANONICAL=O95470-1" }, "locus": { "chromosome": "10", "start_pos": 70877332, "end_pos": 70816854, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000697928.1", "url": "https://www.ensembl.org/id/ENST00000697928.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000513482.1", "url": "https://www.ensembl.org/id/ENSP00000513482.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O95470", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95470" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34229054", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34229054" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" } ] } ], "phosphorylation": [ { "start_pos": 468, "end_pos": 468, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95470", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95470" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ], "site_lbl": "Thr468" }, { "start_pos": 552, "end_pos": 552, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95470", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95470" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ], "site_lbl": "Thr552" }, { "start_pos": 559, "end_pos": 559, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95470", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95470" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser559" }, { "start_pos": 564, "end_pos": 564, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "O95470", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95470" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser564" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Human sphingosine-1-phosphate lyase: cDNA cloning, functional expression studies and mapping to chromosome 10q22(1).", "journal": "Biochimica et biophysica acta", "date": "2000", "authors": "Van Veldhoven PP, Gijsbers S, Mannaerts GP, Vermeesch JR, Brys V", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" }, { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "11018465", "url": "https://glygen.org/publication/PubMed/11018465" } ] }, { "title": "Cloning and characterization of a novel human alkaline ceramidase. A mammalian enzyme that hydrolyzes phytoceramide.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Mao C, Xu R, Szulc ZM, Bielawska A, Galadari SH, Obeid LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "11356846", "url": "https://glygen.org/publication/PubMed/11356846" } ] }, { "title": "Identification and characterization of a novel human sphingosine-1-phosphate phosphohydrolase, hSPP2.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Ogawa C, Kihara A, Gokoh M, Igarashi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "12411432", "url": "https://glygen.org/publication/PubMed/12411432" } ] }, { "title": "Role of human sphingosine-1-phosphate phosphatase 1 in the regulation of intra- and extracellular sphingosine-1-phosphate levels and cell viability.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Johnson KR, Johnson KY, Becker KP, Bielawski J, Mao C, Obeid LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "12815058", "url": "https://glygen.org/publication/PubMed/12815058" } ] }, { "title": "Sphingosine-phosphate lyase enhances stress-induced ceramide generation and apoptosis.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Reiss U, Oskouian B, Zhou J, Gupta V, Sooriyakumaran P, Kelly S, Wang E, Merrill AH Jr, Saba JD", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" }, { "database": "RefSeq", "id": "NP_003892", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003892" } ], "reference": [ { "type": "PubMed", "id": "14570870", "url": "https://glygen.org/publication/PubMed/14570870" } ] }, { "title": "Nitroproteins from a human pituitary adenoma tissue discovered with a nitrotyrosine affinity column and tandem mass spectrometry.", "journal": "Analytical biochemistry", "date": "2006", "authors": "Zhan X, Desiderio DM", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "reference": [ { "type": "PubMed", "id": "16777052", "url": "https://glygen.org/publication/PubMed/16777052" } ] }, { "title": "Sphingosine-1-phosphate phosphohydrolase regulates endoplasmic reticulum-to-golgi trafficking of ceramide.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Giussani P, Maceyka M, Le Stunff H, Mikami A, Lepine S, Wang E, Kelly S, Merrill AH Jr, Milstien S, Spiegel S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "16782891", "url": "https://glygen.org/publication/PubMed/16782891" } ] }, { "title": "Golgi alkaline ceramidase regulates cell proliferation and survival by controlling levels of sphingosine and S1P.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2006", "authors": "Xu R, Jin J, Hu W, Sun W, Bielawski J, Szulc Z, Taha T, Obeid LM, Mao C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "16940153", "url": "https://glygen.org/publication/PubMed/16940153" } ] }, { "title": "Intracellular generation of sphingosine 1-phosphate in human lung endothelial cells: role of lipid phosphate phosphatase-1 and sphingosine kinase 1.", "journal": "The Journal of biological chemistry", "date": "2007-05-11", "authors": "Zhao Yutong, Kalari Satish K, Usatyuk Peter V, Gorshkova Irina, He Donghong, Watkins Tonya, Brindley David N, Sun Chaode, Bittman Robert, Garcia Joe G N, Berdyshev Evgeni V, Natarajan Viswanathan", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "17379599", "url": "https://glygen.org/publication/PubMed/17379599" } ] }, { "title": "Expression and initial characterization of human ALDH3B1.", "journal": "Biochemical and biophysical research communications", "date": "2007-05-11", "authors": "Marchitti Satori A, Orlicky David J, Vasiliou Vasilis", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "17382292", "url": "https://glygen.org/publication/PubMed/17382292" } ] }, { "title": "Upregulation of the human alkaline ceramidase 1 and acid ceramidase mediates calcium-induced differentiation of epidermal keratinocytes.", "journal": "The Journal of investigative dermatology", "date": "2008", "authors": "Sun W, Xu R, Hu W, Jin J, Crellin HA, Bielawski J, Szulc ZM, Thiers BH, Obeid LM, Mao C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "17713573", "url": "https://glygen.org/publication/PubMed/17713573" } ] }, { "title": "Sphingosine-1-phosphate lyase in development and disease: sphingolipid metabolism takes flight.", "journal": "Biochimica et biophysica acta", "date": "2008", "authors": "Fyrst H, Saba JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "18558101", "url": "https://glygen.org/publication/PubMed/18558101" } ] }, { "title": "Ceramidases: regulators of cellular responses mediated by ceramide, sphingosine, and sphingosine-1-phosphate.", "journal": "Biochimica et biophysica acta", "date": "2008", "authors": "Mao C, Obeid LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "18619555", "url": "https://glygen.org/publication/PubMed/18619555" } ] }, { "title": "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.", "journal": "Mol. Cell", "date": "2008", "authors": "Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" }, { "database": "iPTMnet", "id": "O95470", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95470" } ], "reference": [ { "type": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ] }, { "title": "Lysine acetylation targets protein complexes and co-regulates major cellular functions.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "reference": [ { "type": "PubMed", "id": "19608861", "url": "https://glygen.org/publication/PubMed/19608861" } ] }, { "title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.", "journal": "Science signaling", "date": "2009", "authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" }, { "database": "iPTMnet", "id": "O95470", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95470" } ], "reference": [ { "type": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" } ] }, { "title": "Alkaline ceramidase 3 (ACER3) hydrolyzes unsaturated long-chain ceramides, and its down-regulation inhibits both cell proliferation and apoptosis.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Hu W, Xu R, Sun W, Szulc ZM, Bielawski J, Obeid LM, Mao C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "20068046", "url": "https://glygen.org/publication/PubMed/20068046" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O95470", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95470" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Substrate specificity, membrane topology, and activity regulation of human alkaline ceramidase 2 (ACER2).", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Sun W, Jin J, Xu R, Hu W, Szulc ZM, Bielawski J, Obeid LM, Mao C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "20089856", "url": "https://glygen.org/publication/PubMed/20089856" } ] }, { "title": "Molecular characterization, expression analysis, and role of ALDH3B1 in the cellular protection against oxidative stress.", "journal": "Free radical biology & medicine", "date": "2010", "authors": "Marchitti SA, Brocker C, Orlicky DJ, Vasiliou V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "20699116", "url": "https://glygen.org/publication/PubMed/20699116" } ] }, { "title": "First evidence of sphingosine 1-phosphate lyase protein expression and activity downregulation in human neoplasm: implication for resistance to therapeutics in prostate cancer.", "journal": "Mol. Cancer Ther.", "date": "2012", "authors": "Brizuela Leyre, Ader Isabelle, Mazerolles Catherine, Bocquet Magalie, Malavaud Bernard, Cuvillier Olivier", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "reference": [ { "type": "PubMed", "id": "22784711", "url": "https://glygen.org/publication/PubMed/22784711" } ] }, { "title": "Substrate specificity, plasma membrane localization, and lipid modification of the aldehyde dehydrogenase ALDH3B1.", "journal": "Biochimica et biophysica acta", "date": "2013", "authors": "Kitamura T, Naganuma T, Abe K, Nakahara K, Ohno Y, Kihara A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "23721920", "url": "https://glygen.org/publication/PubMed/23721920" } ] }, { "title": "Orally active 7-substituted (4-benzylphthalazin-1-yl)-2-methylpiperazin-1-yl]nicotinonitriles as active-site inhibitors of sphingosine 1-phosphate lyase for the treatment of multiple sclerosis.", "journal": "Journal of medicinal chemistry", "date": "2014", "authors": "Weiler S, Braendlin N, Beerli C, Bergsdorf C, Schubart A, Srinivas H, Oberhauser B, Billich A", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "reference": [ { "type": "PubMed", "id": "24809814", "url": "https://glygen.org/publication/PubMed/24809814" } ] }, { "title": "Mouse aldehyde dehydrogenase ALDH3B2 is localized to lipid droplets via two C-terminal tryptophan residues and lipid modification.", "journal": "The Biochemical journal", "date": "2015", "authors": "Kitamura T, Takagi S, Naganuma T, Kihara A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "25286108", "url": "https://glygen.org/publication/PubMed/25286108" } ] }, { "title": "Alkaline ceramidase 1 is essential for mammalian skin homeostasis and regulating whole-body energy expenditure.", "journal": "The Journal of pathology", "date": "2016-07", "authors": "Liakath-Ali Kifayathullah, Vancollie Valerie E, Lelliott Christopher J, Speak Anneliese O, Lafont David, Protheroe Hayley J, Ingvorsen Camilla, Galli Antonella, Green Angela, Gleeson Diane, Ryder Ed, Glover Leanne, Vizcay-Barrena Gema, Karp Natasha A, Arends Mark J, Brenn Thomas, Spiegel Sarah, Adams David J, Watt Fiona M, van der Weyden Louise", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "27126290", "url": "https://glygen.org/publication/PubMed/27126290" } ] }, { "title": "Sphingosine 1-phosphate lyase deficiency causes Charcot-Marie-Tooth neuropathy.", "journal": "Neurology", "date": "2017", "authors": "Atkinson D, Nikodinovic Glumac J, Asselbergh B, Ermanoska B, Blocquel D, Steiner R, Estrada-Cuzcano A, Peeters K, Ooms T, De Vriendt E, Yang XL, Hornemann T, Milic Rasic V, Jordanova A", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "reference": [ { "type": "PubMed", "id": "28077491", "url": "https://glygen.org/publication/PubMed/28077491" } ] }, { "title": "Mutations in sphingosine-1-phosphate lyase cause nephrosis with ichthyosis and adrenal insufficiency.", "journal": "The Journal of clinical investigation", "date": "2017", "authors": "Lovric S, Goncalves S, Gee HY, Oskouian B, Srinivas H, Choi WI, Shril S, Ashraf S, Tan W, Rao J, Airik M, Schapiro D, Braun DA, Sadowski CE, Widmeier E, Jobst-Schwan T, Schmidt JM, Girik V, Capitani G, Suh JH, Lachaussee N, Arrondel C, Patat J, Gribouval O, Furlano M, Boyer O, Schmitt A, Vuiblet V, Hashmi S, Wilcken R, Bernier FP, Innes AM, Parboosingh JS, Lamont RE, Midgley JP, Wright N, Majewski J, Zenker M, Schaefer F, Kuss N, Greil J, Giese T, Schwarz K, Catheline V, Schanze D, Franke I, Sznajer Y, Truant AS, Adams B, Desir J, Biemann R, Pei Y, Ars E, Lloberas N, Madrid A, Dharnidharka VR, Connolly AM, Willing MC, Cooper MA, Lifton RP, Simons M, Riezman H, Antignac C, Saba JD, Hildebrandt F", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "reference": [ { "type": "PubMed", "id": "28165339", "url": "https://glygen.org/publication/PubMed/28165339" } ] }, { "title": "Sphingosine-1-phosphate lyase mutations cause primary adrenal insufficiency and steroid-resistant nephrotic syndrome.", "journal": "The Journal of clinical investigation", "date": "2017", "authors": "Prasad R, Hadjidemetriou I, Maharaj A, Meimaridou E, Buonocore F, Saleem M, Hurcombe J, Bierzynska A, Barbagelata E, Bergada I, Cassinelli H, Das U, Krone R, Hacihamdioglu B, Sari E, Yesilkaya E, Storr HL, Clemente M, Fernandez-Cancio M, Camats N, Ram N, Achermann JC, Van Veldhoven PP, Guasti L, Braslavsky D, Guran T, Metherell LA", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "reference": [ { "type": "PubMed", "id": "28165343", "url": "https://glygen.org/publication/PubMed/28165343" } ] }, { "title": "Deficiency of the sphingosine-1-phosphate lyase SGPL1 is associated with congenital nephrotic syndrome and congenital adrenal calcifications.", "journal": "Human mutation", "date": "2017", "authors": "Janecke AR, Xu R, Steichen-Gersdorf E, Waldegger S, Entenmann A, Giner T, Krainer I, Huber LA, Hess MW, Frishberg Y, Barash H, Tzur S, Schreyer-Shafir N, Sukenik-Halevy R, Zehavi T, Raas-Rothschild A, Mao C, Muller T", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "reference": [ { "type": "PubMed", "id": "28181337", "url": "https://glygen.org/publication/PubMed/28181337" } ] }, { "title": "Tumor suppressor p53 links ceramide metabolism to DNA damage response through alkaline ceramidase 2.", "journal": "Cell death and differentiation", "date": "2018", "authors": "Xu R, Garcia-Barros M, Wen S, Li F, Lin CL, Hannun YA, Obeid LM, Mao C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "29229990", "url": "https://glygen.org/publication/PubMed/29229990" } ] }, { "title": "Nephrotic syndrome and adrenal insufficiency caused by a variant in SGPL1.", "journal": "Clinical kidney journal", "date": "2018", "authors": "Linhares ND, Arantes RR, Araujo SA, Pena SDJ", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" }, { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "30090628", "url": "https://glygen.org/publication/PubMed/30090628" } ] }, { "title": "SGPL1 Deficiency: A Rare Cause of Primary Adrenal Insufficiency.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2019", "authors": "Settas N, Persky R, Faucz FR, Sheanon N, Voutetakis A, Lodish M, Metherell LA, Stratakis CA", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "reference": [ { "type": "PubMed", "id": "30517686", "url": "https://glygen.org/publication/PubMed/30517686" } ] }, { "title": "Structure of a human intramembrane ceramidase explains enzymatic dysfunction found in leukodystrophy.", "journal": "Nature communications", "date": "2018", "authors": "Vasiliauskaite-Brooks I, Healey RD, Rochaix P, Saint-Paul J, Sounier R, Grison C, Waltrich-Augusto T, Fortier M, Hoh F, Saied EM, Arenz C, Basu S, Leyrat C, Granier S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "30575723", "url": "https://glygen.org/publication/PubMed/30575723" } ] }, { "title": "Fifty years of lyase and a moment of truth: Sphingosine phosphate lyase from discovery to disease.", "journal": "J. Lipid Res.", "date": "2019", "authors": "Saba Julie D", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" }, { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "30635364", "url": "https://glygen.org/publication/PubMed/30635364" } ] }, { "title": "Influenza A virus NS1 induces degradation of sphingosine 1-phosphate lyase to obstruct the host innate immune response.", "journal": "Virology", "date": "2021", "authors": "Wolf JJ, Xia C, Studstill CJ, Ngo H, Brody SL, Anderson PE, Hahm B", "evidence": [ { "database": "RefSeq", "id": "NP_003892", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003892" } ], "reference": [ { "type": "PubMed", "id": "33730651", "url": "https://glygen.org/publication/PubMed/33730651" } ] }, { "title": "S1P Lyase Regulates Intestinal Stem Cell Quiescence via Ki-67 and FOXO3.", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Schwiebs A, Faqar-Uz-Zaman F, Herrero San Juan M, Radeke HH", "evidence": [ { "database": "RefSeq", "id": "NP_003892", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003892" } ], "reference": [ { "type": "PubMed", "id": "34073605", "url": "https://glygen.org/publication/PubMed/34073605" } ] }, { "title": "Synthesis of Na2S2O4 mediated cleavable affinity tag for labeling of O-GlcNAc modified proteins via azide-alkyne cycloaddition.", "journal": "Bioorganic & medicinal chemistry letters", "date": "2021", "authors": "Wang J, Dou B, Zheng L, Cao W, Zeng X, Wen Y, Ma J, Li X", "evidence": [ { "database": "O-GlcNAc Database", "id": "O95470", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95470" } ], "reference": [ { "type": "PubMed", "id": "34229054", "url": "https://glygen.org/publication/PubMed/34229054" } ] }, { "title": "Truncation of the TPR domain of OGT alters substrate and glycosite selection.", "journal": "Analytical and bioanalytical chemistry", "date": "2021", "authors": "Ramirez DH, Yang B, D'Souza AK, Shen D, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "O95470", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95470" } ], "reference": [ { "type": "PubMed", "id": "34725712", "url": "https://glygen.org/publication/PubMed/34725712" } ] }, { "title": "A rare cause of nephrotic syndrome-sphingosine-1-phosphate lyase (SGPL1) deficiency: 6 cases and a review of the literature.", "journal": "Pediatric nephrology (Berlin, Germany)", "date": "2022-06-24", "authors": "Tastemel Ozturk Tugba, Canpolat Nur, Saygili Seha, Bayrakci Umut Selda, Soylemezoglu Oguz, Ozaltin Fatih, Topaloglu Rezan", "evidence": [ { "database": "RefSeq", "id": "NP_003892", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003892" } ], "reference": [ { "type": "PubMed", "id": "35748945", "url": "https://glygen.org/publication/PubMed/35748945" } ] }, { "title": "SGPL1 Deficiency: Nephrotic Syndrome with Lymphopenia.", "journal": "Journal of clinical immunology", "date": "2022-09-02", "authors": "Tran Paulina, Jamee Mahnaz, Pournasiri Zahra, Chavoshzadeh Zahra, Sullivan Kathleen E", "evidence": [ { "database": "RefSeq", "id": "NP_003892", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003892" } ], "reference": [ { "type": "PubMed", "id": "36050428", "url": "https://glygen.org/publication/PubMed/36050428" } ] }, { "title": "Loss of S1P Lyase Expression in Human Podocytes Causes a Reduction in Nephrin Expression That Involves PKC\u03b4 Activation.", "journal": "International journal of molecular sciences", "date": "2023-02-07", "authors": "Imeri Faik, Stepanovska Tanturovska Bisera, Manaila Roxana, Pavenst\u00e4dt Hermann, Pfeilschifter Josef, Huwiler Andrea", "evidence": [ { "database": "RefSeq", "id": "NP_003892", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003892" } ], "reference": [ { "type": "PubMed", "id": "36834691", "url": "https://glygen.org/publication/PubMed/36834691" } ] }, { "title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.", "journal": "Journal of biomedical science", "date": "2023-05-22", "authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K", "evidence": [ { "database": "O-GlcNAc Database", "id": "O95470", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95470" } ], "reference": [ { "type": "PubMed", "id": "37217939", "url": "https://glygen.org/publication/PubMed/37217939" } ] }, { "title": "Human type 2 phosphatidic acid phosphohydrolases. Substrate specificity of the type 2a, 2b, and 2c enzymes and cell surface activity of the 2a isoform.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Roberts R, Sciorra VA, Morris AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "9705349", "url": "https://glygen.org/publication/PubMed/9705349" } ] } ], "pathway": [ { "id": "hsa:8879", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8879", "resource": "KEGG Pathway" }, { "id": "R-HSA-9845614", "name": "Sphingolipid catabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614", "resource": "Reactome", "description": "Sphingolipid catabolism" } ], "orthologs": [ { "uniprot_canonical_ac": "Q05567-1", "protein_name": "Sphingosine-1-phosphate lyase", "gene_name": "DPL1", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MSGVSNKTVSINGWYGMPIHLLREEGDFAQFMILTINELKIAIHGYLRNTPWYNMLKDYLFVIFCYKLISNFFYLLKVYGPVRLAVRTYEHSSRRLFRWLLDSPFLRGTVEKEVTKVKQSIEDELIRSDSQLMNFPQLPSNGIPQDDVIEELNKLNDLIPHTQWKEGKVSGAVYHGGDDLIHLQTIAYEKYCVANQLHPDVFPAVRKMESEVVSMVLRMFNAPSDTGCGTTTSGGTESLLLACLSAKMYALHHRGITEPEIIAPVTAHAGFDKAAYYFGMKLRHVELDPTTYQVDLGKVKKFINKNTILLVGSAPNFPHGIADDIEGLGKIAQKYKLPLHVDSCLGSFIVSFMEKAGYKNLPLLDFRVPGVTSISCDTHKYGFAPKGSSVIMYRNSDLRMHQYYVNPAWTGGLYGSPTLAGSRPGAIVVGCWATMVNMGENGYIESCQEIVGAAMKFKKYIQENIPDLNIMGNPRYSVISFSSKTLNIHELSDRLSKKGWHFNALQKPVALHMAFTRLSAHVVDEICDILRTTVQELKSESNSKPSPDGTSALYGVAGSVKTAGVADKLIVGFLDALYKLGPGEDTATK", "length": 589 }, "evidence": [ { "id": "O95470", "url": "https://omabrowser.org/oma/group/O95470/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "Q8CHN6-1", "protein_name": "Sphingosine-1-phosphate lyase 1", "gene_name": "Sgpl1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MPSTDLLKLKDFEPYLEILEAYSTKAKNYVNGYCTKYEPWQLIAGSVLCTLLVVWVYELIFQPESLWSRFKNKLFRLIRKMPFIGRKIQQQLTKAKKDLVKNMPFLKLDKDYVKTLPAQGLSTAEVLERLKEYSSMDVFWQEGKASGAVYSGEPKLTELLVQAYGEFTWSNPLHPDIFPGLRKLEAEIVRMTCSLFNGGPDSCGCVTSGGTESILMACKAYRDLALEKGIKTPEIVAPESAHAAFDKAAHYFGMKIVRVAQKKNMEVDVRAMKRAISRNTAMLVCSAPQFPHGVIDPIPEVAKLAVKYKIPFHVDACLGGFLIVFMEKAGYPLEKPFDFRVKGVTSISADTHKYGYAPKGSSVVMYSNEKYRKYQFFVDADWQGGIYASPSIAGSRPGGIIAACWAALMHFGENGYVEATKQIIKTARFLKSELENIKNIFILGDPQLSVIALGSNDFDIYRLSNMMSAKGWNFNYLQFPRSIHFCITLVHTRKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQATIDRKMVAEISSVFLDSLYSTDPVTQGNQMNGSPKPR", "length": 568 }, "evidence": [ { "id": "45926923", "url": "http://www.informatics.jax.org/homology/45926923", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q8R0X7-1", "protein_name": "Sphingosine-1-phosphate lyase 1", "gene_name": "Sgpl1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MPGTDLLKLKDFEPYLEILESYSTKAKNYVNGYCTKYEPWQLIAWSVLCTLLIVWVYELIFQPESLWSRFKKKLFKLIRKMPFIGRKIEQQVSKAKKDLVKNMPFLKVDKDYVKTLPAQGMGTAEVLERLKEYSSMDGSWQEGKASGAVYNGEPKLTELLVQAYGEFTWSNPLHPDIFPGLRKLEAEIVRMTCSLFNGGPDSCGCVTSGGTESILMACKAYRDLALEKGIKTPEIVAPESAHAAFDKAAHYFGMKIVRVALKKNMEVDVQAMKRAISRNTAMLVCSTPQFPHGVMDPVPEVAKLAVRYKIPLHVDACLGGFLIVFMEKAGYPLEKPFDFRVKGVTSISADTHKYGYAPKGSSVVMYSNEKYRTYQFFVGADWQGGVYASPSIAGSRPGGIIAACWAALMHFGENGYVEATKQIIKTARFLKSELENIKNIFIFGDPQLSVIALGSNDFDIYRLSNMMSAKGWNFNYLQFPRSIHFCITLVHTRKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQATIDRKLVAEISSVFLDCLYTTDPVTQGNQMNGSPKPR", "length": 568 }, "evidence": [ { "id": "45926923", "url": "http://www.informatics.jax.org/homology/45926923", "database": "MGI" }, { "id": "O95470", "url": "https://omabrowser.org/oma/group/O95470/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9V7Y2-1", "protein_name": "Sphingosine-1-phosphate lyase", "gene_name": "Sply", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MRPFSGSDCLKPVTEGINRAFGAKEPWQVATITATTVLGGVWLWTVICQDENLYIRGKRQFFKFAKKIPAVRRQVETELAKAKNDFETEIKKSNAHLTYSETLPEKGLSKEEILRLVDEHLKTGHYNWRDGRVSGAVYGYKPDLVELVTEVYGKASYTNPLHADLFPGVCKMEAEVVRMACNLFHGNSASCGTMTTGGTESIVMAMKAYRDFAREYKGITRPNIVVPKTVHAAFDKGGQYFNIHVRSVDVDPETYEVDIKKFKRAINRNTILLVGSAPNFPYGTIDDIEAIAALGVKYDIPVHVDACLGSFVVALVRNAGYKLRPFDFEVKGVTSISADTHKYGFAPKGSSVILYSDKKYKDHQFTVTTDWPGGVYGSPTVNGSRAGGIIAACWATMMSFGYDGYLEATKRIVDTARYIERGVRDIDGIFIFGKPATSVIALGSNVFDIFRLSDSLCKLGWNLNALQFPSGIHLCVTDMHTQPGVADKFIADVRSCTAEIMKDPGQPVVGKMALYGMAQSIPDRSVIGEVTRLFLHSMYYTPSQK", "length": 545 }, "evidence": [ { "id": "O95470", "url": "https://omabrowser.org/oma/group/O95470/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "pyridoxal phosphate binding", "id": "GO:0030170", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030170", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "pmid": "" }, { "name": "carbon-carbon lyase activity", "id": "GO:0016830", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016830", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "pmid": "" }, { "name": "sphinganine-1-phosphate aldolase activity", "id": "GO:0008117", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008117", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 21, "go_terms": [ { "name": "carboxylic acid metabolic process", "id": "GO:0019752", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019752", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "pmid": "" }, { "name": "estrogen metabolic process", "id": "GO:0008210", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008210", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "pmid": "" }, { "name": "sphingolipid catabolic process", "id": "GO:0030149", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030149", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "pmid": "" }, { "name": "vasculogenesis", "id": "GO:0001570", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001570", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "pmid": "" }, { "name": "fatty acid metabolic process", "id": "GO:0006631", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006631", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "pmid": "" }, { "name": "spermatogenesis", "id": "GO:0007283", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007283", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "pmid": "" }, { "name": "regulation of multicellular organism growth", "id": "GO:0040014", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0040014", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "pmid": "" }, { "name": "kidney development", "id": "GO:0001822", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001822", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "pmid": "" }, { "name": "sphingolipid biosynthetic process", "id": "GO:0030148", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030148", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "pmid": "" }, { "name": "apoptotic signaling pathway", "id": "GO:0097190", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097190", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "pmid": "" }, { "name": "ceramide metabolic process", "id": "GO:0006672", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006672", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "pmid": "" }, { "name": "post-embryonic development", "id": "GO:0009791", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009791", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "pmid": "" }, { "name": "hemopoiesis", "id": "GO:0030097", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030097", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "pmid": "" }, { "name": "androgen metabolic process", "id": "GO:0008209", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008209", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "pmid": "" }, { "name": "skeletal system morphogenesis", "id": "GO:0048705", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048705", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "pmid": "" }, { "name": "roof of mouth development", "id": "GO:0060021", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060021", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "pmid": "" }, { "name": "face morphogenesis", "id": "GO:0060325", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060325", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "pmid": "" }, { "name": "Leydig cell differentiation", "id": "GO:0033327", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033327", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "pmid": "" }, { "name": "fibroblast migration", "id": "GO:0010761", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010761", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "pmid": "" }, { "name": "platelet-derived growth factor receptor signaling pathway", "id": "GO:0048008", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048008", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "pmid": "" }, { "name": "luteinization", "id": "GO:0001553", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001553", "evidence": [ { "database": "UniProtKB", "id": "O95470", "url": "https://www.uniprot.org/uniprot/O95470" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 102, "end_pos": 104, "annotation": "n_glycosylation_sequon" }, { "start_pos": 562, "end_pos": 564, "annotation": "n_glycosylation_sequon" }, { "start_pos": 93, "end_pos": 95, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "18593", "name": "", "equation": "sphinganine 1-phosphate = hexadecanal + phosphoethanolamine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8CHN6-1", "O95470-1", "Q8R0X7-1", "Q05567-1", "Q54RV9-1", "Q9V7Y2-1" ], "evidence": [ { "id": "18593", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/18593" } ] }, { "id": "33507", "name": "", "equation": "sphing-4-enine 1-phosphate = (2E)-hexadecenal + phosphoethanolamine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8CHN6-1", "O95470-1", "Q8R0X7-1" ], "evidence": [ { "id": "33507", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/33507" } ] }, { "id": "R-HSA-428681", "name": "PXLP-SGPL1 cleaves sphingoid-1-phosphates", "equation": "", "summary": "SGPL1 (sphingosine-1-phosphate lyase 1), associated with the endoplasmic reticulum membrane, catalyzes the cleavage of cytosolic sphinganine (dihydrosphingosine) or sphngosin\\e 1-phosphate to form phosphoethanolamine and hexadecanal or hexadecenal, respectively (Van Veldhoven et al. 2000; reviewed by Fyrst and Saba 2008; Saba, 2019). The reaction has no reverse counterpart and, thus, irreversibly removes sphingoids from the lipid pool. SGPL1 deficiency causes a form of nephrotic syndrome, a renal disease clinically characterized by severe proteinuria (NPHS14, MIM:617575; reviewed by Duarte Linhares et al., 2018).", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O95470-1" ], "evidence": [ { "id": "R-HSA-428681", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-428681" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "O95470", "gene_name": "SGPL1", "activity": [ { "ec_number": "4.1.2.27", "activity": "sphinganine 1-phosphate = hexadecanal + phosphoethanolamine.", "evidence": [ { "id": "O95470", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95470" } ] }, { "ec_number": "4.1.2.27", "activity": "", "evidence": [ { "id": "O95470", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95470" } ] } ] }, { "uniprot_ac": "Q05567", "gene_name": "DPL1", "activity": [ { "ec_number": "4.1.2.27", "activity": "sphinganine 1-phosphate = hexadecanal + phosphoethanolamine.", "evidence": [ { "id": "Q05567", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05567" } ] }, { "ec_number": "4.1.2.-", "activity": "", "evidence": [ { "id": "Q05567", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05567" } ] }, { "ec_number": "4.1.2.27", "activity": "", "evidence": [ { "id": "Q05567", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05567" } ] } ] }, { "uniprot_ac": "Q54RV9", "gene_name": "sglA", "activity": [ { "ec_number": "4.1.2.27", "activity": "sphinganine 1-phosphate = hexadecanal + phosphoethanolamine.", "evidence": [ { "id": "Q54RV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54RV9" } ] }, { "ec_number": "4.1.2.27", "activity": "", "evidence": [ { "id": "Q54RV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54RV9" } ] } ] }, { "uniprot_ac": "Q8CHN6", "gene_name": "Sgpl1", "activity": [ { "ec_number": "4.1.2.27", "activity": "sphinganine 1-phosphate = hexadecanal + phosphoethanolamine.", "evidence": [ { "id": "Q8CHN6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CHN6" } ] }, { "ec_number": "4.1.2.27", "activity": "", "evidence": [ { "id": "Q8CHN6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CHN6" } ] } ] }, { "uniprot_ac": "Q8R0X7", "gene_name": "Sgpl1", "activity": [ { "ec_number": "4.1.2.27", "activity": "sphinganine 1-phosphate = hexadecanal + phosphoethanolamine.", "evidence": [ { "id": "Q8R0X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R0X7" } ] }, { "ec_number": "4.1.2.27", "activity": "", "evidence": [ { "id": "Q8R0X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R0X7" } ] } ] }, { "uniprot_ac": "Q9V7Y2", "gene_name": "Sply", "activity": [ { "ec_number": "4.1.2.27", "activity": "sphinganine 1-phosphate = hexadecanal + phosphoethanolamine.", "evidence": [ { "id": "Q9V7Y2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V7Y2" } ] }, { "ec_number": "4.1.2.27", "activity": "", "evidence": [ { "id": "Q9V7Y2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V7Y2" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 468, 552, 559, 564 ], "sequon_annotation_sites": [ { "start_pos": 102, "end_pos": 104 }, { "start_pos": 562, "end_pos": 564 }, { "start_pos": 93, "end_pos": 95 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 43 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }