{ "uniprot_canonical_ac": "O95395-1", "uniprot_ac": "O95395", "uniprot_id": "GCNT3_HUMAN", "mass": { "chemical_mass": 50864.0, "monoisotopic_mass": 50864.0 }, "refseq": { "ac": "NP_004742", "name": "beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 isoform 1", "summary": "This gene encodes a member of the N-acetylglucosaminyltransferase family. The encoded protein is a beta-6-N-acetylglucosamine-transferase that catalyzes the formation of core 2 and core 4 O-glycans on mucin-type glycoproteins.[provided by RefSeq, Apr 2009].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004742" }, "gene_names": [ { "name": "GCNT3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O95395", "id": "O95395" }, { "name": "C2/4GnT; C24GNT; C2GNT2; C2GNTM; GNTM", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004742", "id": "NP_004742" }, { "name": "GCNT3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004742", "id": "NP_004742" } ], "protein_names": [ { "name": "Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O95395" }, { "name": "2.4.1.102", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95395" }, { "name": "2.4.1.148", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95395" }, { "name": "2.4.1.150", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95395" }, { "name": "C2/4GnT", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95395" }, { "name": "C2GnT-M", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95395" }, { "name": "C2GnT-mucin type", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95395" }, { "name": "Core 2/core 4 beta-1,6-N-acetylglucosaminyltransferase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95395" }, { "name": "beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004742", "id": "NP_004742" }, { "name": "beta1,6-N-acetylglucosaminyltransferase-M; core 2/core 4 beta-1,6-N-acetylglucosaminyltransferase; C2GnT-mucin type; beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3; beta1,6GlcNAc-transferase; mucus-type core 2 beta-1,6-N-acetylglucosaminyltransferase; hC2GnT-M", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004742", "id": "NP_004742" }, { "name": "hC2GnT-M", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95395" } ], "function": [ { "annotation": "EGF suppressed C2GnT activity in a time- and dose-dependent fashion, and also suppressed core 4 beta1,6 N-acetylglucosaminyltransferase (C4GnT) activity", "evidence": [ { "database": "RefSeq", "id": "NP_004742", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004742" }, { "database": "PubMed", "id": "12600830", "url": "https://glygen.org/publication/PubMed/12600830" } ] }, { "annotation": "Frequently downregulated in colorectal cancer and suppresses colon cancer cell growth.", "evidence": [ { "database": "RefSeq", "id": "NP_004742", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004742" }, { "database": "PubMed", "id": "16418723", "url": "https://glygen.org/publication/PubMed/16418723" } ] }, { "annotation": "Functional analysis of GCNT3 for cell migration and EMT of castration-resistant prostate cancer cells.", "evidence": [ { "database": "RefSeq", "id": "NP_004742", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004742" }, { "database": "PubMed", "id": "35867813", "url": "https://glygen.org/publication/PubMed/35867813" } ] }, { "annotation": "GCNT3 was regarded as an oncogene in non-small cell lung cancer, and a target of miR-302b-3p, which regulated cell proliferation, migration and invasion in a GCNT3-dependent manner and E-cadherin, N-cadherin, vimentin, cyclin D1 and p-Erk appeared to be downstream molecules of the miR-302b-3p/GCNT3 pathway.", "evidence": [ { "database": "RefSeq", "id": "NP_004742", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004742" }, { "database": "PubMed", "id": "30355927", "url": "https://glygen.org/publication/PubMed/30355927" } ] }, { "annotation": "Global analysis of human glycosyltransferases reveals novel targets for pancreatic cancer pathogenesis. Erratum:[Br J Cancer. 2020 Apr 14;:. PMID: 32286491]", "evidence": [ { "database": "RefSeq", "id": "NP_004742", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004742" }, { "database": "PubMed", "id": "32203219", "url": "https://glygen.org/publication/PubMed/32203219" } ] }, { "annotation": "Glycosyltransferase that can synthesize all known mucin beta 6 N-acetylglucosaminides. Mediates core 2 and core 4 O-glycan branching, 2 important steps in mucin-type biosynthesis. Has also I-branching enzyme activity by converting linear into branched poly-N-acetyllactosaminoglycans, leading to introduce the blood group I antigen during embryonic development.", "evidence": [ { "database": "UniProtKB", "id": "O95395", "url": "https://www.uniprot.org/uniprot/O95395#function" }, { "database": "PubMed", "id": "9915862", "url": "https://glygen.org/publication/PubMed/9915862" } ] }, { "annotation": "High GCNT3 expression is associated with metastatic melanomas.", "evidence": [ { "database": "RefSeq", "id": "NP_004742", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004742" }, { "database": "PubMed", "id": "28923134", "url": "https://glygen.org/publication/PubMed/28923134" } ] }, { "annotation": "LINC00511 enhances LUAD malignancy by upregulating GCNT3 via miR-195-5p. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_004742", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004742" }, { "database": "PubMed", "id": "35399076", "url": "https://glygen.org/publication/PubMed/35399076" } ] }, { "annotation": "Results describe the identification of the cis-regulatory elements of human C2GnT-M gene.", "evidence": [ { "database": "RefSeq", "id": "NP_004742", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004742" }, { "database": "PubMed", "id": "17303715", "url": "https://glygen.org/publication/PubMed/17303715" } ] }, { "annotation": "This gene encodes a member of the N-acetylglucosaminyltransferase family. The encoded protein is a beta-6-N-acetylglucosamine-transferase that catalyzes the formation of core 2 and core 4 O-glycans on mucin-type glycoproteins.[provided by RefSeq, Apr 2009].", "evidence": [ { "database": "RefSeq", "id": "NP_004742", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004742" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs989440515", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs989440515" }, { "id": "rs989440515", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs989440515#frequency_tab" }, { "id": "rs989440515", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs989440515" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 227, "end_pos": 227, "sequence_org": "C", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NTC->NTS).", "chr_id": "15", "chr_pos": "59618917", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "C227", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs768707580", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768707580" }, { "id": "rs768707580", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768707580" }, { "id": "rs768707580", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768707580" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 252, "end_pos": 252, "sequence_org": "M", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSM->NST).", "chr_id": "15", "chr_pos": "59618993", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "M252", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs376831624", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs376831624" }, { "id": "rs376831624", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs376831624" }, { "id": "rs376831624", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs376831624#frequency_tab" }, { "id": "rs376831624", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs376831624" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 289, "end_pos": 289, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->HLT).", "chr_id": "15", "chr_pos": "59619103", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N289", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs771093896", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771093896" }, { "id": "rs771093896", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771093896" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 28, "end_pos": 28, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KLS->NLS).", "chr_id": "15", "chr_pos": "59618322", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K28", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs771713772", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771713772" }, { "id": "rs771713772", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs771713772" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 353, "end_pos": 353, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DIS->NIS).", "chr_id": "15", "chr_pos": "59619295", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D353", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1566908861", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1566908861" }, { "id": "rs1566908861", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1566908861" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 401, "end_pos": 401, "sequence_org": "M", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NWM->NWT).", "chr_id": "15", "chr_pos": "59619440", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "M401", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O95395", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95395" }, { "id": "rs1187042097", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1187042097" }, { "id": "rs1187042097", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1187042097" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 65, "end_pos": 65, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "K", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (KRS->NRS).", "chr_id": "15", "chr_pos": "59618433", "ref_nt": "G", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "K65", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "66.42", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000140297", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140297" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "91.58", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000140297", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140297" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "81.29", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000140297", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140297" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000140297", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140297" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "56.66", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000140297", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140297" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "98.66", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000140297", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140297" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "89.52", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000140297", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140297" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "59.37", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000140297", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140297" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "62.9", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000140297", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140297" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000140297", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140297" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "51.57", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000140297", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140297" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "65.49", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000140297", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140297" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "51.97", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000140297", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140297" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O95395", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95395" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O95395", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95395" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O95395", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95395" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O95395", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95395" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O95395", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95395" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O95395", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95395" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O95395", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95395" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O95395", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95395" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O95395", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95395" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O95395", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95395" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O95395", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95395" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O95395", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95395" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95395", "url": "https://www.uniprot.org/uniprot/O95395" } ], "common_name": "Human" } ], "gene": [ { "name": "GCNT3", "url": "https://www.uniprot.org/uniprot/O95395", "locus": { "chromosome": "15", "start_pos": 59640239, "end_pos": 59594875, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000140297", "url": "https://www.ensembl.org/id/ENSG00000140297" } ] } } ], "crossref": [ { "id": "ENSG00000140297", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140297", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O95395", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95395", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "2.4.1.102", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.4.1.102&UniProtAcc=O95395", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "2.4.1.150", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.4.1.150&UniProtAcc=O95395", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "GT14", "url": "http://www.cazy.org/GT14.html", "database": "CAZy", "categories": [ "Protein Classification" ] }, { "id": "GCNT3", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=GCNT3", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "9245", "url": "https://www.ncbi.nlm.nih.gov/gene/9245", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "4205", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=4205", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O95395", "url": "https://www.ebi.ac.uk/intact/interactors/id:O95395*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR003406", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003406", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:9245", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9245", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "606836", "url": "http://www.omim.org/entry/606836", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O95395", "url": "https://www.nextprot.org/entry/NX_O95395", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "CRDILYK", "url": "https://omabrowser.org/oma/group/CRDILYK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5403607at2759", "url": "http://www.orthodb.org/?query=5403607at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR19297", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19297", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR19297:SF81", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19297:SF81", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF02485", "url": "http://pfam.xfam.org/family/PF02485", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O95395", "url": "https://pharos.nih.gov/targets/O95395", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O95395", "url": "http://purl.obolibrary.org/obo/PR_O95395", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-913709", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-913709", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_004742", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004742", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "54820", "url": "https://www.rhea-db.org/rhea/54820", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "56188", "url": "https://www.rhea-db.org/rhea/56188", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "56192", "url": "https://www.rhea-db.org/rhea/56192", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "56212", "url": "https://www.rhea-db.org/rhea/56212", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "56216", "url": "https://www.rhea-db.org/rhea/56216", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "H0YM40", "url": "https://www.uniprot.org/uniprot/H0YM40", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YM40-1", "url": "https://www.uniprot.org/uniprot/H0YM40-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YMW7", "url": "https://www.uniprot.org/uniprot/H0YMW7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YMW7-1", "url": "https://www.uniprot.org/uniprot/H0YMW7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YNA3", "url": "https://www.uniprot.org/uniprot/H0YNA3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YNA3-1", "url": "https://www.uniprot.org/uniprot/H0YNA3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95395", "url": "https://www.uniprot.org/uniprot/O95395", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95395-1", "url": "https://www.uniprot.org/uniprot/O95395-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVQWKRLCQLHYLWALGCYMLLATVALKLSFRLKCDSDHLGLESRESQSQYCRNILYNFLKLPAKRSINCSGVTRGDQEAVLQAILNNLEVKKKREPFTDTHYLSLTRDCEHFKAERKFIQFPLSKEEVEFPIAYSMVIHEKIENFERLLRAVYAPQNIYCVHVDEKSPETFKEAVKAIISCFPNVFIASKLVRVVYASWSRVQADLNCMEDLLQSSVPWKYFLNTCGTDFPIKSNAEMVQALKMLNGRNSMESEVPPKHKETRWKYHFEVVRDTLHLTNKKKDPPPYNLTMFTGNAYIVASRDFVQHVLKNPKSQQLIEWVKDTYSPDEHLWATLQRARWMPGSVPNHPKYDISDMTSIARLVKWQGHEGDIDKGAPYAPCSGIHQRAICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL", "length": 438, "header": "sp|O95395-1|GCNT3_HUMAN Isoform 1 of Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=GCNT3 PE=2 SV=1 CANONICAL=O95395-1" }, "isoforms": [ { "isoform_ac": "H0YM40-1", "url": "", "sequence": { "sequence": "MVQWKRLCQLHYLWALGCYMLLATVALKLSFRLKCDSDHLGLESRESQSQYCRNILYNFLKLPAKRSINCSGVTRGDQEAVLQAILN", "length": 87, "header": "tr|H0YM40-1|H0YM40_HUMAN Computationally mapped isoform of Glucosaminyl (N-acetyl) transferase 3, mucin type OS=Homo sapiens OX=9606 GN=GCNT3 PE=1 SV=1 CANONICAL=O95395-1" }, "locus": { "chromosome": "15", "start_pos": 59618499, "end_pos": 59618239, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000559189.5", "url": "https://www.ensembl.org/id/ENST00000559189.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000453453.1", "url": "https://www.ensembl.org/id/ENSP00000453453.1" } ] } }, { "isoform_ac": "H0YMW7-1", "url": "", "sequence": { "sequence": "MVQWKRLCQLHYLWALGCYMLLATVALKLSFRLKCDSDHLGLESRESQSQYCRNILYNFLKLPAKRSINCSGVTRGDQEAVLQAILNNLEVKKKREPFTDTHYLSLTRDCEHFKAERKFIQFPLSKEEVEFPIAYSMVIHEKIENFERLLRAV", "length": 153, "header": "tr|H0YMW7-1|GCNT3_HUMAN Computationally mapped isoform of Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=GCNT3 PE=2 SV=1 CANONICAL=O95395-1" }, "locus": { "chromosome": "15", "start_pos": 59618697, "end_pos": 59618239, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000559200.1", "url": "https://www.ensembl.org/id/ENST00000559200.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000453774.1", "url": "https://www.ensembl.org/id/ENSP00000453774.1" } ] } }, { "isoform_ac": "H0YNA3-1", "url": "", "sequence": { "sequence": "MVQWKRLCQLHYLWALGCYMLLATVALKLSFRLKCDSDHLGLESRESQSQYCR", "length": 53, "header": "tr|H0YNA3-1|H0YNA3_HUMAN Computationally mapped isoform of Glucosaminyl (N-acetyl) transferase 3, mucin type OS=Homo sapiens OX=9606 GN=GCNT3 PE=1 SV=1 CANONICAL=O95395-1" }, "locus": { "chromosome": "15", "start_pos": 59618397, "end_pos": 59618239, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000559626.1", "url": "https://www.ensembl.org/id/ENST00000559626.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000453928.1", "url": "https://www.ensembl.org/id/ENSP00000453928.1" } ] } }, { "isoform_ac": "O95395-1", "url": "", "sequence": { "sequence": "MVQWKRLCQLHYLWALGCYMLLATVALKLSFRLKCDSDHLGLESRESQSQYCRNILYNFLKLPAKRSINCSGVTRGDQEAVLQAILNNLEVKKKREPFTDTHYLSLTRDCEHFKAERKFIQFPLSKEEVEFPIAYSMVIHEKIENFERLLRAVYAPQNIYCVHVDEKSPETFKEAVKAIISCFPNVFIASKLVRVVYASWSRVQADLNCMEDLLQSSVPWKYFLNTCGTDFPIKSNAEMVQALKMLNGRNSMESEVPPKHKETRWKYHFEVVRDTLHLTNKKKDPPPYNLTMFTGNAYIVASRDFVQHVLKNPKSQQLIEWVKDTYSPDEHLWATLQRARWMPGSVPNHPKYDISDMTSIARLVKWQGHEGDIDKGAPYAPCSGIHQRAICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL", "length": 438, "header": "sp|O95395-1|GCNT3_HUMAN Isoform 1 of Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=GCNT3 PE=2 SV=1 CANONICAL=O95395-1" }, "locus": { "chromosome": "15", "start_pos": 59619552, "end_pos": 59618239, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000396065.3", "url": "https://www.ensembl.org/id/ENST00000396065.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000379377.1", "url": "https://www.ensembl.org/id/ENSP00000379377.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 289, "start_aa": "Asn", "end_pos": 289, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn289", "evidence": [ { "id": "O95395", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95395#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycosyltransferase-activity", "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Sulfotransferases of two specificities function in the reconstitution of high endothelial cell ligands for L-selectin.", "journal": "The Journal of cell biology", "date": "1999", "authors": "Bistrup A, Bhakta S, Lee JK, Belov YY, Gunn MD, Zuo FR, Huang CC, Kannagi R, Rosen SD, Hemmerich S", "evidence": [ { "database": "Reactome", "id": "R-HSA-913709", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-913709" } ], "reference": [ { "type": "PubMed", "id": "10330415", "url": "https://glygen.org/publication/PubMed/10330415" } ] }, { "title": "Expression cloning of a human alpha1, 4-N-acetylglucosaminyltransferase that forms GlcNAcalpha1-->4Galbeta-->R, a glycan specifically expressed in the gastric gland mucous cell-type mucin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Nakayama J, Yeh JC, Misra AK, Ito S, Katsuyama T, Fukuda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-913709", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-913709" } ], "reference": [ { "type": "PubMed", "id": "10430883", "url": "https://glygen.org/publication/PubMed/10430883" } ] }, { "title": "Control of O-glycan branch formation. Molecular cloning and characterization of a novel thymus-associated core 2 beta1, 6-n-acetylglucosaminyltransferase.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Schwientek T, Yeh JC, Levery SB, Keck B, Merkx G, van Kessel AG, Fukuda M, Clausen H", "evidence": [ { "database": "Reactome", "id": "R-HSA-913709", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-913709" } ], "reference": [ { "type": "PubMed", "id": "10753916", "url": "https://glygen.org/publication/PubMed/10753916" } ] }, { "title": "Identification and characterization of three novel beta 1,3-N-acetylglucosaminyltransferases structurally related to the beta 1,3-galactosyltransferase family.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Shiraishi N, Natsume A, Togayachi A, Endo T, Akashima T, Yamada Y, Imai N, Nakagawa S, Koizumi S, Sekine S, Narimatsu H, Sasaki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-913709", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-913709" } ], "reference": [ { "type": "PubMed", "id": "11042166", "url": "https://glygen.org/publication/PubMed/11042166" } ] }, { "title": "Molecular cloning and characterization of UDP-GlcNAc:lactosylceramide beta 1,3-N-acetylglucosaminyltransferase (beta 3Gn-T5), an essential enzyme for the expression of HNK-1 and Lewis X epitopes on glycolipids.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Togayachi A, Akashima T, Ookubo R, Kudo T, Nishihara S, Iwasaki H, Natsume A, Mio H, Inokuchi J, Irimura T, Sasaki K, Narimatsu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-913709", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-913709" } ], "reference": [ { "type": "PubMed", "id": "11283017", "url": "https://glygen.org/publication/PubMed/11283017" } ] }, { "title": "Immunohistochemical demonstration of alpha1,4-N-acetylglucosaminyltransferase that forms GlcNAcalpha1,4Galbeta residues in human gastrointestinal mucosa.", "journal": "The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society", "date": "2001", "authors": "Zhang MX, Nakayama J, Hidaka E, Kubota S, Yan J, Ota H, Fukuda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-913709", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-913709" } ], "reference": [ { "type": "PubMed", "id": "11304796", "url": "https://glygen.org/publication/PubMed/11304796" } ] }, { "title": "Molecular cloning and characterization of a novel UDP-GlcNAc:GalNAc-peptide beta1,3-N-acetylglucosaminyltransferase (beta 3Gn-T6), an enzyme synthesizing the core 3 structure of O-glycans.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Iwai T, Inaba N, Naundorf A, Zhang Y, Gotoh M, Iwasaki H, Kudo T, Togayachi A, Ishizuka Y, Nakanishi H, Narimatsu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-913709", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-913709" } ], "reference": [ { "type": "PubMed", "id": "11821425", "url": "https://glygen.org/publication/PubMed/11821425" } ] }, { "title": "Mucin biosynthesis: epidermal growth factor downregulates core 2 enzymes in a human airway adenocarcinoma cell line.", "journal": "American journal of respiratory cell and molecular biology", "date": "2003", "authors": "Beum PV, Bastola DR, Cheng PW", "evidence": [ { "database": "RefSeq", "id": "NP_004742", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004742" } ], "reference": [ { "type": "PubMed", "id": "12600830", "url": "https://glygen.org/publication/PubMed/12600830" } ] }, { "title": "Golgi localization of carbohydrate sulfotransferases is a determinant of L-selectin ligand biosynthesis.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "de Graffenried CL, Bertozzi CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-913709", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-913709" } ], "reference": [ { "type": "PubMed", "id": "12855678", "url": "https://glygen.org/publication/PubMed/12855678" } ] }, { "title": "Expression cloning of a cDNA encoding UDP-GlcNAc:Gal beta 1-3-GalNAc-R (GlcNAc to GalNAc) beta 1-6GlcNAc transferase by gene transfer into CHO cells expressing polyoma large tumor antigen.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1992", "authors": "Bierhuizen MF, Fukuda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-913709", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-913709" } ], "reference": [ { "type": "PubMed", "id": "1329093", "url": "https://glygen.org/publication/PubMed/1329093" } ] }, { "title": "Cloning and tissue distribution of the human B3GALT7 gene, a member of the beta1,3-Glycosyltransferase family.", "journal": "Glycoconjugate journal", "date": "2004", "authors": "Huang C, Zhou J, Wu S, Shan Y, Teng S, Yu L", "evidence": [ { "database": "Reactome", "id": "R-HSA-913709", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-913709" } ], "reference": [ { "type": "PubMed", "id": "15486459", "url": "https://glygen.org/publication/PubMed/15486459" } ] }, { "title": "Characterization of a cDNA encoding a protein with limited similarity to beta1, 3-N-acetylglucosaminyltransferase.", "journal": "Molecular biology reports", "date": "2004", "authors": "Zheng H, Li Y, Ji C, Li J, Zhang J, Yin G, Xu J, Ye X, Wu M, Zou X, Gu S, Xie Y, Mao Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-913709", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-913709" } ], "reference": [ { "type": "PubMed", "id": "15560372", "url": "https://glygen.org/publication/PubMed/15560372" } ] }, { "title": "A novel beta1,3-N-acetylglucosaminyltransferase (beta3Gn-T8), which synthesizes poly-N-acetyllactosamine, is dramatically upregulated in colon cancer.", "journal": "FEBS letters", "date": "2005", "authors": "Ishida H, Togayachi A, Sakai T, Iwai T, Hiruma T, Sato T, Okubo R, Inaba N, Kudo T, Gotoh M, Shoda J, Tanaka N, Narimatsu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-913709", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-913709" } ], "reference": [ { "type": "PubMed", "id": "15620693", "url": "https://glygen.org/publication/PubMed/15620693" } ] }, { "title": "Regulation of sialyl-Lewis x epitope expression by TNF-alpha and EGF in an airway carcinoma cell line.", "journal": "Glycoconj. J.", "date": "2005", "authors": "Ishibashi Yuji, Inouye Yoshio, Okano Teruo, Taniguchi Akiyoshi", "evidence": [ { "database": "UniProtKB", "id": "O95395", "url": "https://www.uniprot.org/uniprot/O95395" } ], "reference": [ { "type": "PubMed", "id": "15864435", "url": "https://glygen.org/publication/PubMed/15864435" } ] }, { "title": "C2GnT-M is downregulated in colorectal cancer and its re-expression causes growth inhibition of colon cancer cells.", "journal": "Oncogene", "date": "2006", "authors": "Huang MC, Chen HY, Huang HC, Huang J, Liang JT, Shen TL, Lin NY, Ho CC, Cho IM, Hsu SM", "evidence": [ { "database": "UniProtKB", "id": "O95395", "url": "https://www.uniprot.org/uniprot/O95395" }, { "database": "RefSeq", "id": "NP_004742", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004742" } ], "reference": [ { "type": "PubMed", "id": "16418723", "url": "https://glygen.org/publication/PubMed/16418723" } ] }, { "title": "Comprehensive enzymatic characterization of glycosyltransferases with a beta3GT or beta4GT motif.", "journal": "Methods in enzymology", "date": "2006", "authors": "Togayachi A, Sato T, Narimatsu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-913709", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-913709" } ], "reference": [ { "type": "PubMed", "id": "17113861", "url": "https://glygen.org/publication/PubMed/17113861" } ] }, { "title": "Mucin biosynthesis: identification of the cis-regulatory elements of human C2GnT-M gene.", "journal": "Am. J. Respir. Cell Mol. Biol.", "date": "2007", "authors": "Tan S, Cheng PW", "evidence": [ { "database": "UniProtKB", "id": "O95395", "url": "https://www.uniprot.org/uniprot/O95395" }, { "database": "RefSeq", "id": "NP_004742", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004742" } ], "reference": [ { "type": "PubMed", "id": "17303715", "url": "https://glygen.org/publication/PubMed/17303715" } ] }, { "title": "New mutations in C1GALT1C1 in individuals with Tn positive phenotype.", "journal": "British journal of haematology", "date": "2008", "authors": "Crew VK, Singleton BK, Green C, Parsons SF, Daniels G, Anstee DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-913709", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-913709" } ], "reference": [ { "type": "PubMed", "id": "18537974", "url": "https://glygen.org/publication/PubMed/18537974" } ] }, { "title": "Control of mucin-type O-glycosylation: a classification of the polypeptide GalNAc-transferase gene family.", "journal": "Glycobiology", "date": "2012", "authors": "Bennett EP, Mandel U, Clausen H, Gerken TA, Fritz TA, Tabak LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-913709", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-913709" } ], "reference": [ { "type": "PubMed", "id": "22183981", "url": "https://glygen.org/publication/PubMed/22183981" } ] }, { "title": "The Cosmc connection to the Tn antigen in cancer.", "journal": "Cancer biomarkers : section A of Disease markers", "date": "2014", "authors": "Ju T, Aryal RP, Kudelka MR, Wang Y, Cummings RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-913709", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-913709" } ], "reference": [ { "type": "PubMed", "id": "24643043", "url": "https://glygen.org/publication/PubMed/24643043" } ] }, { "title": "beta-1,3-Galactosyl-O-Glycosyl-Glycoprotein beta-1,6-N-Acetylglucosaminyltransferase 3 Increases MCAM Stability, Which Enhances S100A8/A9-Mediated Cancer Motility.", "journal": "Oncology research", "date": "2018", "authors": "Sumardika IW, Youyi C, Kondo E, Inoue Y, Ruma IMW, Murata H, Kinoshita R, Yamamoto KI, Tomida S, Shien K, Sato H, Yamauchi A, Futami J, Putranto EW, Hibino T, Toyooka S, Nishibori M, Sakaguchi M", "evidence": [ { "database": "RefSeq", "id": "NP_004742", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004742" } ], "reference": [ { "type": "PubMed", "id": "28923134", "url": "https://glygen.org/publication/PubMed/28923134" } ] }, { "title": "Downregulation of N-Acetylglucosaminyltransferase GCNT3 by miR-302b-3p Decreases Non-Small Cell Lung Cancer (NSCLC) Cell Proliferation, Migration and Invasion.", "journal": "Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology", "date": "2018", "authors": "Li Q, Ran P, Zhang X, Guo X, Yuan Y, Dong T, Zhu B, Zheng S, Xiao C", "evidence": [ { "database": "RefSeq", "id": "NP_004742", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004742" } ], "reference": [ { "type": "PubMed", "id": "30355927", "url": "https://glygen.org/publication/PubMed/30355927" } ] }, { "title": "Global analysis of human glycosyltransferases reveals novel targets for pancreatic cancer pathogenesis.", "journal": "British journal of cancer", "date": "2020", "authors": "Gupta R, Leon F, Thompson CM, Nimmakayala R, Karmakar S, Nallasamy P, Chugh S, Prajapati DR, Rachagani S, Kumar S, Ponnusamy MP", "evidence": [ { "database": "RefSeq", "id": "NP_004742", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004742" } ], "reference": [ { "type": "PubMed", "id": "32203219", "url": "https://glygen.org/publication/PubMed/32203219" } ] }, { "title": "LINC00511 enhances LUAD malignancy by upregulating GCNT3 via miR-195-5p.", "journal": "BMC cancer", "date": "2022", "authors": "Zhang Y, Xiao P, Hu X", "evidence": [ { "database": "RefSeq", "id": "NP_004742", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004742" } ], "reference": [ { "type": "PubMed", "id": "35399076", "url": "https://glygen.org/publication/PubMed/35399076" } ] }, { "title": "Functional analysis of GCNT3 for cell migration and EMT of castration-resistant prostate cancer cells.", "journal": "Glycobiology", "date": "2022", "authors": "Yamamoto D, Sasaki K, Kosaka T, Oya M, Sato T", "evidence": [ { "database": "RefSeq", "id": "NP_004742", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004742" } ], "reference": [ { "type": "PubMed", "id": "35867813", "url": "https://glygen.org/publication/PubMed/35867813" } ] }, { "title": "Substrate specificities of three members of the human UDP-N-acetyl-alpha-D-galactosamine:Polypeptide N-acetylgalactosaminyltransferase family, GalNAc-T1, -T2, and -T3.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Wandall HH, Hassan H, Mirgorodskaya E, Kristensen AK, Roepstorff P, Bennett EP, Nielsen PA, Hollingsworth MA, Burchell J, Taylor-Papadimitriou J, Clausen H", "evidence": [ { "database": "Reactome", "id": "R-HSA-913709", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-913709" } ], "reference": [ { "type": "PubMed", "id": "9295285", "url": "https://glygen.org/publication/PubMed/9295285" } ] }, { "title": "Localization of three human polypeptide GalNAc-transferases in HeLa cells suggests initiation of O-linked glycosylation throughout the Golgi apparatus.", "journal": "Journal of cell science", "date": "1998", "authors": "Rottger S, White J, Wandall HH, Olivo JC, Stark A, Bennett EP, Whitehouse C, Berger EG, Clausen H, Nilsson T", "evidence": [ { "database": "Reactome", "id": "R-HSA-913709", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-913709" } ], "reference": [ { "type": "PubMed", "id": "9394011", "url": "https://glygen.org/publication/PubMed/9394011" } ] }, { "title": "Cloning of a human UDP-galactose:2-acetamido-2-deoxy-D-glucose 3beta-galactosyltransferase catalyzing the formation of type 1 chains.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Kolbinger F, Streiff MB, Katopodis AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-913709", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-913709" } ], "reference": [ { "type": "PubMed", "id": "9417100", "url": "https://glygen.org/publication/PubMed/9417100" } ] }, { "title": "Molecular cloning of a human cDNA encoding beta-1,4-galactosyltransferase with 37% identity to mammalian UDP-Gal:GlcNAc beta-1,4-galactosyltransferase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Sato T, Furukawa K, Bakker H, Van den Eijnden DH, Van Die I", "evidence": [ { "database": "Reactome", "id": "R-HSA-913709", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-913709" } ], "reference": [ { "type": "PubMed", "id": "9435216", "url": "https://glygen.org/publication/PubMed/9435216" } ] }, { "title": "Molecular cloning and expression of a novel beta-1, 6-N-acetylglucosaminyltransferase that forms core 2, core 4, and I branches.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Yeh JC, Ong E, Fukuda M", "evidence": [ { "database": "UniProtKB", "id": "O95395", "url": "https://www.uniprot.org/uniprot/O95395" }, { "database": "Reactome", "id": "R-HSA-913709", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-913709" } ], "reference": [ { "type": "PubMed", "id": "9915862", "url": "https://glygen.org/publication/PubMed/9915862" } ] }, { "title": "Control of O-glycan branch formation. Molecular cloning of human cDNA encoding a novel beta1,6-N-acetylglucosaminyltransferase forming core 2 and core 4.", "journal": "J. Biol. Chem.", "date": "1999", "authors": "Schwientek T, Nomoto M, Levery SB, Merkx G, van Kessel AG, Bennett EP, Hollingsworth MA, Clausen H", "evidence": [ { "database": "UniProtKB", "id": "O95395", "url": "https://www.uniprot.org/uniprot/O95395" }, { "database": "Reactome", "id": "R-HSA-913709", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-913709" } ], "reference": [ { "type": "PubMed", "id": "9988682", "url": "https://glygen.org/publication/PubMed/9988682" } ] } ], "pathway": [ { "id": "hsa:9245", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9245", "resource": "KEGG Pathway" }, { "id": "R-HSA-913709", "name": "O-linked glycosylation of mucins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-913709", "resource": "Reactome", "description": "O-linked glycosylation of mucins" } ], "orthologs": [ { "uniprot_canonical_ac": "F1S070-1", "protein_name": "Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3", "gene_name": "GCNT3", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MKMLWWKKKLCRSHYLWALGCYMLLAIVALRFSLRLKCDIYSLDLESRDFRSQHCRDILYKSLKLPAKRSINCSAITRGDQEAVITAVLDNLEVKKKRKPFTDTDYLNMTRDCEKFKANRKFIQFPLSKEELDFPIAYSMVVHEKIENFERLLRAVYAPQNIYCIHVDEKSPESFKEAVKAIISCFPNVFMVSKLVRVVYASWSRVQADLNCMEDLLQSSVPWKYLLNTCGTDFPIKTNAEMVLALKMLNGKNSMESEIPTEYKKSRWKYHYEVTDTLYLTNKMKDPPPDNLPMFTGNAYIVASRAFVQHVLENPKSQRLIEWAKDTYSPDEHLWATLQRAPWMPGSVPYHPKFHISDMTAIARLVKWQGHEGNVSMGAPYEPCSGIHQRAVCIYGAGDLHWILQNHHLLANKFDPKVDDNVLQCLEEYLRYKAIYGTEL", "length": 440 }, "evidence": [ { "id": "O95395", "url": "https://omabrowser.org/oma/group/O95395/", "database": "OMA" } ], "common_name": "Pig" }, { "uniprot_canonical_ac": "Q5JCT0-1", "protein_name": "Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3", "gene_name": "Gcnt3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MTSWQRLCWHYRLWTLGCYMLLAILALKLSLRLKCDFDAMDLDSEEFQSQYCRDLLYKTLKLPAKSSINCSGVIRGEQKAVTQALLNNLEIKKKQQLFTEADYLRMTADCEHFKTKRKFIQVPLSKEEASFPIAYSMVVHEKIENFERLLRAVYTPQNVYCVHMDQKSSEPFKQAVRAIVSCFPNVFIASKLVSVVYASWSRVQADLNCMEDLLQSPVPWKYLLNTCGTDFPIKTNAEMVKALKLLKGQNSMESEVPPPHKKSRWKYHYEVTDTLHMTSKRKTPPPNNLTMFTGNAYMVASRDFIEHVFSNSKARQLIEWVKDTYSPDEHLWATLQRASWMPGSDPLHRKFDLSDMRAIARLTKWYDHEGDIENGAPYTSCSGIHQRAVCVYGSGDLHWILQNHHLLANKFDPKVDDNVLQCLEEYLRHKAIYGTEL", "length": 437 }, "evidence": [ { "id": "45931053", "url": "http://www.informatics.jax.org/homology/45931053", "database": "MGI" }, { "id": "O95395", "url": "https://omabrowser.org/oma/group/O95395/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q8CH87-1", "protein_name": "Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3", "gene_name": "Gcnt3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MVSWRRFCWHYHGWTLGCYMLLAIIALKLSLRLKCDFDVMDLDSKEFQSQYCRDLLYKTLELPAKSSINCSGVIRGEQKAVTQALLNNLELKRKRQSFTEADYLSMTADCEHFKTQRKFIQVPLSKEEANFPIAYSMVIHEKIENFERLLRAVYTPQNIYCVHVDQKSSETFQQAVRAIVSCFPNVFIANKLVSVVYASWSRVQADLNCMEDLLQSPVPWEYLLNTCGTDFPIKTNAEMVKALKLLNGQNSMESEVPPPHKTFRWKYHYEVADTLYRTSKEKTPPPNNITMFTGNAYMVASRDFIEHVLSNSKARQLIEWVKDTYSPDEHLWATLQRASWMPGSDPLHPKFDLSDMRSIARLTKWQDHEGDIENGAPYTSCSGIHQRAICVYGSGDLHWILQNHHLLANKFDPKVDDNVLQCLEEYLRHKAIYGTEL", "length": 437 }, "evidence": [ { "id": "45931053", "url": "http://www.informatics.jax.org/homology/45931053", "database": "MGI" }, { "id": "O95395", "url": "https://omabrowser.org/oma/group/O95395/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O95395", "url": "https://www.uniprot.org/uniprot/O95395" } ], "pmid": "" }, { "name": "Golgi membrane", "id": "GO:0000139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000139", "evidence": [ { "database": "UniProtKB", "id": "O95395", "url": "https://www.uniprot.org/uniprot/O95395" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "O95395", "url": "https://www.uniprot.org/uniprot/O95395" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase activity", "id": "GO:0003829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003829", "evidence": [ { "database": "UniProtKB", "id": "O95395", "url": "https://www.uniprot.org/uniprot/O95395" } ], "pmid": "" }, { "name": "N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase activity", "id": "GO:0008109", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008109", "evidence": [ { "database": "UniProtKB", "id": "O95395", "url": "https://www.uniprot.org/uniprot/O95395" } ], "pmid": "" }, { "name": "acetylglucosaminyltransferase activity", "id": "GO:0008375", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008375", "evidence": [ { "database": "UniProtKB", "id": "O95395", "url": "https://www.uniprot.org/uniprot/O95395" } ], "pmid": "" }, { "name": "acetylgalactosaminyl-O-glycosyl-seryl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase activity", "id": "GO:0106325", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0106325", "evidence": [ { "database": "UniProtKB", "id": "O95395", "url": "https://www.uniprot.org/uniprot/O95395" } ], "pmid": "" }, { "name": "acetylgalactosaminyl-O-glycosyl-threonyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase activity", "id": "GO:0106326", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0106326", "evidence": [ { "database": "UniProtKB", "id": "O95395", "url": "https://www.uniprot.org/uniprot/O95395" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "tissue morphogenesis", "id": "GO:0048729", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048729", "evidence": [ { "database": "UniProtKB", "id": "O95395", "url": "https://www.uniprot.org/uniprot/O95395" } ], "pmid": "" }, { "name": "kidney morphogenesis", "id": "GO:0060993", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060993", "evidence": [ { "database": "UniProtKB", "id": "O95395", "url": "https://www.uniprot.org/uniprot/O95395" } ], "pmid": "" }, { "name": "carbohydrate metabolic process", "id": "GO:0005975", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005975", "evidence": [ { "database": "UniProtKB", "id": "O95395", "url": "https://www.uniprot.org/uniprot/O95395" } ], "pmid": "" }, { "name": "protein O-linked glycosylation", "id": "GO:0006493", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006493", "evidence": [ { "database": "UniProtKB", "id": "O95395", "url": "https://www.uniprot.org/uniprot/O95395" } ], "pmid": "" }, { "name": "O-glycan processing", "id": "GO:0016266", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016266", "evidence": [ { "database": "UniProtKB", "id": "O95395", "url": "https://www.uniprot.org/uniprot/O95395" } ], "pmid": "" }, { "name": "intestinal absorption", "id": "GO:0050892", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050892", "evidence": [ { "database": "UniProtKB", "id": "O95395", "url": "https://www.uniprot.org/uniprot/O95395" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 289, "end_pos": 291, "annotation": "n_glycosylation_sequon" }, { "start_pos": 69, "end_pos": 71, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "54820", "name": "", "equation": "a beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc derivative + UDP-N-acetyl-alpha-D-glucosamine = a beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-[beta-D-GlcNAc-(1->6)]-beta-D-Gal-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8CH87-1", "Q8N0V5-1", "O95395-1", "P97402-1", "Q5JCT0-1" ], "evidence": [ { "id": "54820", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/54820" } ] }, { "id": "56188", "name": "", "equation": "3-O-[N-acetyl-beta-D-glucosaminyl-(1->3)-N-acetyl-alpha-D-galactosaminyl]-L-seryl-[protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-[N-acetyl-beta-D-glucosaminyl-(1->3)-[N-acetyl-beta-D-glucosaminyl-(1->6)]-N-acetyl-alpha-D-galactosaminyl]-L-seryl-[protein] + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8CH87-1", "O95395-1", "Q5JCT0-1" ], "evidence": [ { "id": "56188", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/56188" } ] }, { "id": "56192", "name": "", "equation": "3-O-[N-acetyl-beta-D-glucosaminyl-(1->3)-N-acetyl-alpha-D-galactosaminyl]-L-threonyl-[protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-[N-acetyl-beta-D-glucosaminyl-(1->3)-[N-acetyl-beta-D-glucosaminyl-(1->6)]-N-acetyl-alpha-D-galactosaminyl]-L-threonyl-[protein] + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8CH87-1", "O95395-1", "Q5JCT0-1" ], "evidence": [ { "id": "56192", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/56192" } ] }, { "id": "56212", "name": "", "equation": "O(3)-[beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl]-L-seryl-[protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-{beta-D-galactosyl-(1->3)-[N-acetyl-beta-D-glucosaminyl-(1->6)]-N-acetyl-alpha-D-galactosaminyl}-L-seryl-[protein] + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8CH87-1", "Q9P109-1", "O95395-1", "Q02742-1", "E9Q649-1", "Q09324-1", "Q5JCT0-1" ], "evidence": [ { "id": "56212", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/56212" } ] }, { "id": "56216", "name": "", "equation": "O(3)-[beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl]-L-threonyl-[protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-{beta-D-galactosyl-(1->3)-[N-acetyl-beta-D-glucosaminyl-(1->6)]-N-acetyl-alpha-D-galactosaminyl}-L-threonyl-[protein] + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8CH87-1", "Q9P109-1", "O95395-1", "Q02742-1", "E9Q649-1", "Q09324-1", "Q5JCT0-1" ], "evidence": [ { "id": "56216", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/56216" } ] }, { "id": "R-HSA-914012", "name": "GCNTs transfer GlcNAc from UDP-GlcNAc to Core 1 mucins", "equation": "", "summary": "The human gene GCNT encodes beta-1,6-N-acetylglucosaminyltransferase which mediates core 2 O-glycan branching by the addition of N-acetylgalactosamine, an important step in mucin-type biosynthesis. There are 3 defined members in humans, 1, 3 and 4 (Bierhuizen and Fukuda, 1992; Yeh et al, 1999; Schwientek et al, 2000). Two members (6 and 7) may be part of the family based on sequence similarity.", "cellular_location": "Golgi lumen, Golgi membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O95395-1", "Q6ZNI0-1", "Q9P109-1", "Q02742-1" ], "evidence": [ { "id": "R-HSA-914012", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-914012" } ] }, { "id": "R-HSA-914018", "name": "Addition of GlcNAc to Core 3 forms a Core 4 glycoprotein", "equation": "", "summary": "The glycosyltransferase GCNT3 mediates core 2 and core 4 O-glycan branching (Yeh et al, 1999; Schwientek et al, 1999).", "cellular_location": "Golgi lumen, Golgi membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O95395-1" ], "evidence": [ { "id": "R-HSA-914018", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-914018" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "E9Q649", "gene_name": "Gcnt4", "activity": [ { "ec_number": "2.4.1.102", "activity": "O(3)-[beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl]-L-seryl-[protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-{beta-D-galactosyl-(1->3)-[N-acetyl-beta-D-glucosaminyl-(1->6)]-N-acetyl-alpha-D-galactosaminyl}-L-seryl-[protein] + H(+) + UDP.", "evidence": [ { "id": "E9Q649", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q649" } ] }, { "ec_number": "2.4.1.102", "activity": "", "evidence": [ { "id": "E9Q649", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q649" } ] } ] }, { "uniprot_ac": "O95395", "gene_name": "GCNT3", "activity": [ { "ec_number": "2.4.1.102", "activity": "O(3)-[beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl]-L-seryl-[protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-{beta-D-galactosyl-(1->3)-[N-acetyl-beta-D-glucosaminyl-(1->6)]-N-acetyl-alpha-D-galactosaminyl}-L-seryl-[protein] + H(+) + UDP.", "evidence": [ { "id": "O95395", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95395" } ] }, { "ec_number": "2.4.1.150", "activity": "a beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc derivative + UDP-N-acetyl-alpha-D-glucosamine = a beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-[beta-D-GlcNAc-(1->6)]-beta-D-Gal-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP.", "evidence": [ { "id": "O95395", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95395" } ] }, { "ec_number": "2.4.1.148", "activity": "3-O-[N-acetyl-beta-D-glucosaminyl-(1->3)-N-acetyl-alpha-D-galactosaminyl]-L-seryl-[protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-[N-acetyl-beta-D-glucosaminyl-(1->3)-[N-acetyl-beta-D-glucosaminyl-(1->6)]-N-acetyl-alpha-D-galactosaminyl]-L-seryl-[protein] + H(+) + UDP.", "evidence": [ { "id": "O95395", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95395" } ] }, { "ec_number": "2.4.1.102", "activity": "", "evidence": [ { "id": "O95395", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95395" } ] }, { "ec_number": "2.4.1.148", "activity": "", "evidence": [ { "id": "O95395", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95395" } ] }, { "ec_number": "2.4.1.150", "activity": "", "evidence": [ { "id": "O95395", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95395" } ] } ] }, { "uniprot_ac": "P97402", "gene_name": "Gcnt2", "activity": [ { "ec_number": "2.4.1.150", "activity": "a beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc derivative + UDP-N-acetyl-alpha-D-glucosamine = a beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-[beta-D-GlcNAc-(1->6)]-beta-D-Gal-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP.", "evidence": [ { "id": "P97402", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97402" } ] }, { "ec_number": "2.4.1.150", "activity": "", "evidence": [ { "id": "P97402", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97402" } ] } ] }, { "uniprot_ac": "Q02742", "gene_name": "GCNT1", "activity": [ { "ec_number": "2.4.1.102", "activity": "O(3)-[beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl]-L-seryl-[protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-{beta-D-galactosyl-(1->3)-[N-acetyl-beta-D-glucosaminyl-(1->6)]-N-acetyl-alpha-D-galactosaminyl}-L-seryl-[protein] + H(+) + UDP.", "evidence": [ { "id": "Q02742", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02742" } ] }, { "ec_number": "2.4.1.102", "activity": "", "evidence": [ { "id": "Q02742", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02742" } ] } ] }, { "uniprot_ac": "Q09324", "gene_name": "Gcnt1", "activity": [ { "ec_number": "2.4.1.102", "activity": "O(3)-[beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl]-L-seryl-[protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-{beta-D-galactosyl-(1->3)-[N-acetyl-beta-D-glucosaminyl-(1->6)]-N-acetyl-alpha-D-galactosaminyl}-L-seryl-[protein] + H(+) + UDP.", "evidence": [ { "id": "Q09324", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q09324" } ] }, { "ec_number": "2.4.1.102", "activity": "", "evidence": [ { "id": "Q09324", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q09324" } ] } ] }, { "uniprot_ac": "Q5JCT0", "gene_name": "Gcnt3", "activity": [ { "ec_number": "2.4.1.102", "activity": "O(3)-[beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl]-L-seryl-[protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-{beta-D-galactosyl-(1->3)-[N-acetyl-beta-D-glucosaminyl-(1->6)]-N-acetyl-alpha-D-galactosaminyl}-L-seryl-[protein] + H(+) + UDP.", "evidence": [ { "id": "Q5JCT0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5JCT0" } ] }, { "ec_number": "2.4.1.150", "activity": "a beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc derivative + UDP-N-acetyl-alpha-D-glucosamine = a beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-[beta-D-GlcNAc-(1->6)]-beta-D-Gal-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP.", "evidence": [ { "id": "Q5JCT0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5JCT0" } ] }, { "ec_number": "2.4.1.148", "activity": "3-O-[N-acetyl-beta-D-glucosaminyl-(1->3)-N-acetyl-alpha-D-galactosaminyl]-L-seryl-[protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-[N-acetyl-beta-D-glucosaminyl-(1->3)-[N-acetyl-beta-D-glucosaminyl-(1->6)]-N-acetyl-alpha-D-galactosaminyl]-L-seryl-[protein] + H(+) + UDP.", "evidence": [ { "id": "Q5JCT0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5JCT0" } ] }, { "ec_number": "2.4.1.102", "activity": "", "evidence": [ { "id": "Q5JCT0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5JCT0" } ] }, { "ec_number": "2.4.1.148", "activity": "", "evidence": [ { "id": "Q5JCT0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5JCT0" } ] }, { "ec_number": "2.4.1.150", "activity": "", "evidence": [ { "id": "Q5JCT0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5JCT0" } ] } ] }, { "uniprot_ac": "Q6ZNI0", "gene_name": "GCNT7", "activity": [ { "ec_number": "2.4.1.-", "activity": "", "evidence": [ { "id": "Q6ZNI0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZNI0" } ] } ] }, { "uniprot_ac": "Q8CH87", "gene_name": "Gcnt3", "activity": [ { "ec_number": "2.4.1.102", "activity": "O(3)-[beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl]-L-seryl-[protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-{beta-D-galactosyl-(1->3)-[N-acetyl-beta-D-glucosaminyl-(1->6)]-N-acetyl-alpha-D-galactosaminyl}-L-seryl-[protein] + H(+) + UDP.", "evidence": [ { "id": "Q8CH87", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CH87" } ] }, { "ec_number": "2.4.1.150", "activity": "a beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc derivative + UDP-N-acetyl-alpha-D-glucosamine = a beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-[beta-D-GlcNAc-(1->6)]-beta-D-Gal-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP.", "evidence": [ { "id": "Q8CH87", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CH87" } ] }, { "ec_number": "2.4.1.148", "activity": "3-O-[N-acetyl-beta-D-glucosaminyl-(1->3)-N-acetyl-alpha-D-galactosaminyl]-L-seryl-[protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-[N-acetyl-beta-D-glucosaminyl-(1->3)-[N-acetyl-beta-D-glucosaminyl-(1->6)]-N-acetyl-alpha-D-galactosaminyl]-L-seryl-[protein] + H(+) + UDP.", "evidence": [ { "id": "Q8CH87", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CH87" } ] }, { "ec_number": "2.4.1.150", "activity": "", "evidence": [ { "id": "Q8CH87", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CH87" } ] }, { "ec_number": "2.4.1.102", "activity": "", "evidence": [ { "id": "Q8CH87", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CH87" } ] }, { "ec_number": "2.4.1.148", "activity": "", "evidence": [ { "id": "Q8CH87", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CH87" } ] } ] }, { "uniprot_ac": "Q8N0V5", "gene_name": "GCNT2", "activity": [ { "ec_number": "2.4.1.150", "activity": "a beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc derivative + UDP-N-acetyl-alpha-D-glucosamine = a beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-[beta-D-GlcNAc-(1->6)]-beta-D-Gal-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP.", "evidence": [ { "id": "Q8N0V5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N0V5" } ] }, { "ec_number": "2.4.1.150", "activity": "", "evidence": [ { "id": "Q8N0V5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N0V5" } ] } ] }, { "uniprot_ac": "Q9P109", "gene_name": "GCNT4", "activity": [ { "ec_number": "2.4.1.102", "activity": "O(3)-[beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl]-L-seryl-[protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-{beta-D-galactosyl-(1->3)-[N-acetyl-beta-D-glucosaminyl-(1->6)]-N-acetyl-alpha-D-galactosaminyl}-L-seryl-[protein] + H(+) + UDP.", "evidence": [ { "id": "Q9P109", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9P109" } ] }, { "ec_number": "2.4.1.102", "activity": "", "evidence": [ { "id": "Q9P109", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9P109" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [ { "glytoucan_ac": "G00027JG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00033MO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00034MO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00034UM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00037MO", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G00038MO", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G00041MO", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G00042MO", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G00069YC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00079IK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00094SE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00112IO", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G00164QP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00196CO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00238CK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00241VQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00287UD", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G00288RP", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G00372ZO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00376RB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00394CR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00423TL", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G00428HK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00430ZK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00467QU", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G00468NI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00496OX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00560KG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00653TI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00707RC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00728SN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00729SA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00754TS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00789VI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00803TF", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G00897BY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00901NZ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G00907IC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00932UQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00944OL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00978GW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00979XR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00980BE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01056RH", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G01097FM", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G01243KR", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G01282UD", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G01284WP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G01302LF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01357LV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01437WY", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G01453BU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01457KB", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G01471GI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01520KE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01532FF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01577DB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01584VI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01608UX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01625GQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01643LM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01674VT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01707KB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01744JD", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G01749YL", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G01759NM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01763RO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01769GP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01802HL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01869FL", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G01879FC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01912GF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01922RI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G01923FT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01999VP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02032MW", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G02033VO", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G02078ZZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02127XA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02150AC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02161CI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02230VA", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G02289NP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02370LQ", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G02377RY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02379AH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02393LQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02402NL", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G02403ZU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02442MH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02530VE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02539TH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02562EQ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G02563ZC", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G02594WS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02624KW", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G02642GO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02799CL", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G02844SX", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G02912JK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02942YF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02990AF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03003KR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03016BW", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G03035VB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03049NB", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G03052ZR", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G03129RJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03140AX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03168RN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03200OR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03266UM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03289LB", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G03304QB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03339IQ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G03340FG", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G03412UM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03425VF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03438WE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03462LS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03494YC", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G03520RT", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G03549GG", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G03549GS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03574EH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03588SZ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G03591CN", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G03605AU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03605AV", "type": "N-linked", "subtype": "Triantennary" }, { "glytoucan_ac": "G03644PT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03670RH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03674DU", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G03720YG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03770XP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G03792OA", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G03840OO", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G03852KN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03877AD", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G03900NK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03941EL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03975EI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04002YJ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G04014AR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04014FP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G04043RM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04074KJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04088QJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04091CN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04114CX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04116CC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04137HF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04185QP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04324CR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04348LJ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G04421LE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04422XL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04428BJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04450CG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04459VF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04464LR", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G04478DK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04490OD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04505IS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04527KW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04531NI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G04534UP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04536JV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04564SK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04608YG", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G04638IX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04712IG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04734LP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04760XP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04765GH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04842IW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04949CY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04970RV", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G04984PI", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G05028TR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05107KY", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G05128BK", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G05184IQ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G05252QE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05259MJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05278GV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05324AQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05378UG", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G05380VG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05400IQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05402FG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05411CD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05413EE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05456PR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05490PJ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G05562YT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05597SV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05620JQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05644LC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05670VR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05675LB", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G05690OR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05724WC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05767GS", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G05784LD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05784QE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05835TV", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G05848DX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05918XD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05970FR", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G05994BK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06067PC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06149AZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06172PE", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G06187MQ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G06225LL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06317RG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06341YK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06366AC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06404BM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06408QU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06435TQ", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G06439PI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G06448OR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06453RB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06460LD", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G06503AU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06507BB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06523WI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06558RX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06563KK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06577DG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06650FN", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G06661NE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06662ZP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06676BQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06710OE", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G06755AP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06786CI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06840BZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06864JC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06938KF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06969QL", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G07061BV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07061YF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07099ZR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07141OG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07145VL", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G07191NE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07210GE", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G07360NF", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G07405CY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07430HH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07435LO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07443RM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07480TU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07578MJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07610JY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07646UD", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G07677VL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07680WY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07692KY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07695IB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07724XN", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G07764JS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07789RJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07817HH", "type": "N-linked", "subtype": "Triantennary" }, { "glytoucan_ac": "G07819HC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07869UA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07898UR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07982LO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08016YO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08046LM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08055MG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08059ZN", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G08107SW", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G08115PN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08131WI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08140FC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08190JB", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G08201TX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08244KE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08244YE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08264JX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08306FC", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G08308ZP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08358DN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08366OY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08382XT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08425VQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08426DX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08566CQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08569VN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08670DD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08784DO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08892TX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08941LG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08952PH", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G09079WY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09125MU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09139MX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09147XQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09153LX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09154YX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09185DX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09198TC", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G09207SI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09224US", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09226UP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09287HW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09403AR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09424UT", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G09425PN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09441VY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09575SG", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G09583DW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09588MX", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G09640VJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09678FF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09698FP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G09761AD", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G09767ET", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G09781FH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09845DR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09921KZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09938IH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09941BM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09980KC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10110YZ", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G10119AX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10174LI", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G10180QX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10287KB", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G10302UO", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G10372YC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10388YZ", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G10408DE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10425AY", "type": "N-linked", "subtype": "Triantennary" }, { "glytoucan_ac": "G10453CW", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G10480CH", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G10487BH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10514PF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10581YA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10604KJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10608NX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10643IE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10679DE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10687EF", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G10688VV", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G10705PR", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G10706IL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10816YX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10818TP", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G10831FE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10924UK", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G10925II", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10954DW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10993EM", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G11083DH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11105TT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11120EJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11198HA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11201QY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11210ZL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11253PI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11272SN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11288UE", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G11366PY", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G11411KB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11427UI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11457RF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11466IA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11679KK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11699WH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11778HP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11819NV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11827HH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11830CY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11846US", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11848VF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11889PN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11936KZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11940TK", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G11980DL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G12020PN", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G12111NA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G12114XT", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G12124FY", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G12133SZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G12193VL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G12230UX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G12232OT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G12350CH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G12396GB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G12405JG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G12428MZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G12486YB", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G12526XX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G12541EY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G12548MD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G12573LN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G12573WR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G12604MY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G12616PJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G12627CA", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G12848QL", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G12891KC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13089IH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13101AX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13104VJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13122AV", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G13168IS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13179DW", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G13260JU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13292XY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13346PK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13483MW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13496UJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13511YR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13520PN", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G13610SN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13616KY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13625HH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13684QB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13695SV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13717KM", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G13761UE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13767YY", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G13782XR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13785BU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13814UH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13816ZL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13858YJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13863XN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13890JV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13894RO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13968BO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13976VB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14009XM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14014EQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14125ZW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14138XB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14188TW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14205YR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14238UO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14296RM", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G14303LL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14317JF", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G14346JI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14375KO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14453LC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14514DY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14555ST", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G14567YG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14623FX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14645TH", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G14646AF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14693JJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14722QE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14781HP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14815WH", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G14829OL", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G14868UU", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G14919CV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14955CK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14965PJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14978ZY", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G15011KZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G15033WI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G15050SW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G15099DI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G15249CA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G15270BO", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G15307GJ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G15367TG", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G15393WU", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G15484AW", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G15555MR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G15577KP", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G15631KB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G15635CJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G15648GT", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G15718TL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G15756SW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G15772KA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G15779LH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G15849KC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G15876HU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G16040ZU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G16078YI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G16079QO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G16270SN", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G16327YW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G16344NR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G16365JY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G16458JH", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G16503YF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G16536QD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G16576OQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G16682CP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G16687RY", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G16709FR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G16739XD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G16756OS", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G16768QV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G16816IR", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G16867VE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G16943AM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G16964KY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G16970LX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G16984QJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17039UO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17050CK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17055DM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17077YF", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G17218WW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17241OS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17251XF", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G17269LY", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G17280PS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17294JY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17300DB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17320JG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17331IX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17331WA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17346NI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17361GJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17454VN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17457PQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17465GV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17488LP", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G17500FP", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G17527HL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17650QU", "type": "N-linked", "subtype": "Complex" }, { "glytoucan_ac": "G17673XH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17709UI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17733ZN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17740TV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17752YB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17766PJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17827ZK", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G17843DM", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G18117YG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18123MJ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G18132YR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18299YA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18347PA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18362VR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18388QV", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G18423OV", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G18427DX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18463FK", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G18519LX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18559VR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18561AX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18603OH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18603ZQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18628GH", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G18653BM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18695QD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18800AB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18814OJ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G18815VY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18837VD", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G18853HA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18855WX", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G18878GS", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G18878PL", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G18890KW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18892PE", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G18924BG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18930SC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18932FF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18946TX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18950NM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18953GB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18963DQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18982QA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G19029ID", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G19043KB", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G19075LN", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G19135OS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G19203SG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G19212IL", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G19231UV", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G19238ZQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G19342EE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G19382GM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G19474IX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G19555CW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G19562CL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G19618VN", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G19664QJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G19756XC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G19793PI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G19806ZW", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G19807JC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G19954YX", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G19957ZD", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G20016GC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20038KA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20059NZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20064ZN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20222KH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20251UM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20310DM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20359JA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20372QO", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G20438JB", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G20440GC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20453WS", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G20557GR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20566UO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20713UI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G20718YD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20735IM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20739VI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20745AF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20752RM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20828MB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20860NB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20878US", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20879UO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20887HP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G20988ZU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20993TP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G21029LJ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G21147BK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G21246WW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G21297DP", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G21312EA", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G21360BF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G21385AQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G21412CQ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G21557NG", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G21564HN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G21654MJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G21672LC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G21675EO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G21696DT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G21740EF", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G21780GG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G21807KQ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G21827YQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G21845NG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G21880FP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G21895BD", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G21905ZO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G21939VU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G21939WK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G21989SY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G22070LE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G22171KQ", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G22185MF", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G22327AZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G22343QB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G22366MN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G22385OT", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G22498IQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G22536LR", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G22540KI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G22555FB", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G22564NT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G22609VV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G22626SX", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G22629JM", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G22668GN", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G22773YW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G22782LH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G22787WJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G22793FR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G22815DC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G22841DM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G22849VW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G22970UG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G22988HQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23016AG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23021IW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23021NE", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G23048PE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23066SI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23113ER", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23119MJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23126IF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23193CN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23250OE", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G23262BU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23262LC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23285KY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23348CE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23404PC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23416ZA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23447MZ", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G23463KX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23494UZ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G23502AY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23560WQ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G23564VW", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G23580VC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23633EE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23674BI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23801QI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23866EW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23870PO", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G23888EZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23893ZL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23975EE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23979XZ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G23999MD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24030QV", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G24055UV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24120OI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24142JB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24151NT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24186OV", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G24204KW", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G24218RK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24256XU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24283IO", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G24293BT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24296ZA", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G24303LM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24327KR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24363HJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24366RG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24371IA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24407ZG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24475OY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24553WE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24646WV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24684JT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24720OO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24739SA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24790YU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24798BT", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G24820LP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24845EE", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G24856YP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24931MM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24951IK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25012OX", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G25043OJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25064SU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25065CJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25096GQ", "type": "N-linked", "subtype": "Complex" }, { "glytoucan_ac": "G25127JU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25146DY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25153GE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25233TU", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G25322NY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25323VU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25351JT", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G25380IT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25382RS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25416CE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25421NH", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G25443TD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25489WW", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G25498HI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G25499LZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25524RD", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G25529RM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25538MM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25612EW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25694MT", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G25716MV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25726HS", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G25757VH", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G25764DO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25795DA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25804XU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25848FU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25865TC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25895SL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25934VE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25935VE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25937FN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25953KD", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G25955UH", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G25977RW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26021BY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26080SE", "type": "N-linked", "subtype": "Complex" }, { "glytoucan_ac": "G26099QT", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G26176JA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26185YJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26209TI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26224UH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26228QQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26301NP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26325AQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26326PX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26341AW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26392IX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26429CZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26441FH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26452XA", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G26472EX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26497EU", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G26570RB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26596ON", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G26688CX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26700PN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26712CT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26718PT", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G26754XS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26778RK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26827ST", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26913JX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26918XL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G27000YJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G27071PO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G27236KE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G27248RA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G27263EA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G27300OX", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G27366LV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G27384IP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G27409LG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G27431EQ", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G27520PV", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G27523II", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G27526RV", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G27605DL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G27626TX", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G27655DO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G27721RV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G27796IG", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G27866VO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G27883TZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G27888XB", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G27889FI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G27893KR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28010TC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28023AU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28040SC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28077AI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28116PK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28132XE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28136FA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28326EU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28329XZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28336JR", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G28336ME", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28371PC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28384MU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28465GJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28505XN", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G28525CY", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G28561QO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28570DO", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G28582VX", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G28598IQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28665FP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28749YQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28757BV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28782ND", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G28791JD", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G28801XY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28877HV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28878FC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28881KN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28885XK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28898NZ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G28915JJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28989XR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G29014XV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G29098XN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G29144HY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G29231AT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G29260RF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G29290QO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G29348FH", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G29418HB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G29432PD", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G29477YV", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G29495CE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G29503CE", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G29524AT", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G29622NE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G29624ZY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G29628MO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G29712MR", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G29725MK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G29818FJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G29914BX", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G29940LU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G29956GF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30011VO", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G30086CM", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G30090IC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30120XC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30182VC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30241UB", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G30255XL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30284BK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30296PK", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G30304DE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30304IT", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G30372CO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30391YC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30392XP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30425ZJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30431XW", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G30434QC", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G30443NG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30464XN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30524AR", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G30524IG", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G30584YH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30591GE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30609WQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30614QN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30647NK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30651QG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30739AG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30835JV", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G30871VQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30933VG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30976UY", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G31061SB", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G31073HZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G31087MR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G31101EW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G31118TG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G31208LM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G31288FK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G31317BJ", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G31335UO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G31372TK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G31378RD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G31457ZU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G31540HC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G31601FB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G31676DD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G31686QZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G31729QS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G31776ML", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G31849TV", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G31911LU", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G31997DH", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G32026LV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G32216IU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G32247GO", "type": "N-linked", "subtype": "Complex" }, { "glytoucan_ac": "G32289FM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G32333NU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G32405GG", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G32426JY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G32460TA", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G32556JI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G32588AA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G32590UP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G32624RQ", "type": "N-linked", "subtype": "Complex" }, { "glytoucan_ac": "G32652KI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G32660EU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G32684NS", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G32735YJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G32785BQ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G32853SP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G32863IR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G32877EI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G32910OR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G32944VN", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G33018IJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33024FX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33115WA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33149BM", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G33159AG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33278DK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33345BX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33350QT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33350UC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33368AN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33401IN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33418YX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33463NC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33479HZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33508VK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33569OU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33610ZO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33633KK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33658KS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33669VL", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G33696UB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33719VU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33740YL", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G33758XE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33772BZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33825CM", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G33858ZT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33860PM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33866SM", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G33877TL", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G33886DT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33892UJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33899KJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33908QE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33911NA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33963JX", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G34049BA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G34073UX", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G34096TA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G34100DU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G34143CH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G34162ZB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G34168KI", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G34180FC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G34293SQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G34449IE", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G34461YU", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G34539VP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G34596BP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G34705QH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G34706DW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G34764BK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G34854XJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G34863TS", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G34891MO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G34918NO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G34962LY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G34988TR", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G35127VU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35199BM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35234CM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35243PQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35301YI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35316IV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35343OD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35409SK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35419IZ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G35432EX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35486FC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35528EA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35551AS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35632SP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35656YC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35679QA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35750SU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35799DH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35805TC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35815ZB", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G35825BV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35875IX", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G35884UD", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G35896AC", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G35898DT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35910XN", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G35941VN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35945JK", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G35946GZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35949CT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36046VV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36047BO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36138ZV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36157LL", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G36184OR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36231CI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36404TW", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G36406GU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36410YZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36460YS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36479RD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36482YM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36511AX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36669SS", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G36674QY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36774NW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36777IJ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G36786TD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36793ZF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36807NH", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G36835IG", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G36855EL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36958OJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36970ZN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36983SB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37003XY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37115PC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37134CP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37137WW", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G37190OA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37239FO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37241GG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37282LW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37283DQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37325HA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37354FL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37381UQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37416IR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37435GT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37510PE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37528JY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37530LM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37597VQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37619KE", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G37638KH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37649DI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37653KL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37689ZA", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G37716XX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37779JP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37801HD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37843CX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37927WZ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G38002BK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38004LX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38027UF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38065TJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38075PP", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G38189CI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G38234JH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38296RM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38309TB", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G38316MW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38335CY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38361SH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38402DW", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G38418FR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38462TG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38465NT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38468XG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38506CT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38542FY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38568EL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38688TT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38702PM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38722VX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38754AX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38767OS", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G38773BI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38799GI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38812YS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38823IZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38877IK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38887TM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38975ZC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38979WI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39098FX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39135DL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39136MQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39147LS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39162CC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39174FJ", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G39246KD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39247UK", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G39260NC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39279TA", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G39283IB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39305NP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39308RS", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G39321UZ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G39326PP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G39422JF", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G39423SD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39496AZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39516UK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39523KI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39615UL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39624YQ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G39643KO", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G39650IP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39676NA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39720OK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39759RL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39762RW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39785OI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G39802SS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39865FQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39890DX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39893XZ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G39948NU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40088CY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40107NH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40119MV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40289VL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40291QP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G40294ED", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40319SF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40331VO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40338WB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40347YM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40393FZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40397HC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40445LE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40455IF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40463SB", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G40539YV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40560AU", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G40560HO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40565CN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40580KO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40606LI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40660XA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40681EH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40689UV", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G40709XS", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G40737YL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40757HO", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G40778MP", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G40792HV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40799GH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40834NS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40841KI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G40852TV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40909HG", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G40957MU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40963HH", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G41165PK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41196CX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41220ZV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41245OZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41255BI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41257VM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41286JH", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G41322DV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41330YY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41358UX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41372SJ", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G41384PQ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G41403QR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41424HD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41434QN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41451JJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41498BE", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G41539MU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41540NH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41545LH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41552DE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41552FO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41581KJ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G41606JQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41780OY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41797KJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41816PJ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G41836YE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41866GK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41896LD", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G41919TD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41925MG", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G41928NU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41964LZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42002WQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42039AA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42089IU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42105TS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42120JR", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G42147XQ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G42206TU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42239FO", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G42239OO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42245KI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42263HE", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G42300CL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42325VD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42368XT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42393CS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42444RF", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G42545LJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42603RO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42611JR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42622BJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42632OC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42650PV", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G42665KV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42667BL", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G42668PC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42752PT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42772WO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42814RP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42828SU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42829WM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42912TT", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G42927HH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G43001RF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G43027VE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G43059PA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G43146HZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G43167FQ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G43204BV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G43211ZC", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G43220WQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G43265YA", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G43415UJ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G43438SM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G43449ON", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G43453MN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G43506AH", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G43572AH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G43619YE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G43629KF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G43636EV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G43639BV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G43656YN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G43662XM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G43668RJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G43766HZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G43925AD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G43933MN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G43972TU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G43993DD", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G44127LD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G44198VS", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G44233ST", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G44236OL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G44342ZF", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G44374JT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G44411RJ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G44414IQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G44463UK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G44495BT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G44543KU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G44551BR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G44597NW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G44809JX", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G44886WZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G44917UQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G44980KU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G45086UC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G45095CF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G45235OK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G45291XZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G45313PF", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G45333UL", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G45335XP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G45367LB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G45402WV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G45465HD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G45494FB", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G45563VS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G45565NV", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G45579IH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G45596OR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G45699QA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G45707SN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G45718WR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G45756EL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G45917UD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G45941OK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G46029TT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G46039GY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G46060BG", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G46135RN", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G46168RR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G46174KH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G46241WB", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G46304CE", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G46341RW", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G46360PG", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G46500XL", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G46520QG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G46532VN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G46627WE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G46681XX", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G46748BU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G46754UT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G46760LG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G46785SS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G46822ZY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G46915JA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G46926OL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G46935AJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G46960TX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G47152AG", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G47174QJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G47307MO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G47451TR", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G47459CP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G47537XW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G47560LW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G47590GJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G47652ZE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G47690ND", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G47709SA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G47772RH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G47818EL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G47847UW", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G47925PB", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G47935HW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G47947JW", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G47952MI", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G47975LL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G48064BJ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G48089QY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G48115DD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G48129FF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G48192XR", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G48256FI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G48265KY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G48265YT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G48321FJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G48355MU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G48365EK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G48367IB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G48375OF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G48415TJ", "type": "N-linked", "subtype": "Complex" }, { "glytoucan_ac": "G48440GN", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G48499NG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G48503ML", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G48533PM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G48791KW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G48809BS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G48809VN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G48823WJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G48851YP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G48854JY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G49029NU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G49077EU", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G49088AN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G49104WF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G49120XR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G49221CG", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G49228QV", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G49302PT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G49322HB", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G49332RT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G49349BS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G49390AT", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G49394FL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G49460YF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G49499SW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G49508KM", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G49520ZT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G49567XA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G49603LL", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G49668VU", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G49671FR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G49773DF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G49844LC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G49854OS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G49915EH", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G49944DR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50001GD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50003EV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50003FX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50068TE", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G50165MW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50192TG", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G50198YU", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G50215WR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50223FX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50252SB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50362JF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50425IY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50558NC", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G50574FX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50613GW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50619VO", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G50652EJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50685MJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50762OP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50769VE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50802FP", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G50808YS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50809LR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50849OF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50896EJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50905UI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50937OW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50970GU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51018LC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51103QO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51114IJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51116JR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51140AE", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G51184PT", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G51192NL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51216AJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51318YG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51340HW", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G51343UJ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G51349BU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51500KY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51554PH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51557QE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51566FN", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G51586EE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51678TA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51726CK", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G51747SV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51809TM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51840MR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51842SQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51862BI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G51883EC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51914CH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51914HP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51947OY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51963NX", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G51992CI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52070NB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52120GQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52120NK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52144RR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52179YJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52232VY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52236XX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52239LM", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G52262VT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52316LQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52318OF", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G52376IF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52380IS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52447UD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52515QC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52608IK", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G52639VC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52652AM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52738OC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52794ID", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52839BU", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G52960IE", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G52971SZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53000BS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53016WG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53064IK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53066XA", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G53084MW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53084TQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53151WW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53180NV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53188WR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53206FD", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G53219BI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53220ZS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53225BR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53246IE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53251NX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53266MQ", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G53303ZX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53330OZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53396TS", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G53404LB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53435KM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53472RQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53490OS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53498KG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53502ZZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53522BA", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G53557CQ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G53682MP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53778MF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53809VI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53827VR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53856PB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53861OY", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G53864RZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53880XP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G53931RD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53933PW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54029EI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54043EU", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G54060QF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54083SI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54125VH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54159GO", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G54190AS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54212AC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54264AR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54286RT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54334WY", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G54371SF", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G54394ER", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54409FD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54439SD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54458VQ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G54542VV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54561II", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G54651DQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54706BB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54727BI", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G54765AR", "type": "N-linked", "subtype": "Complex" }, { "glytoucan_ac": "G54795GY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54896JZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54938LL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54994IG", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G55043JL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55051BJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55104BW", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G55144QZ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G55174HS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55205VX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55259BS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55282VK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55331YF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55459MJ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G55464VJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55480NU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55492KC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55529NV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55560NP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55567ZW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55592QU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55636WA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55638XL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55695AY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55700PF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55870EJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55880FX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55967EP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55986UN", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G56011JM", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G56042JM", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G56044AQ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G56067ON", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G56111FM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G56186MJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G56245IE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G56293JI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G56418NV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G56427WT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G56506GT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G56529CD", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G56575BH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G56657VE", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G56675EV", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G56731XW", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G56734EJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G56936OK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G56961QY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G56979BY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G57051HS", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G57068ZS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G57092PW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G57130XG", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G57184TT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G57247BR", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G57249PT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G57296XM", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G57385MA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G57415BF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G57471CR", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G57545VN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G57558XS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G57568CV", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G57591KJ", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G57592QM", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G57692HM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G57772TI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G57836JM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G57840ZW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G57857CB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G57872KZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G57925NK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G57949TL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G57971KJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G57993RM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58066JR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58078TR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58106KY", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G58145JY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58195CE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58201OX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58272ZE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58276QF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58293BE", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G58386YP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58402CL", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G58414HI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58473ZD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58489YE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58511VX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58577QT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58580BP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G58582XO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58590MR", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G58620PN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58683GH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58806SQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58810QT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58878NJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58890ZT", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G58959YB", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G58972RV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59031ZJ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G59035KA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59103LK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59155GF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59332RZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59379KN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59417ID", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59432AC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59498PG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59588ZH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59658KK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59659CN", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G59674PZ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G59684RH", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G59712UJ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G59740UO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59745LP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59746EH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59804FF", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G59930AW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59944EN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59951KW", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G59969VC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59970QL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59973RN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59999BN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60059YM", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G60067UC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60231EF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60234BX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60275BG", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G60282OI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G60341PX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60426XC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60437DK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60457MA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60461BM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60558WQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60603HJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60615ZD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60687DB", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G60731ZH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60734PM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60740GB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60741OC", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G60799ZL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60833BB", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G60884FR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60884PS", "type": "N-linked", "subtype": "Complex" }, { "glytoucan_ac": "G60890ZT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60925RS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60949GI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G60977LC", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G61011QL", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G61072JZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G61108WE", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G61119KT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G61159LY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G61238HB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G61311ZY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G61339UO", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G61341GD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G61358KS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G61367OF", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G61411XJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G61582HZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G61724IO", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G61730RY", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G61747RH", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G61780GR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G61833XV", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G61887VA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G61889LW", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G61929YU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G61972DW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62001NV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62014YU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62044IM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62044ND", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62055DD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62070TZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62081IR", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G62165LJ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G62189UN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62217NB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62218ID", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62221RF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62278MB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62311FX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62382LX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62437NU", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G62469XB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62471ZA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62574YR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62577TV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62680UQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62741IO", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G62765JV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62824TL", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G63020KP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63161GM", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G63193BW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63193FF", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G63194GH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63209WI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63213PP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G63231BS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63241SG", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G63242HY", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G63258OL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63286MF", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G63309YY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63317CA", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G63324SB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63404EE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63416WN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63427CD", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G63444WV", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G63474NY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63570GH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63596DU", "type": "N-linked", "subtype": "Complex" }, { "glytoucan_ac": "G63628UX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63664GB", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G63716UE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63727WO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63748AU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63754TT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63787FE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63794QO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63826DN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63845LK", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G63932ZM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63946SF", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G63978FG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64002SF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64008QI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G64029DP", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G64055WO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64165TJ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G64200LI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64206XB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64239KZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64305XQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64458EC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64476AV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64482PB", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G64485VT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64563CQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64566OC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64575OQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64577HA", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G64774WV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64852XI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64878VD", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G64899EB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64904FE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64904QS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64931FF", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G64937TE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64996BH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65037OI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65085NL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65124UZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65135MY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65200OC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65237AB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65249DN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65262KR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65263TV", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G65321RW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65345RD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65347HP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65348IZ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G65351EL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65363PV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65364FS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65365ZJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65369IB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65396UE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65460ES", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G65600KO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65667PE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65669BM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65796KU", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G65800DR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65805JY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65809MG", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G65837AE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65895VF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65933SR", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G65955VU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65978JH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66030KY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66038TP", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G66040YD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66166BF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66184ZO", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G66188DL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66205CG", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G66215MG", "type": "N-linked", "subtype": "Complex" }, { "glytoucan_ac": "G66253BZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66271TT", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G66284CX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66289YR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66301VC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66307BZ", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G66360FX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66405LD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66414OW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66419SM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66421OE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66435SV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66489LJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66505YL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66512FS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66552NS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66576RC", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G66651WU", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G66662KA", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G66669IY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66685LA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66711OC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66722AJ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G66741QE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66772SE", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G66830UP", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G66838AF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66867PA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66872WN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66887YI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66959DD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66967KV", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G66977DX", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G66991YE", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G67046QM", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G67053LB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67174VO", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G67212WQ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G67255LY", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G67263AS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67265VZ", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G67277GK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67281LU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67300CR", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G67306YE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67354ZM", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G67371HE", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G67384KH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67400MO", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G67407NJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67471ND", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67561OD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67586UM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67590LG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67650WH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67686RZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67693JC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67775HG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67796SA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67821CP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67883AD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67920QO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67959IK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68038KC", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G68074JL", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G68133RV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68175FX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68207KB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68210RO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68232HG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68253RD", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G68264WB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68286QZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68384KC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68391RZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68458SS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68480EG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68529LC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68557OH", "type": "N-linked", "subtype": "Complex" }, { "glytoucan_ac": "G68563JG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68614NL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68636XD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68639VP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G68686HN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68713BO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68721DM", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G68733PD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68776NM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68881YW", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G68893BQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68894XH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68924IG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68931EB", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G68951DB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68986CP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68990TK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69022KK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69033GJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69052CM", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G69065FL", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G69093SL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69096ZS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69118GP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69137GO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69176ZA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69185XX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69229KW", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G69233PF", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G69261IG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69281GH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69327YC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69420JU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69443HY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69445ZX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69446XZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69479TC", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G69500TM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69616MR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69631DE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69683VZ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G69685RI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69723CB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69735UM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69748TK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69762CO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69762TP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G69765IW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69774ND", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69808IK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69824GC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69831AM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69876CC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69890SN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69897TU", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G70074GW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G70081ZH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G70097NU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G70125XL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G70332AA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G70422TG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G70520NA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G70579MZ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G70590VH", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G70631UV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G70647PV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G70648DX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G70688TC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G70783BY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G70815NG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G70857WY", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G71057CI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71089OL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71091AL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71094KR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71121NN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71174VV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71234WE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71247WG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71283AJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71304WV", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G71306LD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71307CC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71331ST", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G71362YO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71409LF", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G71414GS", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G71461JM", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G71479KG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71506JZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71511JI", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G71520GT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71538OA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71575PR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71620LJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71695GL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71698NY", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G71707QJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71713QS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71725KE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71767XQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71773FH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71816WC", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G71835SV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71964JP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71969OB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71999UY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72070EH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72154SP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G72175XZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72261BF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72279PA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72287LC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72289FX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72303HP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72304KR", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G72319UQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72336LC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72379PC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72446TS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72526DQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72579SX", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G72614KG", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G72620YF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72647JE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72647WK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72673RJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72693SY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72729HN", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G72735TB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72790LD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72827OW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72828HZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72830DK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G73033IA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G73076IB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G73184QR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G73323VU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G73328UF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G73344QV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G73351YM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G73382HV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G73423PD", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G73440TD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G73487DJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G73507OY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G73574DM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G73616UE", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G73653TX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G73663RH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G73723ZY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G73829NH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G73913LV", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G74012IM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74038AG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74049SP", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G74130BZ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G74130TT", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G74179EL", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G74225AH", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G74241QD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74242PX", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G74252EK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74286WC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74294TP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74340SH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74396CO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74426IB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74463NF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74471QR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74473MP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74484ON", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74489AS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74491LU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74503BE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74542HC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74607VK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74632FV", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G74684ZW", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G74701OU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74758HW", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G74782FR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74814JR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74917JV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74918VW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74941GK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74975UG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75042KU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75171WW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75178DV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75212LV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75339KH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75381CL", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G75389LS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75407RU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75500ME", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G75518WT", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G75547HK", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G75549SI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75586OT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75594JP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75599HG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75621PH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75637RB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75646NW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75648IS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75687SF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75704MB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75709RV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75726JQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75786FQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75851ZW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75905JY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75999PF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76031FX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76082SD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76104SB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76213KN", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G76214JA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76299ZG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76330SV", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G76362LL", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G76387IG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76389HC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76420FO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76459ZD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76465IY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76470HC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76481US", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G76500NB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76505ZE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76544YY", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G76561LL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76703CC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76726PJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76748ZU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76844PH", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G76863NB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76874HM", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G76876LB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76986FH", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G77109JA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G77136XW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G77149IZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G77208XM", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G77213YG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G77353TH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G77413CE", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G77503IE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G77535NG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G77550KK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G77557JA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G77633IZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G77674IK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G77696IB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G77740PR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G77937PE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G77938VI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G77938WM", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G77960OV", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G78011OA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G78032US", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G78056MI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G78106KK", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G78127DL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G78156NN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G78262KC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G78293EI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G78315FS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G78372JK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G78519JI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G78617GO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G78657XR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G78695ET", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G78734OE", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G78744AW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G78757VY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G78767YD", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G78789AJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G78792AJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G78830IZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G78880TG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G78915OI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G78918BK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G78992FU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G79011EQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G79017QZ", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G79019WG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G79021WI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G79035QO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G79039LV", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G79083TY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G79137TM", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G79222ND", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G79224KH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G79243QP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G79464QJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G79492YL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G79566BO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G79600DE", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G79745IB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G79762CW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G79764DY", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G79855KD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G79878OX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G79889QN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G79915IB", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G79968EZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G79976GJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G80027ER", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G80147HT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G80176YK", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G80188JS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G80204VI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G80316IP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G80343TU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G80345NV", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G80403NF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G80425FZ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G80489MK", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G80577JZ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G80618TG", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G80643JD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G80667HT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G80678HX", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G80700YJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G80719YH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G80738PE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G80903UK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G80951VR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G81013HU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G81041HS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G81082JG", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G81112MA", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G81115FG", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G81167HN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G81213GH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G81214EK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G81221QB", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G81303NJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G81439BR", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G81473HY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G81534KB", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G81541IU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G81628EZ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G81632WR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G81680BU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G81759TU", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G81797TX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G81825YE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G81832XS", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G81944UV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82054AK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82083TQ", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G82092PV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82133EG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82175BQ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G82195SF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82251ZP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82264VK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82267MT", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G82285OB", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G82324DC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82334OE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82362HL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82366DK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82370DV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82412EH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82427FY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82512PT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82621TY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82638QD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82680KA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82693QG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82700SN", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G82714WL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82785ZH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82831RJ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G82862JX", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G82881HF", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G82950HY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82952OK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82970CD", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G83029ZD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G83092KU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G83103PA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G83134ZR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G83192EO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G83206CA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G83232LD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G83244OE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G83261UB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G83412BV", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G83432YR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G83476KH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G83491LR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G83495JN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G83514WC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G83519QC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G83546KK", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G83561CI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G83620XJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G83700KR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G83736YU", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G83754KL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G83831AS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G83843GL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G83952ID", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G83998HE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84003GC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84064VM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84122DM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84168WH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84184XU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84228OY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84273UX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84275GW", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G84332AC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84366AE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84398ZW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84504MZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84515GE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84571QT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84596RP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84641CT", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G84646MS", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G84647SC", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G84818UM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84821OV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84827GB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84853WN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84969LS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G85039TI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G85213IC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G85213NF", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G85284LO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G85284MK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G85302NF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G85310SF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G85313YF", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G85315VP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G85392NL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G85393KI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G85463RK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G85493TB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G85545QE", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G85608AG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G85633MF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G85670FA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G85734JO", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G85736BH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G85828UH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G85851IJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G85890AG", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G85907UO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G85947FY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G85971OX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G85972YO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86002IU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86013XY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86083AM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86085HN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86117ZB", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G86167MF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86173MX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86186US", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86196JH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86199GK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86239DV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86294AN", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G86372GF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86407VN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86537AD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86557DD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86571PO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86669AN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86682HG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86733FM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86736BF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86782PI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G86871XB", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G87014UA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G87249CK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G87253VG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G87256FP", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G87280CM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G87310ZF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G87418QZ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G87420IF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G87514QJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G87574LM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G87676CC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G87699TW", "type": "N-linked", "subtype": "Triantennary" }, { "glytoucan_ac": "G87756AW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G87808DX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G87847UQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G87984PA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G87996EB", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G88014YP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G88043PD", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G88050IP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G88122BX", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G88139CF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G88188XI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G88204LN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G88263BY", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G88347ND", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G88366YR", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G88432QZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G88500KL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G88505QR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G88508SI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G88599FO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G88609PK", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G88624YG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G88687UE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G88708RX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G88725FA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G88780VN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G88837PJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G88856QG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G88936JZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G88975RE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G89058HG", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G89119ID", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G89129AU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G89137AE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G89210OT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G89242LQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G89242PW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G89257WJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G89270VP", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G89315II", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G89398MH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G89603EU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G89605NX", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G89661WR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G89748NG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G89753PC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G89816MU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G89870ED", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G89897ZH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G89946SW", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G89990JE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90103MR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90135ZJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90146ME", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90153WX", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G90182FM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90205AB", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G90242XR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90251SV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90260XX", "type": "N-linked", "subtype": "Complex" }, { "glytoucan_ac": "G90295ID", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90350EB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90402OU", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G90423CD", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G90439ZM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90575VK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90639RS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90684PC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90689AW", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G90724OH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90739UE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90746ZG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90767ZX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90771OP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G90771UI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G90791MJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90818DN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90829NZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90965BZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90999PU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90999QY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G91016QL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G91041PO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G91043NZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G91069QW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G91093AL", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G91161VR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G91166AC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G91181WA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G91227PM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G91313DF", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G91368WO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G91410ZU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G91459EI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G91474LB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G91637SF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G91659ZV", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G91669BT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G91687HB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G91731DX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G91732VA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G91756JQ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G91875JA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G91945VH", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G92115RL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G92155IO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G92175OV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G92194JK", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G92232VN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G92296LB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G92302BV", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G92324IJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G92332SI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G92354TO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G92378XH", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G92399AI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G92424DL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G92485YK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G92509CI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G92594CB", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G92716MQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G92829RR", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G92933OP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G92982UI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93000QZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93045SX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93088DU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93090IR", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G93160RG", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G93195AE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93213IL", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G93239VC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93279YE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93296CH", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G93309ZC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93333OF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93389TU", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G93450CE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93461HH", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G93505VZ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G93526OI", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G93543SY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93592ZT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93597FN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93636BY", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G93696JX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93706QR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93774RM", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G93801LA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93828IC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93861XR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93909NH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93911DY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93913SP", "type": "N-linked", "subtype": "Complex" }, { "glytoucan_ac": "G93984MO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93987XA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93994EV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93996ZB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94005KC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94058TU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94062FP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94070ID", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94072JB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94092LO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94146NJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94161VQ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G94217FB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94234FX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94351CH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94416QP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G94470EI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G94502LK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94514IB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94517VF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94541HG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94566ZN", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G94593TA", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G94595ZZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94599QJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94615OV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94618YC", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G94621HP", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G94705OR", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G94768NG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94808XV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94824OK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94850KK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94855OA", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G94938LU", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G94941PK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G95003CS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G95114RJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G95151JF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G95259QI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G95292IF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G95304AA", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G95324VU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G95329IQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G95353IZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G95397YW", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G95415HZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G95430GC", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G95448VV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G95532JO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G95560ML", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G95593KU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G95615QI", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G95648NB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G95740GH", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G95925PE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96005ME", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96017QA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96066HD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96079CK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96119TZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96142QQ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G96334ZO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96336FY", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G96349RY", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G96373OE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96463EY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96464PC", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G96540EH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96568SI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96576RP", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G96576WB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96599KT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96622FI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96631UP", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G96643WB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96663HG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96691CI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96746BC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96758WF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96763TB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96915PP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96943FZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96950XO", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G96971EN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G97213ID", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G97271OF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G97316FN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G97345NY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G97413OV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G97436XI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G97452SL", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G97473TX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G97494HI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G97529OC", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G97553OZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G97585KM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G97586IF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G97595JJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G97608ZP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G97657WO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G97777ZK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G97793RN", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G97840DJ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G97841LZ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G97850YT", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G97857BW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G97860FK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G97863GV", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G98003WW", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G98073MH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G98074JA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G98126OX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G98166HB", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G98166ZJ", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G98264BW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G98270SB", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G98308VA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G98319WB", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G98383AS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G98393IW", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G98412TA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G98437LC", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G98473NJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G98518WL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G98522DF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G98540XI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G98658WC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G98745FI", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G98795OG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G98873GM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G98891IZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G98912YW", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G98925GS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G98940EW", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G98977CH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99039KB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99041XF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99137GH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99236CU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99244AI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99264QJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99281CN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99354AR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99372JL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99435JQ", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G99448MJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99466GU", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G99507PM", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G99517NL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99522JL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99567UC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99730GF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99738HT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99738PW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99772FN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99783GX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99785MW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99792ZO", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G99893CA", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G99987ZQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99991DB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99998AA", "type": "O-linked", "subtype": "Core 2" } ], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 289 ], "o_linked_sites": [], "snv_sites": [ 28, 65, 227, 252, 289, 353, 401 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 289, "end_pos": 291 }, { "start_pos": 69, "end_pos": 71 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 31 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }