{ "uniprot_canonical_ac": "O95453-1", "uniprot_ac": "O95453", "uniprot_id": "PARN_HUMAN", "mass": { "chemical_mass": 73451.0, "monoisotopic_mass": 73451.0 }, "refseq": { "ac": "NP_001127949", "name": "poly(A)-specific ribonuclease PARN isoform 2", "summary": "The protein encoded by this gene is a 3'-exoribonuclease, with similarity to the RNase D family of 3'-exonucleases. It prefers poly(A) as the substrate, hence, efficiently degrades poly(A) tails of mRNAs. Exonucleolytic degradation of the poly(A) tail is often the first step in the decay of eukaryotic mRNAs. This protein is also involved in silencing of certain maternal mRNAs during oocyte maturation and early embryonic development, as well as in nonsense-mediated decay (NMD) of mRNAs that contain premature stop codons. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127949" }, "gene_names": [ { "name": "PARN", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O95453", "id": "O95453" }, { "name": "DAN; DKCB6; PFBMFT4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127949", "id": "NP_001127949" }, { "name": "DAN", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O95453", "id": "O95453" }, { "name": "PARN", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127949", "id": "NP_001127949" } ], "protein_names": [ { "name": "Poly(A)-specific ribonuclease PARN", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O95453" }, { "name": "3.1.13.4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95453" }, { "name": "Deadenylating nuclease", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95453" }, { "name": "Deadenylation nuclease", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95453" }, { "name": "Polyadenylate-specific ribonuclease", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95453" }, { "name": "deadenylating nuclease; deadenylation nuclease; polyadenylate-specific ribonuclease", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127949", "id": "NP_001127949" }, { "name": "poly(A)-specific ribonuclease PARN isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127949", "id": "NP_001127949" } ], "function": [ { "annotation": "3'-exoribonuclease that has a preference for poly(A) tails of mRNAs, thereby efficiently degrading poly(A) tails. Exonucleolytic degradation of the poly(A) tail is often the first step in the decay of eukaryotic mRNAs and is also used to silence certain maternal mRNAs translationally during oocyte maturation and early embryonic development. Interacts with both the 3'-end poly(A) tail and the 5'-end cap structure during degradation, the interaction with the cap structure being required for an efficient degradation of poly(A) tails. Involved in nonsense-mediated mRNA decay, a critical process of selective degradation of mRNAs that contain premature stop codons. Also involved in degradation of inherently unstable mRNAs that contain AU-rich elements (AREs) in their 3'-UTR, possibly via its interaction with KHSRP. Probably mediates the removal of poly(A) tails of AREs mRNAs, which constitutes the first step of destabilization (PubMed:10882133, PubMed:11359775, PubMed:12748283, PubMed:15175153, PubMed:9736620). Also able to recognize and trim poly(A) tails of microRNAs such as MIR21 and H/ACA box snoRNAs (small nucleolar RNAs) leading to microRNAs degradation or snoRNA increased stability (PubMed:25049417, PubMed:22442037).", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453#function" }, { "database": "PubMed", "id": "9736620", "url": "https://glygen.org/publication/PubMed/9736620" }, { "database": "PubMed", "id": "15175153", "url": "https://glygen.org/publication/PubMed/15175153" }, { "database": "PubMed", "id": "12748283", "url": "https://glygen.org/publication/PubMed/12748283" }, { "database": "PubMed", "id": "11359775", "url": "https://glygen.org/publication/PubMed/11359775" }, { "database": "PubMed", "id": "10882133", "url": "https://glygen.org/publication/PubMed/10882133" }, { "database": "PubMed", "id": "22442037", "url": "https://glygen.org/publication/PubMed/22442037" }, { "database": "PubMed", "id": "25049417", "url": "https://glygen.org/publication/PubMed/25049417" } ] }, { "annotation": "Deadenylation by the mammalian and amphibian poly(A)-specific exoribonuclease, PARN, is stimulated by the presence of an m(7)-guanosine cap on substrate RNAs. PARN exhibits intrinsic cap-binding activity.", "evidence": [ { "database": "RefSeq", "id": "NP_001127949", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127949" }, { "database": "PubMed", "id": "10698948", "url": "https://glygen.org/publication/PubMed/10698948" } ] }, { "annotation": "Intrinsically disordered PARN C-terminal domain is required for PARN nuclear localization in response to DNA damage. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001127949", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127949" }, { "database": "PubMed", "id": "31387300", "url": "https://glygen.org/publication/PubMed/31387300" } ] }, { "annotation": "PARN is a poly(A)-specific member of the RNase D family of 3' exoribonucleases. It is distributed between the nucleus and the cytoplasm and is not stably associated with ribosomes. Xenopus PARN catalyzes deadenylation during oocyte maturation.", "evidence": [ { "database": "RefSeq", "id": "NP_001127949", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127949" }, { "database": "PubMed", "id": "9736620", "url": "https://glygen.org/publication/PubMed/9736620" } ] }, { "annotation": "Regulation of poly(a)-specific ribonuclease activity by reversible lysine acetylation.", "evidence": [ { "database": "RefSeq", "id": "NP_001127949", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127949" }, { "database": "PubMed", "id": "32457045", "url": "https://glygen.org/publication/PubMed/32457045" } ] }, { "annotation": "Study reports a family with idiopathic pulmonary fibrosis with a rare missense mutation, p.Y91C, and a novel insertion, p.(I274*) in PARN gene. PARN p.Y91C had reduced deadenylase activity and the p.(I274*) transcript was depleted.", "evidence": [ { "database": "RefSeq", "id": "NP_001127949", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127949" }, { "database": "PubMed", "id": "31448843", "url": "https://glygen.org/publication/PubMed/31448843" } ] }, { "annotation": "The protein encoded by this gene is a 3'-exoribonuclease, with similarity to the RNase D family of 3'-exonucleases. It prefers poly(A) as the substrate, hence, efficiently degrades poly(A) tails of mRNAs. Exonucleolytic degradation of the poly(A) tail is often the first step in the decay of eukaryotic mRNAs. This protein is also involved in silencing of certain maternal mRNAs during oocyte maturation and early embryonic development, as well as in nonsense-mediated decay (NMD) of mRNAs that contain premature stop codons. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001127949", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127949" } ] }, { "annotation": "Translation Efficiency and Degradation of ER-Associated mRNAs Modulated by ER-Anchored poly(A)-Specific Ribonuclease (PARN). Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001127949", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127949" }, { "database": "PubMed", "id": "31936572", "url": "https://glygen.org/publication/PubMed/31936572" } ] } ], "disease": [ { "disease_id": "DOID:0070024", "recommended_name": { "id": "DOID:0070024", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0070024", "name": "autosomal recessive dyskeratosis congenita 6", "description": "A dyskeratosis congenita that has_material_basis_in an autosomal recessive mutation of the PARN gene on chromosome 16p13.12." }, "synonyms": [ { "id": "DOID:0070024", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0070024", "name": "DKCB6", "description": "" }, { "id": "MONDO:0014600", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014600", "name": "dyskeratosis congenita, autosomal recessive 6", "description": "Any dyskeratosis congenita in which the cause of the disease is a mutation in the PARN gene." }, { "id": "MONDO:0014600", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014600", "name": "DKCB6", "description": "" }, { "id": "MONDO:0014600", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014600", "name": "PARN dyskeratosis congenita", "description": "" }, { "id": "MONDO:0014600", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014600", "name": "dyskeratosis congenita caused by mutation in PARN", "description": "" }, { "id": "MONDO:0014600", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014600", "name": "dyskeratosis congenita, autosomal recessive 6", "description": "" }, { "id": "MONDO:0014600", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014600", "name": "dyskeratosis congenita, autosomal recessive type 6", "description": "" }, { "id": "MONDO:0014600", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014600", "name": "autosomal recessive dyskeratosis congenita 6", "description": "" }, { "id": "MIM:616353", "resource": "MIM", "url": "https://www.omim.org/entry/616353", "name": "Dyskeratosis congenita, autosomal recessive, 6", "description": "Dyskeratosis congenita, autosomal recessive, 6" } ], "evidence": [ { "id": "616353", "database": "MIM", "url": "https://www.omim.org/entry/616353" } ] }, { "disease_id": "MONDO:0014612", "recommended_name": { "id": "MONDO:0014612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014612", "name": "pulmonary fibrosis and/or bone marrow failure, Telomere-related, 4", "description": "Any pulmonary fibrosis and/or bone marrow failure, Telomere-related in which the cause of the disease is a mutation in the PARN gene." }, "synonyms": [ { "id": "MONDO:0014612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014612", "name": "PARN pulmonary fibrosis and/or bone marrow failure, Telomere-related", "description": "" }, { "id": "MONDO:0014612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014612", "name": "pulmonary fibrosis and/or bone marrow failure, Telomere-related caused by mutation in PARN", "description": "" }, { "id": "MONDO:0014612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014612", "name": "pulmonary fibrosis and/or bone marrow failure, Telomere-related, 4", "description": "" }, { "id": "MONDO:0014612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014612", "name": "pulmonary fibrosis and/or bone marrow failure, Telomere-related, type 4", "description": "" }, { "id": "MONDO:0014612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014612", "name": "PFBMFT4", "description": "" }, { "id": "MONDO:0014612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014612", "name": "pulmonary fibrosis and/or bone marrow failure, TELOMERE-RELATED, 4", "description": "" }, { "id": "MIM:616371", "resource": "MIM", "url": "https://www.omim.org/entry/616371", "name": "Pulmonary fibrosis, and/or bone marrow failure syndrome, telomere-related, 4", "description": "Pulmonary fibrosis, and/or bone marrow failure syndrome, telomere-related, 4" } ], "evidence": [ { "id": "616371", "database": "MIM", "url": "https://www.omim.org/entry/616371" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 113, "end_pos": 113, "sequence_org": "I", "sequence_mut": "A", "comment": "Loss of dimerization. Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" }, { "database": "PubMed", "id": "16281054", "url": "https://glygen.org/publication/PubMed/16281054" } ] }, { "start_pos": 115, "end_pos": 115, "sequence_org": "F", "sequence_mut": "A", "comment": "Reduced affinity for poly(A). Little effect on activity.", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ] }, { "start_pos": 123, "end_pos": 123, "sequence_org": "F", "sequence_mut": "A", "comment": "Loss of dimerization. Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" }, { "database": "PubMed", "id": "16281054", "url": "https://glygen.org/publication/PubMed/16281054" } ] }, { "start_pos": 28, "end_pos": 28, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of function but does not abolish ability to bind RNA. Induces a decrease in degradation of mRNAs containing AREs.", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" }, { "database": "PubMed", "id": "11742007", "url": "https://glygen.org/publication/PubMed/11742007" }, { "database": "PubMed", "id": "12748283", "url": "https://glygen.org/publication/PubMed/12748283" }, { "database": "PubMed", "id": "15358788", "url": "https://glygen.org/publication/PubMed/15358788" } ] }, { "start_pos": 28, "end_pos": 28, "sequence_org": "D", "sequence_mut": "C", "comment": "Loss of function in the presence of Mg(2+) but not in the presence of Mn(2+), Zn(2+), Co(2+) or Cd(2+).", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" }, { "database": "PubMed", "id": "11742007", "url": "https://glygen.org/publication/PubMed/11742007" }, { "database": "PubMed", "id": "12748283", "url": "https://glygen.org/publication/PubMed/12748283" }, { "database": "PubMed", "id": "15358788", "url": "https://glygen.org/publication/PubMed/15358788" } ] }, { "start_pos": 292, "end_pos": 292, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of function but does not abolish ability to bind RNA.", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" }, { "database": "PubMed", "id": "11742007", "url": "https://glygen.org/publication/PubMed/11742007" }, { "database": "PubMed", "id": "15358788", "url": "https://glygen.org/publication/PubMed/15358788" } ] }, { "start_pos": 292, "end_pos": 292, "sequence_org": "D", "sequence_mut": "C", "comment": "Loss of function in the presence of Mg(2+) but not in the presence of Mn(2+), Zn(2+), Co(2+) or Cd(2+).", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" }, { "database": "PubMed", "id": "11742007", "url": "https://glygen.org/publication/PubMed/11742007" }, { "database": "PubMed", "id": "15358788", "url": "https://glygen.org/publication/PubMed/15358788" } ] }, { "start_pos": 30, "end_pos": 30, "sequence_org": "E", "sequence_mut": "A", "comment": "Loss of function but does not abolish ability to bind RNA. Induces a decrease in degradation of mRNAs containing AREs.", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" }, { "database": "PubMed", "id": "11742007", "url": "https://glygen.org/publication/PubMed/11742007" }, { "database": "PubMed", "id": "12748283", "url": "https://glygen.org/publication/PubMed/12748283" }, { "database": "PubMed", "id": "15358788", "url": "https://glygen.org/publication/PubMed/15358788" } ] }, { "start_pos": 30, "end_pos": 30, "sequence_org": "E", "sequence_mut": "C", "comment": "Loss of function in the presence of Mg(2+), Mn(2+), Zn(2+), Co(2+) or Cd(2+).", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" }, { "database": "PubMed", "id": "11742007", "url": "https://glygen.org/publication/PubMed/11742007" }, { "database": "PubMed", "id": "12748283", "url": "https://glygen.org/publication/PubMed/12748283" }, { "database": "PubMed", "id": "15358788", "url": "https://glygen.org/publication/PubMed/15358788" } ] }, { "start_pos": 31, "end_pos": 31, "sequence_org": "F", "sequence_mut": "A", "comment": "Reduced affinity for poly(A). Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" }, { "database": "PubMed", "id": "16281054", "url": "https://glygen.org/publication/PubMed/16281054" } ] }, { "start_pos": 326, "end_pos": 326, "sequence_org": "K", "sequence_mut": "A", "comment": "Reduced affinity for poly(A). Little effect on activity.", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ] }, { "start_pos": 34, "end_pos": 34, "sequence_org": "I", "sequence_mut": "A", "comment": "Reduced affinity for poly(A). Strongly reduced activity.", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" }, { "database": "PubMed", "id": "16281054", "url": "https://glygen.org/publication/PubMed/16281054" } ] }, { "start_pos": 377, "end_pos": 377, "sequence_org": "H", "sequence_mut": "A", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" }, { "database": "PubMed", "id": "16281054", "url": "https://glygen.org/publication/PubMed/16281054" } ] }, { "start_pos": 382, "end_pos": 382, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of function but does not abolish ability to bind RNA. Induces a decrease in degradation of mRNAs containing AREs.", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" }, { "database": "PubMed", "id": "11742007", "url": "https://glygen.org/publication/PubMed/11742007" }, { "database": "PubMed", "id": "12748283", "url": "https://glygen.org/publication/PubMed/12748283" }, { "database": "PubMed", "id": "15358788", "url": "https://glygen.org/publication/PubMed/15358788" } ] }, { "start_pos": 382, "end_pos": 382, "sequence_org": "D", "sequence_mut": "C", "comment": "Loss of function in the presence of Mg(2+) but not in the presence of Mn(2+), Zn(2+), Co(2+) or Cd(2+).", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" }, { "database": "PubMed", "id": "11742007", "url": "https://glygen.org/publication/PubMed/11742007" }, { "database": "PubMed", "id": "12748283", "url": "https://glygen.org/publication/PubMed/12748283" }, { "database": "PubMed", "id": "15358788", "url": "https://glygen.org/publication/PubMed/15358788" } ] }, { "start_pos": 557, "end_pos": 557, "sequence_org": "S", "sequence_mut": "A", "comment": "Strong reduction of phosphorylation by MAPKAPK2.", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "82.19", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000140694", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140694" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "81.4", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000140694", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140694" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "83.17", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000140694", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140694" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000140694", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140694" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "90.4", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000140694", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140694" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "91.35", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000140694", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140694" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "71.45", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000140694", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140694" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "86.58", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000140694", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140694" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "89.62", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000140694", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140694" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "70.63", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000140694", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140694" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "88.39", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000140694", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140694" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "88.39", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000140694", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140694" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "89.68", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000140694", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140694" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O95453", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95453" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O95453", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95453" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O95453", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95453" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O95453", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95453" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O95453", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95453" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O95453", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95453" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O95453", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95453" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O95453", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95453" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O95453", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95453" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O95453", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95453" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O95453", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95453" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O95453", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95453" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "common_name": "Human" } ], "gene": [ { "name": "PARN", "url": "https://www.uniprot.org/uniprot/O95453", "locus": { "chromosome": "16", "start_pos": 14435700, "end_pos": 14632728, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000140694", "url": "https://www.ensembl.org/id/ENSG00000140694" } ] } } ], "crossref": [ { "id": "ENSG00000140694", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140694", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd02637", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd02637", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd12428", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd12428", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL3616362", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3616362", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "PARN", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=PARN", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "5073", "url": "https://www.ncbi.nlm.nih.gov/gene/5073", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "8609", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=8609", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O95453", "url": "https://www.ebi.ac.uk/intact/interactors/id:O95453*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001374", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001374", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006941", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006941", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012337", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012337", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012677", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012677", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014789", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014789", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR034042", "url": "https://www.ebi.ac.uk/interpro/entry/IPR034042", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035979", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035979", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036397", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036397", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036867", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036867", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:5073", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5073", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "604212", "url": "http://www.omim.org/entry/604212", "database": "MIM", "categories": [ "Other" ] }, { "id": "616353", "url": "http://www.omim.org/entry/616353", "database": "MIM", "categories": [ "Other" ] }, { "id": "616371", "url": "http://www.omim.org/entry/616371", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O95453", "url": "https://www.nextprot.org/entry/NX_O95453", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O95453", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95453", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "LTTCHED", "url": "https://omabrowser.org/oma/group/LTTCHED/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "276176at2759", "url": "http://www.orthodb.org/?query=276176at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR15092", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15092", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15092:SF44", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15092:SF44", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2A1R", "url": "https://www.rcsb.org/structure/2A1R", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2A1S", "url": "https://www.rcsb.org/structure/2A1S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3CTR", "url": "https://www.rcsb.org/structure/3CTR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF01424", "url": "http://pfam.xfam.org/family/PF01424", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF04857", "url": "http://pfam.xfam.org/family/PF04857", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF08675", "url": "http://pfam.xfam.org/family/PF08675", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O95453", "url": "https://pharos.nih.gov/targets/O95453", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O95453", "url": "http://purl.obolibrary.org/obo/PR_O95453", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-380994", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380994", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-450604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450604", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001127949", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127949", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A494BZU6", "url": "https://www.uniprot.org/uniprot/A0A494BZU6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494BZU6-1", "url": "https://www.uniprot.org/uniprot/A0A494BZU6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494BZW7", "url": "https://www.uniprot.org/uniprot/A0A494BZW7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494BZW7-1", "url": "https://www.uniprot.org/uniprot/A0A494BZW7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494C002", "url": "https://www.uniprot.org/uniprot/A0A494C002", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494C002-1", "url": "https://www.uniprot.org/uniprot/A0A494C002-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494C008", "url": "https://www.uniprot.org/uniprot/A0A494C008", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494C008-1", "url": "https://www.uniprot.org/uniprot/A0A494C008-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494C0K5", "url": "https://www.uniprot.org/uniprot/A0A494C0K5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494C0K5-1", "url": "https://www.uniprot.org/uniprot/A0A494C0K5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494C0N0", "url": "https://www.uniprot.org/uniprot/A0A494C0N0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494C0N0-1", "url": "https://www.uniprot.org/uniprot/A0A494C0N0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494C0P9", "url": "https://www.uniprot.org/uniprot/A0A494C0P9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494C0P9-1", "url": "https://www.uniprot.org/uniprot/A0A494C0P9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494C0Q2", "url": "https://www.uniprot.org/uniprot/A0A494C0Q2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494C0Q2-1", "url": "https://www.uniprot.org/uniprot/A0A494C0Q2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494C0Q6", "url": "https://www.uniprot.org/uniprot/A0A494C0Q6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494C0Q6-1", "url": "https://www.uniprot.org/uniprot/A0A494C0Q6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494C0W0", "url": "https://www.uniprot.org/uniprot/A0A494C0W0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494C0W0-1", "url": "https://www.uniprot.org/uniprot/A0A494C0W0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494C156", "url": "https://www.uniprot.org/uniprot/A0A494C156", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494C156-1", "url": "https://www.uniprot.org/uniprot/A0A494C156-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494C1G3", "url": "https://www.uniprot.org/uniprot/A0A494C1G3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494C1G3-1", "url": "https://www.uniprot.org/uniprot/A0A494C1G3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494C1K5", "url": "https://www.uniprot.org/uniprot/A0A494C1K5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494C1K5-1", "url": "https://www.uniprot.org/uniprot/A0A494C1K5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494C1N1", "url": "https://www.uniprot.org/uniprot/A0A494C1N1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494C1N1-1", "url": "https://www.uniprot.org/uniprot/A0A494C1N1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TMN8", "url": "https://www.uniprot.org/uniprot/A0A8V8TMN8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TMN8-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TMN8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H1Z4", "url": "https://www.uniprot.org/uniprot/F5H1Z4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H1Z4-1", "url": "https://www.uniprot.org/uniprot/F5H1Z4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BRK1", "url": "https://www.uniprot.org/uniprot/H3BRK1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BRK1-1", "url": "https://www.uniprot.org/uniprot/H3BRK1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BT23", "url": "https://www.uniprot.org/uniprot/H3BT23", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BT23-1", "url": "https://www.uniprot.org/uniprot/H3BT23-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BVG1", "url": "https://www.uniprot.org/uniprot/H3BVG1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BVG1-1", "url": "https://www.uniprot.org/uniprot/H3BVG1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95453-1", "url": "https://www.uniprot.org/uniprot/O95453-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95453-2", "url": "https://www.uniprot.org/uniprot/O95453-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95453-3", "url": "https://www.uniprot.org/uniprot/O95453-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95453-4", "url": "https://www.uniprot.org/uniprot/O95453-4", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIAVNTSKYAESYRIQTYAEYMGRKQEEKQIKRKWTEDSWKEADSKRLNPQCIPYTLQNHYYRNNSFTAPSTVGKRNLSPSQEEAGLEDGVSGEISDTELEQTDSCAEPLSEGRKKAKKLKRMKKELSPAGSISKNSPATLFEVPDTW", "length": 639, "header": "sp|O95453-1|PARN_HUMAN Isoform 1 of Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1 CANONICAL=O95453-1" }, "isoforms": [ { "isoform_ac": "A0A494BZU6-1", "url": "", "sequence": { "sequence": "XAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIVSCRFTLRMRST", "length": 488, "header": "tr|A0A494BZU6-1|PARN_HUMAN Computationally mapped isoform of Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1 CANONICAL=O95453-1" }, "locus": { "chromosome": "16", "start_pos": 14629643, "end_pos": 14551710, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000651913.1", "url": "https://www.ensembl.org/id/ENST00000651913.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000498230.1", "url": "https://www.ensembl.org/id/ENSP00000498230.1" } ] } }, { "isoform_ac": "A0A494BZW7-1", "url": "", "sequence": { "sequence": "MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIGIQAML", "length": 499, "header": "tr|A0A494BZW7-1|A0A494BZW7_HUMAN Computationally mapped isoform of Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1 CANONICAL=O95453-1" }, "locus": { "chromosome": "16", "start_pos": 14630125, "end_pos": 14550580, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000652501.1", "url": "https://www.ensembl.org/id/ENST00000652501.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000498261.1", "url": "https://www.ensembl.org/id/ENSP00000498261.1" } ] } }, { "isoform_ac": "A0A494C002-1", "url": "", "sequence": { "sequence": "MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPAMESHSFTRLECSGMISAPCNIRLLGSSDSPASASRVAGTTGLK", "length": 349, "header": "tr|A0A494C002-1|PARN_HUMAN Computationally mapped isoform of Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1 CANONICAL=O95453-1" }, "locus": { "chromosome": "16", "start_pos": 14630125, "end_pos": 14586354, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000651348.1", "url": "https://www.ensembl.org/id/ENST00000651348.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000498315.1", "url": "https://www.ensembl.org/id/ENSP00000498315.1" } ] } }, { "isoform_ac": "A0A494C008-1", "url": "", "sequence": { "sequence": "MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKRSVSLC", "length": 65, "header": "tr|A0A494C008-1|PARN_HUMAN Computationally mapped isoform of Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1 CANONICAL=O95453-1" }, "locus": { "chromosome": "16", "start_pos": 14630125, "end_pos": 14627802, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000651300.1", "url": "https://www.ensembl.org/id/ENST00000651300.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000498294.1", "url": "https://www.ensembl.org/id/ENSP00000498294.1" } ] } }, { "isoform_ac": "A0A494C0K5-1", "url": "", "sequence": { "sequence": "MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPALSLNFPRCSFCLLHEVFIACYLAQEDLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIAVNTSKYAESYRIQTYAEYMGRKQEEKQIKRKWTEDSWKEADSKRLNPQCIPYTLQNHYYRNNSFTAPSTVGKRNLSPSQEEAGLEDGVSGEISDTELEQTDSCAEPLSEGRKKAKKLKRMKKELSPAGSISKNSPATLFEVPDTW", "length": 614, "header": "tr|A0A494C0K5-1|PARN_HUMAN Computationally mapped isoform of Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1 CANONICAL=O95453-1" }, "locus": { "chromosome": "16", "start_pos": 14630125, "end_pos": 14436720, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000651865.1", "url": "https://www.ensembl.org/id/ENST00000651865.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000498567.1", "url": "https://www.ensembl.org/id/ENSP00000498567.1" } ] } }, { "isoform_ac": "A0A494C0N0-1", "url": "", "sequence": { "sequence": "XFLLFQFGLCTFKYDYTDSNHLTSMFSRNPSIDPHQMSNLFVRAPALTF", "length": 49, "header": "tr|A0A494C0N0-1|PARN_HUMAN Computationally mapped isoform of Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1 CANONICAL=O95453-1" }, "locus": { "chromosome": "16", "start_pos": 14627326, "end_pos": 14617631, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000651760.1", "url": "https://www.ensembl.org/id/ENST00000651760.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000498642.1", "url": "https://www.ensembl.org/id/ENSP00000498642.1" } ] } }, { "isoform_ac": "A0A494C0P9-1", "url": "", "sequence": { "sequence": "MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIVSCRFTLRMRSTCNKLILTLTCSSLYFPPIC", "length": 524, "header": "tr|A0A494C0P9-1|A0A494C0P9_HUMAN Computationally mapped isoform of Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1 CANONICAL=O95453-1" }, "locus": { "chromosome": "16", "start_pos": 14630125, "end_pos": 14551654, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000651027.1", "url": "https://www.ensembl.org/id/ENST00000651027.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000498640.1", "url": "https://www.ensembl.org/id/ENSP00000498640.1" } ] } }, { "isoform_ac": "A0A494C0Q2-1", "url": "", "sequence": { "sequence": "MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIAVNTSKYAESYRIQTYAEYMGRKQEEKQIKRKWTEDSWKEADSKRLNPQCIPYTLQNHYYRNNSDKPRQHSFQMDNQKRELINQDESVIRNQ", "length": 585, "header": "tr|A0A494C0Q2-1|A0A494C0Q2_HUMAN Computationally mapped isoform of Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1 CANONICAL=O95453-1" }, "locus": { "chromosome": "16", "start_pos": 14630125, "end_pos": 14461750, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000651049.1", "url": "https://www.ensembl.org/id/ENST00000651049.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000498644.1", "url": "https://www.ensembl.org/id/ENSP00000498644.1" } ] } }, { "isoform_ac": "A0A494C0Q6-1", "url": "", "sequence": { "sequence": "MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADIINNTSLAELEKRLKETPFNPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDCNIQISWIDDTSAFVSLSQPEQVKIAVNTSKYAESYRIQTYAEYMGRKQEEKQIKRKWTEDSWKEADSKRLNPQCIPYTLQNHYYRNNSFTAPSTVGKRNLSPSQEEAGLEDGVSGEISDTELEQTDSCAEPLSEGRKKAKKLKRMKKELSPAGSISKNSPATLFEVPDTW", "length": 581, "header": "tr|A0A494C0Q6-1|A0A494C0Q6_HUMAN Computationally mapped isoform of Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1 CANONICAL=O95453-1" }, "locus": { "chromosome": "16", "start_pos": 14630125, "end_pos": 14436720, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000652727.1", "url": "https://www.ensembl.org/id/ENST00000652727.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000498650.1", "url": "https://www.ensembl.org/id/ENSP00000498650.1" } ] } }, { "isoform_ac": "A0A494C0W0-1", "url": "", "sequence": { "sequence": "MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPALSLNFPRCSFCLLHEVFIACYLAQEDLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIAVNTSKYAESYRIQTYAEYMGRKQEEKQIKRKWTEDSWKEADSKRLNPQCIPYTLQNHYYRNNSFTAPSTVGKRNLSPSQEEAGLEDGVSGEISDTELEQTDSCAEPLSEGRKKAKKLKRMKKELSPAGSISKNSPATLFEVPDTW", "length": 664, "header": "tr|A0A494C0W0-1|A0A494C0W0_HUMAN Computationally mapped isoform of Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1 CANONICAL=O95453-1" }, "locus": { "chromosome": "16", "start_pos": 14630125, "end_pos": 14436720, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000650990.1", "url": "https://www.ensembl.org/id/ENST00000650990.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000498741.1", "url": "https://www.ensembl.org/id/ENSP00000498741.1" } ] } }, { "isoform_ac": "A0A494C156-1", "url": "", "sequence": { "sequence": "MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKVSLCCQAGVQWRNLDSLQLLPPGFK", "length": 446, "header": "tr|A0A494C156-1|PARN_HUMAN Computationally mapped isoform of Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1 CANONICAL=O95453-1" }, "locus": { "chromosome": "16", "start_pos": 14630125, "end_pos": 14558414, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000652051.1", "url": "https://www.ensembl.org/id/ENST00000652051.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000498898.1", "url": "https://www.ensembl.org/id/ENSP00000498898.1" } ] } }, { "isoform_ac": "A0A494C1G3-1", "url": "", "sequence": { "sequence": "XSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPALSLNFPRCSFCLLHEVFIACYLAQEDLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIDGVSLCWTGCSQTPSDLPASASQSAGITGMRHHAWPAF", "length": 458, "header": "tr|A0A494C1G3-1|PARN_HUMAN Computationally mapped isoform of Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1 CANONICAL=O95453-1" }, "locus": { "chromosome": "16", "start_pos": 14627137, "end_pos": 14531061, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000652066.1", "url": "https://www.ensembl.org/id/ENST00000652066.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000499051.1", "url": "https://www.ensembl.org/id/ENSP00000499051.1" } ] } }, { "isoform_ac": "A0A494C1K5-1", "url": "", "sequence": { "sequence": "MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIAVNTSKYAESYRIQTYAEYMGRKQEEKQIKRKWTEDSWKEADSKRLNPQCIPYTLQNHYYRNNSFRISSRIPYYIWPSYLHRLL", "length": 577, "header": "tr|A0A494C1K5-1|A0A494C1K5_HUMAN Computationally mapped isoform of Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1 CANONICAL=O95453-1" }, "locus": { "chromosome": "16", "start_pos": 14630125, "end_pos": 14461210, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000651634.1", "url": "https://www.ensembl.org/id/ENST00000651634.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000499078.1", "url": "https://www.ensembl.org/id/ENSP00000499078.1" } ] } }, { "isoform_ac": "A0A494C1N1-1", "url": "", "sequence": { "sequence": "MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIAVNTSKYAESYRIQTYAEYMGRKQEEKQIKRKWTEDSWKEADSKRLNPQCIPYTLQNHYYRNNRQGLILLPRLECSGTITACCSFDLLGSSDPPTST", "length": 590, "header": "tr|A0A494C1N1-1|A0A494C1N1_HUMAN Computationally mapped isoform of Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1 CANONICAL=O95453-1" }, "locus": { "chromosome": "16", "start_pos": 14630125, "end_pos": 14482289, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000650960.1", "url": "https://www.ensembl.org/id/ENST00000650960.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000499110.1", "url": "https://www.ensembl.org/id/ENSP00000499110.1" } ] } }, { "isoform_ac": "A0A8V8TMN8-1", "url": "", "sequence": { "sequence": "MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIAVNTSKYAESYRIQTYAEYMGRKQEEKQIKRKWTEDSWKEADSKRLNPQCIPYTLQNHYYRNNSFTAPSTVGKRNLSPSQEEAGLEDGVSGEISDTELEQTDSCAEPLSEGRKKAKKLKRMKKELSPAGLYWILPKFWGRGLFKCSRNSYFGGEIIARLHLVAKPM", "length": 659, "header": "tr|A0A8V8TMN8-1|A0A8V8TMN8_HUMAN Computationally mapped isoform of Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1 CANONICAL=O95453-1" }, "locus": { "chromosome": "16", "start_pos": 14630125, "end_pos": 14446775, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000697474.1", "url": "https://www.ensembl.org/id/ENST00000697474.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000513329.1", "url": "https://www.ensembl.org/id/ENSP00000513329.1" } ] } }, { "isoform_ac": "F5H1Z4-1", "url": "", "sequence": { "sequence": "MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKRSDI", "length": 207, "header": "tr|F5H1Z4-1|F5H1Z4_HUMAN Computationally mapped isoform of Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1 CANONICAL=O95453-1" }, "locus": { "chromosome": "HSCHR16_1_CTG1", "start_pos": 202981, "end_pos": 177071, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000634095.1", "url": "https://www.ensembl.org/id/ENST00000634095.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000487870.1", "url": "https://www.ensembl.org/id/ENSP00000487870.1" } ] } }, { "isoform_ac": "H3BRK1-1", "url": "", "sequence": { "sequence": "XANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLFLMRVMDIPYLNLEGPD", "length": 261, "header": "tr|H3BRK1-1|PARN_HUMAN Computationally mapped isoform of Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1 CANONICAL=O95453-1" }, "locus": { "chromosome": "16", "start_pos": 14610743, "end_pos": 14555654, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000569444.5", "url": "https://www.ensembl.org/id/ENST00000569444.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000456279.1", "url": "https://www.ensembl.org/id/ENSP00000456279.1" } ] } }, { "isoform_ac": "H3BT23-1", "url": "", "sequence": { "sequence": "MGSRCVFQADLEHMASRDPPASALQSAAITDFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYIT", "length": 109, "header": "tr|H3BT23-1|H3BT23_HUMAN Computationally mapped isoform of Poly(A)-specific ribonuclease OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1 CANONICAL=O95453-1" }, "locus": { "chromosome": "HSCHR16_1_CTG1", "start_pos": 205336, "end_pos": 200034, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000633129.1", "url": "https://www.ensembl.org/id/ENST00000633129.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000488491.1", "url": "https://www.ensembl.org/id/ENSP00000488491.1" } ] } }, { "isoform_ac": "H3BVG1-1", "url": "", "sequence": { "sequence": "MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKVYNEVI", "length": 65, "header": "tr|H3BVG1-1|H3BVG1_HUMAN Computationally mapped isoform of Poly(A)-specific ribonuclease OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1 CANONICAL=O95453-1" }, "locus": { "chromosome": "HSCHR16_1_CTG1", "start_pos": 202981, "end_pos": 200026, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000632226.1", "url": "https://www.ensembl.org/id/ENST00000632226.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000488466.1", "url": "https://www.ensembl.org/id/ENSP00000488466.1" } ] } }, { "isoform_ac": "O95453-1", "url": "", "sequence": { "sequence": "MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIAVNTSKYAESYRIQTYAEYMGRKQEEKQIKRKWTEDSWKEADSKRLNPQCIPYTLQNHYYRNNSFTAPSTVGKRNLSPSQEEAGLEDGVSGEISDTELEQTDSCAEPLSEGRKKAKKLKRMKKELSPAGSISKNSPATLFEVPDTW", "length": 639, "header": "sp|O95453-1|PARN_HUMAN Isoform 1 of Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1 CANONICAL=O95453-1" }, "locus": { "chromosome": "HSCHR16_1_CTG1", "start_pos": 202981, "end_pos": 9577, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000615183.4", "url": "https://www.ensembl.org/id/ENST00000615183.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000478668.1", "url": "https://www.ensembl.org/id/ENSP00000478668.1" } ] } }, { "isoform_ac": "O95453-2", "url": "", "sequence": { "sequence": "MDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIAVNTSKYAESYRIQTYAEYMGRKQEEKQIKRKWTEDSWKEADSKRLNPQCIPYTLQNHYYRNNSFTAPSTVGKRNLSPSQEEAGLEDGVSGEISDTELEQTDSCAEPLSEGRKKAKKLKRMKKELSPAGSISKNSPATLFEVPDTW", "length": 578, "header": "sp|O95453-2|PARN_HUMAN Isoform 2 of Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1 CANONICAL=O95453-1" }, "locus": { "chromosome": "HSCHR16_1_CTG1", "start_pos": 200186, "end_pos": 9577, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000634004.1", "url": "https://www.ensembl.org/id/ENST00000634004.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000487634.1", "url": "https://www.ensembl.org/id/ENSP00000487634.1" } ] } }, { "isoform_ac": "O95453-3", "url": "", "sequence": { "sequence": "MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIAVNTSKYAESYRIQTYAEYMGRKQEEKQIKRKWTEDSWKEADSKRLNPQCIPYTLQNHYYRNNSFTAPSTVGKRNLSPSQEEAGLEDGVSGEISDTELEQTDSCAEPLSEGRKKAKKLKRMKKELSPAGSISKNSPATLFEVPDTW", "length": 593, "header": "sp|O95453-3|PARN_HUMAN Isoform 3 of Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1 CANONICAL=O95453-1" }, "locus": { "chromosome": "HSCHR16_1_CTG1", "start_pos": 202981, "end_pos": 9577, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000618929.2", "url": "https://www.ensembl.org/id/ENST00000618929.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000484279.1", "url": "https://www.ensembl.org/id/ENSP00000484279.1" } ] } }, { "isoform_ac": "O95453-4", "url": "", "sequence": { "sequence": "MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIAVNTSKYAESYRIQTYAEYMGRKQEEKQIKRKWTEDSWKEADSKRLNPQCIPYTLQNHYYRNNSFTAPSTVGKRNLSPSQEEAGLEDGVSGEISDTELEQTDSCAEPLSEGRKKAKKLKRMKKELSPAGSISKNSPATLFEVPDTW", "length": 464, "header": "sp|O95453-4|PARN_HUMAN Isoform 4 of Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1 CANONICAL=O95453-1" }, "locus": { "chromosome": "16", "start_pos": 14630125, "end_pos": 14436720, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000539279.5", "url": "https://www.ensembl.org/id/ENST00000539279.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000444381.1", "url": "https://www.ensembl.org/id/ENSP00000444381.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O95453", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95453" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" } ] } ], "phosphorylation": [ { "start_pos": 151, "end_pos": 151, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95453", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95453" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser151" }, { "start_pos": 160, "end_pos": 160, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95453", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95453" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser160" }, { "start_pos": 163, "end_pos": 163, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" }, { "database": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "O95453", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95453" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "phospho.ELM", "id": "O95453", "url": "http://phospho.elm.eu.org/byAccession/O95453.html" } ], "site_lbl": "Ser163" }, { "start_pos": 166, "end_pos": 166, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95453", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95453" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "O95453", "url": "http://phospho.elm.eu.org/byAccession/O95453.html" } ], "site_lbl": "Thr166" }, { "start_pos": 167, "end_pos": 167, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O95453", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95453" } ], "site_lbl": "Ser167" }, { "start_pos": 530, "end_pos": 530, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O95453", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95453" } ], "site_lbl": "Ser530" }, { "start_pos": 557, "end_pos": 557, "kinase_uniprot_canonical_ac": "P49137-1", "kinase_gene_name": "MAPKAPK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95453", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95453" }, { "database": "PubMed", "id": "20932473", "url": "https://glygen.org/publication/PubMed/20932473" } ], "site_lbl": "Ser557" }, { "start_pos": 557, "end_pos": 557, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by MAPKAPK2", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" }, { "database": "iPTMnet", "id": "O95453", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95453" }, { "database": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" }, { "database": "PubMed", "id": "18212344", "url": "https://glygen.org/publication/PubMed/18212344" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" }, { "database": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "O95453", "url": "http://phospho.elm.eu.org/byAccession/O95453.html" }, { "database": "PubMed", "id": "31387300", "url": "https://glygen.org/publication/PubMed/31387300" }, { "database": "PubMed", "id": "20932473", "url": "https://glygen.org/publication/PubMed/20932473" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ], "site_lbl": "Ser557" }, { "start_pos": 570, "end_pos": 570, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95453", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95453" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "O95453", "url": "http://phospho.elm.eu.org/byAccession/O95453.html" } ], "site_lbl": "Ser570" }, { "start_pos": 572, "end_pos": 572, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95453", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95453" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "phospho.ELM", "id": "O95453", "url": "http://phospho.elm.eu.org/byAccession/O95453.html" } ], "site_lbl": "Ser572" }, { "start_pos": 583, "end_pos": 583, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" }, { "database": "iPTMnet", "id": "O95453", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95453" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "O95453", "url": "http://phospho.elm.eu.org/byAccession/O95453.html" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Ser583" }, { "start_pos": 587, "end_pos": 587, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" }, { "database": "iPTMnet", "id": "O95453", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95453" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "phospho.ELM", "id": "O95453", "url": "http://phospho.elm.eu.org/byAccession/O95453.html" } ], "site_lbl": "Ser587" }, { "start_pos": 589, "end_pos": 589, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95453", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95453" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "phospho.ELM", "id": "O95453", "url": "http://phospho.elm.eu.org/byAccession/O95453.html" } ], "site_lbl": "Thr589" }, { "start_pos": 619, "end_pos": 619, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "O95453", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95453" }, { "database": "PubMed", "id": "17322306", "url": "https://glygen.org/publication/PubMed/17322306" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "27920218", "url": "" }, { "database": "phospho.ELM", "id": "O95453", "url": "http://phospho.elm.eu.org/byAccession/O95453.html" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Ser619" }, { "start_pos": 623, "end_pos": 623, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "O95453", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95453" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ], "site_lbl": "Ser623" }, { "start_pos": 628, "end_pos": 628, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "iPTMnet", "id": "O95453", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95453" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ], "site_lbl": "Ser628" }, { "start_pos": 631, "end_pos": 631, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "iPTMnet", "id": "O95453", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95453" } ], "site_lbl": "Thr631" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Isolation and characterization of human orthologs of yeast CCR4-NOT complex subunits.", "journal": "Nucleic acids research", "date": "2000", "authors": "Albert TK, Lemaire M, van Berkum NL, Gentz R, Collart MA, Timmers HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "10637334", "url": "https://glygen.org/publication/PubMed/10637334" } ] }, { "title": "The human gene for the poly(A)-specific ribonuclease (PARN) maps to 16p13 and has a truncated copy in the Prader-Willi/Angelman syndrome region on 15q11-->q13.", "journal": "Cytogenet. Cell Genet.", "date": "1999", "authors": "Buiting K, Korner C, Ulrich B, Wahle E, Horsthemke B", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "reference": [ { "type": "PubMed", "id": "10640832", "url": "https://glygen.org/publication/PubMed/10640832" } ] }, { "title": "Cap-dependent deadenylation of mRNA.", "journal": "The EMBO journal", "date": "2000", "authors": "Dehlin E, Wormington M, Korner CG, Wahle E", "evidence": [ { "database": "RefSeq", "id": "NP_001127949", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127949" } ], "reference": [ { "type": "PubMed", "id": "10698948", "url": "https://glygen.org/publication/PubMed/10698948" } ] }, { "title": "A 54-kDa fragment of the Poly(A)-specific ribonuclease is an oligomeric, processive, and cap-interacting Poly(A)-specific 3' exonuclease.", "journal": "J. Biol. Chem.", "date": "2000", "authors": "Martinez J, Ren Y G, Thuresson A C, Hellman U, Astrom J, Virtanen A", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "reference": [ { "type": "PubMed", "id": "10801819", "url": "https://glygen.org/publication/PubMed/10801819" } ] }, { "title": "Interaction between a poly(A)-specific ribonuclease and the 5' cap influences mRNA deadenylation rates in vitro.", "journal": "Molecular cell", "date": "2000", "authors": "Gao M, Fritz DT, Ford LP, Wilusz J", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" }, { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "10882133", "url": "https://glygen.org/publication/PubMed/10882133" } ] }, { "title": "ATF6 activated by proteolysis binds in the presence of NF-Y (CBF) directly to the cis-acting element responsible for the mammalian unfolded protein response.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Yoshida H, Okada T, Haze K, Yanagi H, Yura T, Negishi M, Mori K", "evidence": [ { "database": "Reactome", "id": "R-HSA-380994", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380994" } ], "reference": [ { "type": "PubMed", "id": "10958673", "url": "https://glygen.org/publication/PubMed/10958673" } ] }, { "title": "The cap-to-tail guide to mRNA turnover.", "journal": "Nature reviews. Molecular cell biology", "date": "2001", "authors": "Wilusz CJ, Wormington M, Peltz SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "11283721", "url": "https://glygen.org/publication/PubMed/11283721" } ] }, { "title": "The mRNA cap structure stimulates rate of poly(A) removal and amplifies processivity of degradation.", "journal": "The Journal of biological chemistry", "date": "2001-07-27", "authors": "Mart\u00eenez J, Ren Y G, Nilsson P, Ehrenberg M, Virtanen A", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "reference": [ { "type": "PubMed", "id": "11359775", "url": "https://glygen.org/publication/PubMed/11359775" } ] }, { "title": "AU binding proteins recruit the exosome to degrade ARE-containing mRNAs.", "journal": "Cell", "date": "2001", "authors": "Chen CY, Gherzi R, Ong SE, Chan EL, Raijmakers R, Pruijn GJ, Stoecklin G, Moroni C, Mann M, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-450604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450604" } ], "reference": [ { "type": "PubMed", "id": "11719186", "url": "https://glygen.org/publication/PubMed/11719186" } ] }, { "title": "Identification of the active site of poly(A)-specific ribonuclease by site-directed mutagenesis and Fe(2+)-mediated cleavage.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Ren YG, Martinez J, Virtanen A", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "reference": [ { "type": "PubMed", "id": "11742007", "url": "https://glygen.org/publication/PubMed/11742007" } ] }, { "title": "CCR4, a 3'-5' poly(A) RNA and ssDNA exonuclease, is the catalytic component of the cytoplasmic deadenylase.", "journal": "The EMBO journal", "date": "2002", "authors": "Chen J, Chiang YC, Denis CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "11889047", "url": "https://glygen.org/publication/PubMed/11889047" } ] }, { "title": "Functional proteomic analysis of human nucleolus.", "journal": "Mol. Biol. Cell", "date": "2002", "authors": "Scherl A, Coute Y, Deon C, Calle A, Kindbeiter K, Sanchez JC, Greco A, Hochstrasser D, Diaz JJ", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "reference": [ { "type": "PubMed", "id": "12429849", "url": "https://glygen.org/publication/PubMed/12429849" } ] }, { "title": "Tristetraprolin and its family members can promote the cell-free deadenylation of AU-rich element-containing mRNAs by poly(A) ribonuclease.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Lai WS, Kennington EA, Blackshear PJ", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "reference": [ { "type": "PubMed", "id": "12748283", "url": "https://glygen.org/publication/PubMed/12748283" } ] }, { "title": "Properties of a HeLa cell 3' exonuclease specific for degrading poly(A) tails of mammalian mRNA.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Astrom J, Astrom A, Virtanen A", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "1355481", "url": "https://glygen.org/publication/PubMed/1355481" } ] }, { "title": "Nonsense-mediated mRNA decay in mammalian cells involves decapping, deadenylating, and exonucleolytic activities.", "journal": "Mol. Cell", "date": "2003", "authors": "Lejeune F, Li X, Maquat LE", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "reference": [ { "type": "PubMed", "id": "14527413", "url": "https://glygen.org/publication/PubMed/14527413" } ] }, { "title": "Identification of a human cytoplasmic poly(A) nuclease complex stimulated by poly(A)-binding protein.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Uchida N, Hoshino S, Katada T", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "14583602", "url": "https://glygen.org/publication/PubMed/14583602" } ] }, { "title": "Facilitation of mRNA deadenylation and decay by the exosome-bound, DExH protein RHAU.", "journal": "Mol. Cell", "date": "2004", "authors": "Tran H, Schilling M, Wirbelauer C, Hess D, Nagamine Y", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "reference": [ { "type": "PubMed", "id": "14731398", "url": "https://glygen.org/publication/PubMed/14731398" } ] }, { "title": "Herp is dually regulated by both the endoplasmic reticulum stress-specific branch of the unfolded protein response and a branch that is shared with other cellular stress pathways.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Ma Y, Hendershot LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-380994", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380994" } ], "reference": [ { "type": "PubMed", "id": "14742429", "url": "https://glygen.org/publication/PubMed/14742429" } ] }, { "title": "The enzymes and control of eukaryotic mRNA turnover.", "journal": "Nature structural & molecular biology", "date": "2004", "authors": "Parker R, Song H", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "14749774", "url": "https://glygen.org/publication/PubMed/14749774" } ] }, { "title": "A KH domain RNA binding protein, KSRP, promotes ARE-directed mRNA turnover by recruiting the degradation machinery.", "journal": "Molecular cell", "date": "2004", "authors": "Gherzi R, Lee KY, Briata P, Wegmuller D, Moroni C, Karin M, Chen CY", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" }, { "database": "Reactome", "id": "R-HSA-450604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450604" } ], "reference": [ { "type": "PubMed", "id": "15175153", "url": "https://glygen.org/publication/PubMed/15175153" } ] }, { "title": "Coordination of divalent metal ions in the active site of poly(A)-specific ribonuclease.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Ren YG, Kirsebom LA, Virtanen A", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "reference": [ { "type": "PubMed", "id": "15358788", "url": "https://glygen.org/publication/PubMed/15358788" } ] }, { "title": "Amino acid deprivation induces the transcription rate of the human asparagine synthetase gene through a timed program of expression and promoter binding of nutrient-responsive basic region/leucine zipper transcription factors as well as localized histone acetylation.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Chen H, Pan YX, Dudenhausen EE, Kilberg MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-380994", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380994" } ], "reference": [ { "type": "PubMed", "id": "15385533", "url": "https://glygen.org/publication/PubMed/15385533" } ] }, { "title": "Messenger RNA decay in mammalian cells: the exonuclease perspective.", "journal": "Cell biochemistry and biophysics", "date": "2004", "authors": "Fritz DT, Bergman N, Kilpatrick WJ, Wilusz CJ, Wilusz J", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "15475613", "url": "https://glygen.org/publication/PubMed/15475613" } ] }, { "title": "IL-1beta induces stabilization of IL-8 mRNA in malignant breast cancer cells via the 3' untranslated region: Involvement of divergent RNA-binding factors HuR, KSRP and TIAR.", "journal": "International journal of cancer", "date": "2005", "authors": "Suswam EA, Nabors LB, Huang Y, Yang X, King PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-450604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450604" } ], "reference": [ { "type": "PubMed", "id": "15514971", "url": "https://glygen.org/publication/PubMed/15514971" } ] }, { "title": "From birth to death: the complex lives of eukaryotic mRNAs.", "journal": "Science (New York, N.Y.)", "date": "2005", "authors": "Moore MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "16141059", "url": "https://glygen.org/publication/PubMed/16141059" } ] }, { "title": "Structural insight into poly(A) binding and catalytic mechanism of human PARN.", "journal": "The EMBO journal", "date": "2005", "authors": "Wu M, Reuter M, Lilie H, Liu Y, Wahle E, Song H", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "reference": [ { "type": "PubMed", "id": "16281054", "url": "https://glygen.org/publication/PubMed/16281054" } ] }, { "title": "Concerted action of poly(A) nucleases and decapping enzyme in mammalian mRNA turnover.", "journal": "Nature structural & molecular biology", "date": "2005", "authors": "Yamashita A, Chang TC, Yamashita Y, Zhu W, Zhong Z, Chen CY, Shyu AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "16284618", "url": "https://glygen.org/publication/PubMed/16284618" } ] }, { "title": "p38-dependent phosphorylation of the mRNA decay-promoting factor KSRP controls the stability of select myogenic transcripts.", "journal": "Molecular cell", "date": "2005", "authors": "Briata P, Forcales SV, Ponassi M, Corte G, Chen CY, Karin M, Puri PL, Gherzi R", "evidence": [ { "database": "Reactome", "id": "R-HSA-450604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450604" } ], "reference": [ { "type": "PubMed", "id": "16364914", "url": "https://glygen.org/publication/PubMed/16364914" } ] }, { "title": "CUG-BP binds to RNA substrates and recruits PARN deadenylase.", "journal": "RNA", "date": "2006", "authors": "Moraes Karen C M, Wilusz Carol J, Wilusz Jeffrey", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "reference": [ { "type": "PubMed", "id": "16601207", "url": "https://glygen.org/publication/PubMed/16601207" } ] }, { "title": "Tethering KSRP, a decay-promoting AU-rich element-binding protein, to mRNAs elicits mRNA decay.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Chou CF, Mulky A, Maitra S, Lin WJ, Gherzi R, Kappes J, Chen CY", "evidence": [ { "database": "Reactome", "id": "R-HSA-450604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450604" } ], "reference": [ { "type": "PubMed", "id": "16648466", "url": "https://glygen.org/publication/PubMed/16648466" } ] }, { "title": "Endoplasmic reticulum stress induction of insulin-like growth factor-binding protein-1 involves ATF4.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Marchand A, Tomkiewicz C, Magne L, Barouki R, Garlatti M", "evidence": [ { "database": "Reactome", "id": "R-HSA-380994", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380994" } ], "reference": [ { "type": "PubMed", "id": "16687408", "url": "https://glygen.org/publication/PubMed/16687408" } ] }, { "title": "Identification of inflammatory gene modules based on variations of human endothelial cell responses to oxidized lipids.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Gargalovic PS, Imura M, Zhang B, Gharavi NM, Clark MJ, Pagnon J, Yang WP, He A, Truong A, Patel S, Nelson SF, Horvath S, Berliner JA, Kirchgessner TG, Lusis AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-380994", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380994" } ], "reference": [ { "type": "PubMed", "id": "16912112", "url": "https://glygen.org/publication/PubMed/16912112" } ] }, { "title": "The unfolded protein response is an important regulator of inflammatory genes in endothelial cells.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2006", "authors": "Gargalovic PS, Gharavi NM, Clark MJ, Pagnon J, Yang WP, He A, Truong A, Baruch-Oren T, Berliner JA, Kirchgessner TG, Lusis AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-380994", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380994" } ], "reference": [ { "type": "PubMed", "id": "16931790", "url": "https://glygen.org/publication/PubMed/16931790" } ] }, { "title": "A probability-based approach for high-throughput protein phosphorylation analysis and site localization.", "journal": "Nature biotechnology", "date": "2006", "authors": "Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" }, { "database": "iPTMnet", "id": "O95453-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95453-1" } ], "reference": [ { "type": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" } ] }, { "title": "Activation of the ATF3 gene through a co-ordinated amino acid-sensing response programme that controls transcriptional regulation of responsive genes following amino acid limitation.", "journal": "The Biochemical journal", "date": "2007", "authors": "Pan YX, Chen H, Thiaville MM, Kilberg MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-380994", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380994" } ], "reference": [ { "type": "PubMed", "id": "16989641", "url": "https://glygen.org/publication/PubMed/16989641" } ] }, { "title": "Opposing polymerase-deadenylase activities regulate cytoplasmic polyadenylation.", "journal": "Molecular cell", "date": "2006", "authors": "Kim JH, Richter JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "17052452", "url": "https://glygen.org/publication/PubMed/17052452" } ] }, { "title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.", "journal": "Cell", "date": "2006", "authors": "Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O95453-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95453-1" } ], "reference": [ { "type": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ] }, { "title": "The RNA-binding protein KSRP promotes decay of beta-catenin mRNA and is inactivated by PI3K-AKT signaling.", "journal": "PLoS biology", "date": "2006", "authors": "Gherzi R, Trabucchi M, Ponassi M, Ruggiero T, Corte G, Moroni C, Chen CY, Khabar KS, Andersen JS, Briata P", "evidence": [ { "database": "Reactome", "id": "R-HSA-450604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450604" } ], "reference": [ { "type": "PubMed", "id": "17177604", "url": "https://glygen.org/publication/PubMed/17177604" } ] }, { "title": "The highways and byways of mRNA decay.", "journal": "Nature reviews. Molecular cell biology", "date": "2007", "authors": "Garneau NL, Wilusz J, Wilusz CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "17245413", "url": "https://glygen.org/publication/PubMed/17245413" } ] }, { "title": "Phosphopeptide enrichment by aliphatic hydroxy acid-modified metal oxide chromatography for nano-LC-MS/MS in proteomics applications.", "journal": "Molecular & cellular proteomics : MCP", "date": "2007", "authors": "Sugiyama N, Masuda T, Shinoda K, Nakamura A, Tomita M, Ishihama Y", "evidence": [ { "database": "iPTMnet", "id": "O95453-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95453-1" } ], "reference": [ { "type": "PubMed", "id": "17322306", "url": "https://glygen.org/publication/PubMed/17322306" } ] }, { "title": "Poly(A) nuclease interacts with the C-terminal domain of polyadenylate-binding protein domain from poly(A)-binding protein.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Siddiqui N, Mangus DA, Chang TC, Palermino JM, Shyu AB, Gehring K", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "17595167", "url": "https://glygen.org/publication/PubMed/17595167" } ] }, { "title": "Hydrophilic interaction chromatography reduces the complexity of the phosphoproteome and improves global phosphopeptide isolation and detection.", "journal": "Molecular & cellular proteomics : MCP", "date": "2008", "authors": "McNulty DE, Annan RS", "evidence": [ { "database": "iPTMnet", "id": "O95453-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95453-1" } ], "reference": [ { "type": "PubMed", "id": "18212344", "url": "https://glygen.org/publication/PubMed/18212344" } ] }, { "title": "HepG2/C3A cells respond to cysteine deprivation by induction of the amino acid deprivation/integrated stress response pathway.", "journal": "Physiological genomics", "date": "2008", "authors": "Lee JI, Dominy JE Jr, Sikalidis AK, Hirschberger LL, Wang W, Stipanuk MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-380994", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380994" } ], "reference": [ { "type": "PubMed", "id": "18285520", "url": "https://glygen.org/publication/PubMed/18285520" } ] }, { "title": "Deadenylation is prerequisite for P-body formation and mRNA decay in mammalian cells.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Zheng D, Ezzeddine N, Chen CY, Zhu W, He X, Shyu AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "18625844", "url": "https://glygen.org/publication/PubMed/18625844" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "O95453-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95453-1" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "The sequence selectivity of KSRP explains its flexibility in the recognition of the RNA targets.", "journal": "Nucleic acids research", "date": "2008", "authors": "Garcia-Mayoral MF, Diaz-Moreno I, Hollingworth D, Ramos A", "evidence": [ { "database": "Reactome", "id": "R-HSA-450604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450604" } ], "reference": [ { "type": "PubMed", "id": "18684992", "url": "https://glygen.org/publication/PubMed/18684992" } ] }, { "title": "Successive and selective release of phosphorylated peptides captured by hydroxy acid-modified metal oxide chromatography.", "journal": "Journal of proteome research", "date": "2008", "authors": "Kyono Y, Sugiyama N, Imami K, Tomita M, Ishihama Y", "evidence": [ { "database": "iPTMnet", "id": "O95453-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95453-1" } ], "reference": [ { "type": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" } ] }, { "title": "Transcriptional induction of the human asparagine synthetase gene during the unfolded protein response does not require the ATF6 and IRE1/XBP1 arms of the pathway.", "journal": "The Biochemical journal", "date": "2009", "authors": "Gjymishka A, Su N, Kilberg MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-380994", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380994" } ], "reference": [ { "type": "PubMed", "id": "18840095", "url": "https://glygen.org/publication/PubMed/18840095" } ] }, { "title": "Identification of mRNA binding proteins that regulate the stability of LDL receptor mRNA through AU-rich elements.", "journal": "Journal of lipid research", "date": "2009", "authors": "Li H, Chen W, Zhou Y, Abidi P, Sharpe O, Robinson WH, Kraemer FB, Liu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-450604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450604" } ], "reference": [ { "type": "PubMed", "id": "19141871", "url": "https://glygen.org/publication/PubMed/19141871" } ] }, { "title": "Phosphorylation-mediated unfolding of a KH domain regulates KSRP localization via 14-3-3 binding.", "journal": "Nature structural & molecular biology", "date": "2009", "authors": "Diaz-Moreno I, Hollingworth D, Frenkiel TA, Kelly G, Martin S, Howell S, Garcia-Mayoral M, Gherzi R, Briata P, Ramos A", "evidence": [ { "database": "Reactome", "id": "R-HSA-450604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450604" } ], "reference": [ { "type": "PubMed", "id": "19198587", "url": "https://glygen.org/publication/PubMed/19198587" } ] }, { "title": "The many pathways of RNA degradation.", "journal": "Cell", "date": "2009", "authors": "Houseley J, Tollervey D", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "19239894", "url": "https://glygen.org/publication/PubMed/19239894" } ] }, { "title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.", "journal": "Analytical chemistry", "date": "2009", "authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S", "evidence": [ { "database": "iPTMnet", "id": "O95453-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95453-1" } ], "reference": [ { "type": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ] }, { "title": "Human Ccr4-Not complexes contain variable deadenylase subunits.", "journal": "The Biochemical journal", "date": "2009", "authors": "Lau NC, Kolkman A, van Schaik FM, Mulder KW, Pijnappel WW, Heck AJ, Timmers HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "19558367", "url": "https://glygen.org/publication/PubMed/19558367" } ] }, { "title": "Lysine acetylation targets protein complexes and co-regulates major cellular functions.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "reference": [ { "type": "PubMed", "id": "19608861", "url": "https://glygen.org/publication/PubMed/19608861" } ] }, { "title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Pan C, Olsen JV, Daub H, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O95453-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95453-1" } ], "reference": [ { "type": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ] }, { "title": "Phosphorylation dynamics during early differentiation of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Van Hoof D, Munoz J, Braam SR, Pinkse MW, Linding R, Heck AJ, Mummery CL, Krijgsveld J", "evidence": [ { "database": "iPTMnet", "id": "O95453-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95453-1" } ], "reference": [ { "type": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" } ] }, { "title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.", "journal": "Science signaling", "date": "2009", "authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" }, { "database": "iPTMnet", "id": "O95453", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95453" } ], "reference": [ { "type": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" } ] }, { "title": "Transcriptional and post-transcriptional regulation of iNOS expression in human chondrocytes.", "journal": "Biochemical pharmacology", "date": "2010", "authors": "Schmidt N, Pautz A, Art J, Rauschkolb P, Jung M, Erkel G, Goldring MB, Kleinert H", "evidence": [ { "database": "Reactome", "id": "R-HSA-450604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450604" } ], "reference": [ { "type": "PubMed", "id": "19854161", "url": "https://glygen.org/publication/PubMed/19854161" } ] }, { "title": "Regulation of endoplasmic reticulum stress-induced cell death by ATF4 in neuroectodermal tumor cells.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Armstrong JL, Flockhart R, Veal GJ, Lovat PE, Redfern CP", "evidence": [ { "database": "Reactome", "id": "R-HSA-380994", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380994" } ], "reference": [ { "type": "PubMed", "id": "20022965", "url": "https://glygen.org/publication/PubMed/20022965" } ] }, { "title": "Exploring the human leukocyte phosphoproteome using a microfluidic reversed-phase-TiO2-reversed-phase high-performance liquid chromatography phosphochip coupled to a quadrupole time-of-flight mass spectrometer.", "journal": "Analytical chemistry", "date": "2010", "authors": "Raijmakers R, Kraiczek K, de Jong AP, Mohammed S, Heck AJ", "evidence": [ { "database": "iPTMnet", "id": "O95453-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95453-1" } ], "reference": [ { "type": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" }, { "database": "iPTMnet", "id": "O95453-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95453-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Gene expression and integrated stress response in HepG2/C3A cells cultured in amino acid deficient medium.", "journal": "Amino acids", "date": "2011", "authors": "Sikalidis AK, Lee JI, Stipanuk MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-380994", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380994" } ], "reference": [ { "type": "PubMed", "id": "20361218", "url": "https://glygen.org/publication/PubMed/20361218" } ] }, { "title": "DNA damage activates a spatially distinct late cytoplasmic cell-cycle checkpoint network controlled by MK2-mediated RNA stabilization.", "journal": "Molecular cell", "date": "2010", "authors": "Reinhardt HC, Hasskamp P, Schmedding I, Morandell S, van Vugt MA, Wang X, Linding R, Ong SE, Weaver D, Carr SA, Yaffe MB", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" }, { "database": "iPTMnet", "id": "O95453", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95453" } ], "reference": [ { "type": "PubMed", "id": "20932473", "url": "https://glygen.org/publication/PubMed/20932473" } ] }, { "title": "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.", "journal": "Science signaling", "date": "2011", "authors": "Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" }, { "database": "iPTMnet", "id": "O95453", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95453" } ], "reference": [ { "type": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" } ] }, { "title": "Zinc-finger antiviral protein inhibits HIV-1 infection by selectively targeting multiply spliced viral mRNAs for degradation.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2011", "authors": "Zhu Y, Chen G, Lv F, Wang X, Ji X, Xu Y, Sun J, Wu L, Zheng YT, Gao G", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "reference": [ { "type": "PubMed", "id": "21876179", "url": "https://glygen.org/publication/PubMed/21876179" } ] }, { "title": "Maturation of mammalian H/ACA box snoRNAs: PAPD5-dependent adenylation and PARN-dependent trimming.", "journal": "RNA (New York, N.Y.)", "date": "2012-05", "authors": "Berndt Heike, Harnisch Christiane, Rammelt Christiane, St\u00f6hr Nadine, Zirkel Anne, Dohm Juliane C, Himmelbauer Heinz, Tavanez Joao-Paulo, H\u00fcttelmaier Stefan, Wahle Elmar", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "reference": [ { "type": "PubMed", "id": "22442037", "url": "https://glygen.org/publication/PubMed/22442037" } ] }, { "title": "Gene regulatory network of unfolded protein response genes in endoplasmic reticulum stress.", "journal": "Cell stress & chaperones", "date": "2013", "authors": "Takayanagi S, Fukuda R, Takeuchi Y, Tsukada S, Yoshida K", "evidence": [ { "database": "Reactome", "id": "R-HSA-380994", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380994" } ], "reference": [ { "type": "PubMed", "id": "22802018", "url": "https://glygen.org/publication/PubMed/22802018" } ] }, { "title": "3,3'-diindolylmethane induces activating transcription factor 3 (ATF3) via ATF4 in human colorectal cancer cells.", "journal": "The Journal of nutritional biochemistry", "date": "2013", "authors": "Lee SH, Min KW, Zhang X, Baek SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-380994", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380994" } ], "reference": [ { "type": "PubMed", "id": "22819556", "url": "https://glygen.org/publication/PubMed/22819556" } ] }, { "title": "Dynamic changes in genomic histone association and modification during activation of the ASNS and ATF3 genes by amino acid limitation.", "journal": "The Biochemical journal", "date": "2013", "authors": "Balasubramanian MN, Shan J, Kilberg MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-380994", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380994" } ], "reference": [ { "type": "PubMed", "id": "22978410", "url": "https://glygen.org/publication/PubMed/22978410" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" }, { "database": "iPTMnet", "id": "O95453", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95453" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Elevated cJUN expression and an ATF/CRE site within the ATF3 promoter contribute to activation of ATF3 transcription by the amino acid response.", "journal": "Physiological genomics", "date": "2013", "authors": "Fu L, Kilberg MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-380994", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380994" } ], "reference": [ { "type": "PubMed", "id": "23269699", "url": "https://glygen.org/publication/PubMed/23269699" } ] }, { "title": "Proteome wide purification and identification of O-GlcNAc-modified proteins using click chemistry and mass spectrometry.", "journal": "Journal of proteome research", "date": "2013", "authors": "Hahne H, Sobotzki N, Nyberg T, Helm D, Borodkin VS, van Aalten DM, Agnew B, Kuster B", "evidence": [ { "database": "O-GlcNAc Database", "id": "O95453", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95453" } ], "reference": [ { "type": "PubMed", "id": "23301498", "url": "https://glygen.org/publication/PubMed/23301498" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "iPTMnet", "id": "O95453", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95453" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "PAPD5-mediated 3' adenylation and subsequent degradation of miR-21 is disrupted in proliferative disease.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014-08-05", "authors": "Boele Joost, Persson Helena, Shin Jay W, Ishizu Yuri, Newie Inga S, S\u00f8kilde Rolf, Hawkins Shannon M, Coarfa Cristian, Ikeda Kazuhiro, Takayama Ken-ichi, Horie-Inoue Kuniko, Ando Yoshinari, Burroughs A Maxwell, Sasaki Chihiro, Suzuki Chizuru, Sakai Mizuho, Aoki Shintaro, Ogawa Ayumi, Hasegawa Akira, Lizio Marina, Kaida Kaoru, Teusink Bas, Carninci Piero, Suzuki Harukazu, Inoue Satoshi, Gunaratne Preethi H, Rovira Carlos, Hayashizaki Yoshihide, de Hoon Michiel J L", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "reference": [ { "type": "PubMed", "id": "25049417", "url": "https://glygen.org/publication/PubMed/25049417" } ] }, { "title": "Uridylation by TUT4 and TUT7 marks mRNA for degradation.", "journal": "Cell", "date": "2014", "authors": "Lim J, Ha M, Chang H, Kwon SC, Simanshu DK, Patel DJ, Kim VN", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "25480299", "url": "https://glygen.org/publication/PubMed/25480299" } ] }, { "title": "Exome sequencing links mutations in PARN and RTEL1 with familial pulmonary fibrosis and telomere shortening.", "journal": "Nature genetics", "date": "2015", "authors": "Stuart BD, Choi J, Zaidi S, Xing C, Holohan B, Chen R, Choi M, Dharwadkar P, Torres F, Girod CE, Weissler J, Fitzgerald J, Kershaw C, Klesney-Tait J, Mageto Y, Shay JW, Ji W, Bilguvar K, Mane S, Lifton RP, Garcia CK", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "reference": [ { "type": "PubMed", "id": "25848748", "url": "https://glygen.org/publication/PubMed/25848748" } ] }, { "title": "Poly(A)-specific ribonuclease deficiency impacts telomere biology and causes dyskeratosis congenita.", "journal": "The Journal of clinical investigation", "date": "2015", "authors": "Tummala H, Walne A, Collopy L, Cardoso S, de la Fuente J, Lawson S, Powell J, Cooper N, Foster A, Mohammed S, Plagnol V, Vulliamy T, Dokal I", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "reference": [ { "type": "PubMed", "id": "25893599", "url": "https://glygen.org/publication/PubMed/25893599" } ] }, { "title": "Genomic structure of the human monocyte-derived neutrophil chemotactic factor IL-8.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1989", "authors": "Mukaida N, Shiroo M, Matsushima K", "evidence": [ { "database": "Reactome", "id": "R-HSA-380994", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380994" } ], "reference": [ { "type": "PubMed", "id": "2663993", "url": "https://glygen.org/publication/PubMed/2663993" } ] }, { "title": "Regulation of the mRNA for monocyte-derived neutrophil-activating peptide in differentiating HL60 promyelocytes.", "journal": "Molecular and cellular biology", "date": "1989", "authors": "Kowalski J, Denhardt DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-380994", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380994" } ], "reference": [ { "type": "PubMed", "id": "2664463", "url": "https://glygen.org/publication/PubMed/2664463" } ] }, { "title": "Regulation of the ATF3 gene by a single promoter in response to amino acid availability and endoplasmic reticulum stress in human primary hepatocytes and hepatoma cells.", "journal": "Biochimica et biophysica acta. Gene regulatory mechanisms", "date": "2018", "authors": "Hayner JN, Shan J, Kilberg MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-380994", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380994" } ], "reference": [ { "type": "PubMed", "id": "29413899", "url": "https://glygen.org/publication/PubMed/29413899" } ] }, { "title": "The Intrinsically Disordered C-Terminal Domain Triggers Nucleolar Localization and Function Switch of PARN in Response to DNA Damage.", "journal": "Cells", "date": "2019", "authors": "Duan TL, He GJ, Hu LD, Yan YB", "evidence": [ { "database": "RefSeq", "id": "NP_001127949", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127949" }, { "database": "iPTMnet", "id": "O95453", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95453" } ], "reference": [ { "type": "PubMed", "id": "31387300", "url": "https://glygen.org/publication/PubMed/31387300" } ] }, { "title": "From incomplete penetrance with normal telomere length to severe disease and telomere shortening in a family with monoallelic and biallelic PARN pathogenic variants.", "journal": "Human mutation", "date": "2019", "authors": "Dodson LM, Baldan A, Nissbeck M, Gunja SMR, Bonnen PE, Aubert G, Birchansky S, Virtanen A, Bertuch AA", "evidence": [ { "database": "RefSeq", "id": "NP_001127949", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127949" } ], "reference": [ { "type": "PubMed", "id": "31448843", "url": "https://glygen.org/publication/PubMed/31448843" } ] }, { "title": "Translation Efficiency and Degradation of ER-Associated mRNAs Modulated by ER-Anchored poly(A)-Specific Ribonuclease (PARN).", "journal": "Cells", "date": "2020", "authors": "Duan TL, Jiao H, He GJ, Yan YB", "evidence": [ { "database": "RefSeq", "id": "NP_001127949", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127949" } ], "reference": [ { "type": "PubMed", "id": "31936572", "url": "https://glygen.org/publication/PubMed/31936572" } ] }, { "title": "Regulation of poly(a)-specific ribonuclease activity by reversible lysine acetylation.", "journal": "The Journal of biological chemistry", "date": "2020", "authors": "Dejene EA, Li Y, Showkatian Z, Ling H, Seto E", "evidence": [ { "database": "RefSeq", "id": "NP_001127949", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127949" } ], "reference": [ { "type": "PubMed", "id": "32457045", "url": "https://glygen.org/publication/PubMed/32457045" } ] }, { "title": "Molecular cloning of a human monocyte-derived neutrophil chemotactic factor (MDNCF) and the induction of MDNCF mRNA by interleukin 1 and tumor necrosis factor.", "journal": "The Journal of experimental medicine", "date": "1988", "authors": "Matsushima K, Morishita K, Yoshimura T, Lavu S, Kobayashi Y, Lew W, Appella E, Kung HF, Leonard EJ, Oppenheim JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-380994", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380994" } ], "reference": [ { "type": "PubMed", "id": "3260265", "url": "https://glygen.org/publication/PubMed/3260265" } ] }, { "title": "Poly(A) tail shortening by a mammalian poly(A)-specific 3'-exoribonuclease.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Korner CG, Wahle E", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "9099687", "url": "https://glygen.org/publication/PubMed/9099687" } ] }, { "title": "The deadenylating nuclease (DAN) is involved in poly(A) tail removal during the meiotic maturation of Xenopus oocytes.", "journal": "The EMBO journal", "date": "1998", "authors": "Korner CG, Wormington M, Muckenthaler M, Schneider S, Dehlin E, Wahle E", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" }, { "database": "RefSeq", "id": "NP_001127949", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127949" } ], "reference": [ { "type": "PubMed", "id": "9736620", "url": "https://glygen.org/publication/PubMed/9736620" } ] } ], "pathway": [ { "id": "hsa:5073", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5073", "resource": "KEGG Pathway" }, { "id": "R-HSA-380994", "name": "ATF4 activates genes in response to endoplasmic reticulum stress", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380994", "resource": "Reactome", "description": "ATF4 activates genes in response to endoplasmic reticulum stress" }, { "id": "R-HSA-429947", "name": "Deadenylation of mRNA", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947", "resource": "Reactome", "description": "Deadenylation of mRNA" }, { "id": "R-HSA-450604", "name": "KSRP (KHSRP) binds and destabilizes mRNA", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450604", "resource": "Reactome", "description": "KSRP (KHSRP) binds and destabilizes mRNA" } ], "orthologs": [ { "uniprot_canonical_ac": "Q8VDG3-1", "protein_name": "Poly(A)-specific ribonuclease PARN", "gene_name": "Parn", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MEIIRSNFKINLHKVYQAIEEADFFAIDGEFSGISDGPSVTALTSGFDTPEERYQKLKKHSMDFLLFQFGLCAFKYDHTDSKHVTKSFNFYVFPKPFSRSSPDVKFVCQSSSIDFLASQGFDFNKVFCSGIPYLNQEEERQLREQFDEKRSQANGAGALAKCPVTIPEDQKKFIDQVIEKIEDFLQSEEKRSLELDPCTGFQRKLIYQTLSWKYPKGIHVETLETDKKERHIVISKVDEEERKRREQEKYTKEQEELNDAVGFSRVIHAIANSGKLVVGHNMLLDVMHTIHQFYCPLPADLNEFKEMAICVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFDPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSLLSPPKMCVSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVQIAVNTSKYAESYRIQTYAEYVGKKQEGKQVKRKWTEDSWKEVDRKRPHMQGPCYHSNSFTAAGVLGKRTLSPDPREAALEDRESEEVSDSELEQTDSCTDPLPEGRKKSKKLKRMKKELSLAGSVSDSPAVLFEVPDTW", "length": 624 }, "evidence": [ { "id": "45919181", "url": "http://www.informatics.jax.org/homology/45919181", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 9, "go_terms": [ { "name": "nucleic acid binding", "id": "GO:0003676", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003676", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "pmid": "" }, { "name": "poly(A)-specific ribonuclease activity", "id": "GO:0004535", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004535", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "pmid": "" }, { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "pmid": "" }, { "name": "protein kinase binding", "id": "GO:0019901", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019901", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "pmid": "" }, { "name": "mRNA 3'-UTR binding", "id": "GO:0003730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003730", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "pmid": "" }, { "name": "nuclease activity", "id": "GO:0004518", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004518", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "pmid": "" }, { "name": "telomerase RNA binding", "id": "GO:0070034", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070034", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "pmid": "" }, { "name": "cation binding", "id": "GO:0043169", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043169", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "pmid": "" }, { "name": "nuclear speck", "id": "GO:0016607", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016607", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "pmid": "" }, { "name": "glutamatergic synapse", "id": "GO:0098978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098978", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "pmid": "" }, { "name": "nucleolus", "id": "GO:0005730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "pmid": "" }, { "name": "postsynapse", "id": "GO:0098794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098794", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 13, "go_terms": [ { "name": "mRNA catabolic process", "id": "GO:0006402", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006402", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "pmid": "" }, { "name": "ncRNA deadenylation", "id": "GO:0110008", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0110008", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "pmid": "" }, { "name": "positive regulation of telomere maintenance via telomerase", "id": "GO:0032212", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032212", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "pmid": "" }, { "name": "positive regulation of telomerase activity", "id": "GO:0051973", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051973", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "pmid": "" }, { "name": "nuclear-transcribed mRNA catabolic process, nonsense-mediated decay", "id": "GO:0000184", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000184", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "pmid": "" }, { "name": "RNA modification", "id": "GO:0009451", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009451", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "pmid": "" }, { "name": "female gamete generation", "id": "GO:0007292", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007292", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "pmid": "" }, { "name": "box H/ACA RNA 3'-end processing", "id": "GO:0000495", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000495", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "pmid": "" }, { "name": "nuclear-transcribed mRNA poly(A) tail shortening", "id": "GO:0000289", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000289", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "pmid": "" }, { "name": "telomerase RNA stabilization", "id": "GO:0090669", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090669", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "pmid": "" }, { "name": "regulation of telomerase RNA localization to Cajal body", "id": "GO:1904872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904872", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "pmid": "" }, { "name": "miRNA catabolic process", "id": "GO:0010587", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010587", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "pmid": "" }, { "name": "polyadenylation-dependent snoRNA 3'-end processing", "id": "GO:0071051", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071051", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 165, "end_pos": 167, "annotation": "n_glycosylation_sequon" }, { "start_pos": 339, "end_pos": 341, "annotation": "n_glycosylation_sequon" }, { "start_pos": 340, "end_pos": 342, "annotation": "n_glycosylation_sequon" }, { "start_pos": 496, "end_pos": 498, "annotation": "n_glycosylation_sequon" }, { "start_pos": 555, "end_pos": 557, "annotation": "n_glycosylation_sequon" }, { "start_pos": 568, "end_pos": 570, "annotation": "n_glycosylation_sequon" }, { "start_pos": 98, "end_pos": 100, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylation by MAPKAPK2, preventing GADD45A mRNA degradation after genotoxic stress.", "evidence": [ { "database": "UniProtKB", "id": "O95453", "url": "https://www.uniprot.org/uniprot/O95453" }, { "database": "PubMed", "id": "20932473", "url": "https://glygen.org/publication/PubMed/20932473" } ] } ], "interactions": [], "reactions": [ { "id": "R-HSA-429992", "name": "PARN deadenylates mRNA", "equation": "", "summary": "The PARN exoribonuclease hydrolyzes adenosine residues at the 3' ends of polyadenylated mRNA, shortening the poly(A) tail from about 80 adenosine residues to about 10-15 residues and yielding adenosine 5'-monophosphate. PARN interacts simultaneously with the poly(A) tail and with the 7-methylguanosine cap of the mRNA, therefore it is believed that PARN displaces the eIF4F cap-binding complex. The trigger for deadenylation by PARN is unknown. PARN is also part of a complex that regulates poly(A) tail length and hence translation in developing oocytes.", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P60842-1", "Q14240-1", "P38919-1", "O95453-1" ], "evidence": [ { "id": "R-HSA-429992", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429992" } ] }, { "id": "R-HSA-450422", "name": "KSRP recruits RNA degradation activities", "equation": "", "summary": "KSRP (KHSRP) forms a complex with the PARN deadenylase, exosome components (3' to 5' mRNA decay), and the decapping enzyme DCP2. Tethering KSRP to a mRNA is sufficient to target the mRNA for degradation.", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9Y2L1-1", "O95453-1", "Q8IU60-1" ], "evidence": [ { "id": "R-HSA-450422", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450422" } ] }, { "id": "R-HSA-517731", "name": "Expression of IL-8", "equation": "", "summary": "The IL-8 gene is transcribed to yield mRNA which is translated to yield protein.", "cellular_location": "extracellular region, nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9Y2L1-1", "O95453-1", "Q8IU60-1" ], "evidence": [ { "id": "R-HSA-517731", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-517731" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "O95453", "gene_name": "PARN", "activity": [ { "ec_number": "3.1.13.4", "activity": "Exonucleolytic cleavage of poly(A) to 5'-AMP.", "evidence": [ { "id": "O95453", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95453" } ] }, { "ec_number": "3.1.13.4", "activity": "", "evidence": [ { "id": "O95453", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95453" } ] } ] }, { "uniprot_ac": "P38919", "gene_name": "EIF4A3", "activity": [ { "ec_number": "3.6.4.13", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "P38919", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38919" } ] }, { "ec_number": "3.6.4.13", "activity": "", "evidence": [ { "id": "P38919", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38919" } ] } ] }, { "uniprot_ac": "P60842", "gene_name": "EIF4A1", "activity": [ { "ec_number": "3.6.4.13", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "P60842", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60842" } ] }, { "ec_number": "3.6.4.13", "activity": "", "evidence": [ { "id": "P60842", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60842" } ] } ] }, { "uniprot_ac": "Q14240", "gene_name": "EIF4A2", "activity": [ { "ec_number": "3.6.4.13", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "Q14240", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14240" } ] }, { "ec_number": "3.6.4.13", "activity": "", "evidence": [ { "id": "Q14240", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14240" } ] } ] }, { "uniprot_ac": "Q8IU60", "gene_name": "DCP2", "activity": [ { "ec_number": "3.6.1.62", "activity": "a 5'-end (N(7)-methyl 5'-triphosphoguanosine)-ribonucleoside in mRNA + H2O = a 5'-end phospho-ribonucleoside in mRNA + 2 H(+) + N(7)-methyl-GDP.", "evidence": [ { "id": "Q8IU60", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IU60" } ] }, { "ec_number": "3.6.1.62", "activity": "", "evidence": [ { "id": "Q8IU60", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IU60" } ] } ] }, { "uniprot_ac": "Q9Y2L1", "gene_name": "DIS3", "activity": [ { "ec_number": "3.1.13.-", "activity": "", "evidence": [ { "id": "Q9Y2L1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2L1" } ] }, { "ec_number": "3.1.26.-", "activity": "", "evidence": [ { "id": "Q9Y2L1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2L1" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 151, 160, 163, 166, 167, 530, 557, 570, 572, 583, 587, 589, 619, 623, 628, 631 ], "sequon_annotation_sites": [ { "start_pos": 165, "end_pos": 167 }, { "start_pos": 339, "end_pos": 341 }, { "start_pos": 340, "end_pos": 342 }, { "start_pos": 496, "end_pos": 498 }, { "start_pos": 555, "end_pos": 557 }, { "start_pos": 568, "end_pos": 570 }, { "start_pos": 98, "end_pos": 100 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 17 }, { "field": "total_sites", "count": 16 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 87 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }