{ "uniprot_canonical_ac": "O95267-1", "uniprot_ac": "O95267", "uniprot_id": "GRP1_HUMAN", "mass": { "chemical_mass": 90402.0, "monoisotopic_mass": 90402.0 }, "refseq": { "ac": "NP_001122074", "name": "RAS guanyl-releasing protein 1 isoform b", "summary": "This gene is a member of a family of genes characterized by the presence of a Ras superfamily guanine nucleotide exchange factor (GEF) domain. It functions as a diacylglycerol (DAG)-regulated nucleotide exchange factor specifically activating Ras through the exchange of bound GDP for GTP. It activates the Erk/MAP kinase cascade and regulates T-cells and B-cells development, homeostasis and differentiation. Alternatively spliced transcript variants encoding different isoforms have been identified. Altered expression of the different isoforms of this protein may be a cause of susceptibility to systemic lupus erythematosus (SLE). [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122074" }, "gene_names": [ { "name": "RASGRP1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O95267", "id": "O95267" }, { "name": "CALDAG-GEFI; CALDAG-GEFII; IMD64; RASGRP", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122074", "id": "NP_001122074" }, { "name": "RASGRP1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122074", "id": "NP_001122074" }, { "name": "RASGRP", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O95267", "id": "O95267" } ], "protein_names": [ { "name": "RAS guanyl-releasing protein 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O95267" }, { "name": "CalDAG-GEFII", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95267" }, { "name": "Calcium and DAG-regulated guanine nucleotide exchange factor II", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95267" }, { "name": "RAS guanyl-releasing protein 1 isoform b", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122074", "id": "NP_001122074" }, { "name": "Ras guanyl-releasing protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95267" }, { "name": "guanine nucleotide exchange factor, calcium- and DAG-regulated, Rap1A; RAS guanyl nucleotide-releasing protein 1; calcium and DAG-regulated guanine nucleotide exchange factor II; ras activator RasGRP; RAS guanyl releasing protein 1 (calcium and DAG-regulated); calcium- and diacylglycerol-regulated guanine nucleotide exchange factor II", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122074", "id": "NP_001122074" } ], "function": [ { "annotation": "A Focused Review of Ras Guanine Nucleotide-Releasing Protein 1 in Immune Cells and Cancer. Review article Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001122074", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122074" }, { "database": "PubMed", "id": "36675167", "url": "https://glygen.org/publication/PubMed/36675167" } ] }, { "annotation": "Abnormal RasGRP1 Expression in the Post-Mortem Brain and Blood Serum of Schizophrenia Patients. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001122074", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122074" }, { "database": "PubMed", "id": "35204828", "url": "https://glygen.org/publication/PubMed/35204828" } ] }, { "annotation": "Dysregulated RASGRP1 expression through RUNX1 mediated transcription promotes autoimmunity.", "evidence": [ { "database": "RefSeq", "id": "NP_001122074", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122074" }, { "database": "PubMed", "id": "33065764", "url": "https://glygen.org/publication/PubMed/33065764" } ] }, { "annotation": "Functions as a calcium- and diacylglycerol (DAG)-regulated nucleotide exchange factor specifically activating Ras through the exchange of bound GDP for GTP (PubMed:15899849, PubMed:23908768, PubMed:27776107, PubMed:29155103). Activates the Erk/MAP kinase cascade (PubMed:15899849). Regulates T-cell/B-cell development, homeostasis and differentiation by coupling T-lymphocyte/B-lymphocyte antigen receptors to Ras (PubMed:10807788, PubMed:12839994, PubMed:27776107, PubMed:29155103). Regulates NK cell cytotoxicity and ITAM-dependent cytokine production by activation of Ras-mediated ERK and JNK pathways (PubMed:19933860). Functions in mast cell degranulation and cytokine secretion, regulating FcERI-evoked allergic responses. May also function in differentiation of other cell types (PubMed:12845332).", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267#function" }, { "database": "PubMed", "id": "12845332", "url": "https://glygen.org/publication/PubMed/12845332" }, { "database": "PubMed", "id": "12839994", "url": "https://glygen.org/publication/PubMed/12839994" }, { "database": "PubMed", "id": "15184873", "url": "https://glygen.org/publication/PubMed/15184873" }, { "database": "UniProtKB", "id": "Q9Z1S3", "url": "https://www.uniprot.org/uniprot/Q9Z1S3#function" }, { "database": "PubMed", "id": "19933860", "url": "https://glygen.org/publication/PubMed/19933860" }, { "database": "PubMed", "id": "10807788", "url": "https://glygen.org/publication/PubMed/10807788" }, { "database": "PubMed", "id": "12782630", "url": "https://glygen.org/publication/PubMed/12782630" }, { "database": "PubMed", "id": "23908768", "url": "https://glygen.org/publication/PubMed/23908768" }, { "database": "PubMed", "id": "29155103", "url": "https://glygen.org/publication/PubMed/29155103" }, { "database": "PubMed", "id": "27776107", "url": "https://glygen.org/publication/PubMed/27776107" }, { "database": "PubMed", "id": "15899849", "url": "https://glygen.org/publication/PubMed/15899849" }, { "database": "PubMed", "id": "15060167", "url": "https://glygen.org/publication/PubMed/15060167" } ] }, { "annotation": "Novel tumour suppressor roles for GZMA and RASGRP1 in Theileria annulata-transformed macrophages and human B lymphoma cells.", "evidence": [ { "database": "RefSeq", "id": "NP_001122074", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122074" }, { "database": "PubMed", "id": "32830401", "url": "https://glygen.org/publication/PubMed/32830401" } ] }, { "annotation": "Nurr1 performs its anti-inflammatory function by regulating RasGRP1 expression in neuro-inflammation. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001122074", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122074" }, { "database": "PubMed", "id": "32612143", "url": "https://glygen.org/publication/PubMed/32612143" } ] }, { "annotation": "This gene is a member of a family of genes characterized by the presence of a Ras superfamily guanine nucleotide exchange factor (GEF) domain. It functions as a diacylglycerol (DAG)-regulated nucleotide exchange factor specifically activating Ras through the exchange of bound GDP for GTP. It activates the Erk/MAP kinase cascade and regulates T-cells and B-cells development, homeostasis and differentiation. Alternatively spliced transcript variants encoding different isoforms have been identified. Altered expression of the different isoforms of this protein may be a cause of susceptibility to systemic lupus erythematosus (SLE). [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001122074", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122074" } ] } ], "disease": [ { "disease_id": "DOID:0111980", "recommended_name": { "id": "DOID:0111980", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111980", "name": "immunodeficiency 64", "description": "A T cell, B cell, and NK cell deficiency characterized by variably decreased numbers of T cells, lesser deficiencies of B and NK cells, decreased phosphorylation of the extracellular-signal-regulated serine kinase ERK in T and B cells, and onset in early childhood of recurrent bacterial, viral, and fungal infections that has_material_basis_in homozygous or compound heterozygous mutation in the RASGRP1 gene on chromosome 15q14." }, "synonyms": [ { "id": "DOID:0111980", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111980", "name": "IMD64", "description": "" }, { "id": "MONDO:0032803", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032803", "name": "immunodeficiency 64", "description": "" }, { "id": "MONDO:0032803", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032803", "name": "IMD64", "description": "" }, { "id": "MONDO:0032803", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032803", "name": "IMMUNODEFICIENCY 64", "description": "" }, { "id": "MIM:618534", "resource": "MIM", "url": "https://www.omim.org/entry/618534", "name": "Immunodeficiency 64 with lymphoproliferation", "description": "Immunodeficiency 64 with lymphoproliferation" } ], "evidence": [ { "id": "618534", "database": "MIM", "url": "https://www.omim.org/entry/618534" } ] }, { "disease_id": "DOID:9074", "recommended_name": { "id": "DOID:9074", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9074", "name": "systemic lupus erythematosus", "description": "A lupus erythematosus that is an inflammation of connective tissue marked by skin rashes, joint pain and swelling, inflammation of the kidneys and inflammation of the tissue surrounding the heart." }, "synonyms": [ { "id": "DOID:9074", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9074", "name": "Lupus Erythematosus, systemic", "description": "" }, { "id": "DOID:9074", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9074", "name": "SLE - Lupus Erythematosus, systemic", "description": "" }, { "id": "DOID:9074", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9074", "name": "disseminated lupus erythematosus", "description": "" }, { "id": "MONDO:0012361", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012361", "name": "systemic lupus erythematosus, susceptibility to, 5", "description": "" }, { "id": "MONDO:0012361", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012361", "name": "SLEB5", "description": "" }, { "id": "MONDO:0012361", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012361", "name": "systemic lupus erythematosus, susceptibility to, 5", "description": "" }, { "id": "MONDO:0012404", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012404", "name": "systemic lupus erythematosus, susceptibility to, 8", "description": "" }, { "id": "MONDO:0012404", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012404", "name": "SLEB8", "description": "" }, { "id": "MONDO:0012404", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012404", "name": "systemic lupus erythematosus, susceptibility to, 8", "description": "" }, { "id": "MONDO:0012403", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012403", "name": "systemic lupus erythematosus, susceptibility to, 7", "description": "" }, { "id": "MONDO:0012403", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012403", "name": "SLEB7", "description": "" }, { "id": "MONDO:0012403", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012403", "name": "systemic lupus erythematosus, susceptibility to, 7", "description": "" }, { "id": "MONDO:0012836", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012836", "name": "systemic lupus erythematosus, susceptibility to, 12", "description": "" }, { "id": "MONDO:0012836", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012836", "name": "SLEB12", "description": "" }, { "id": "MONDO:0012836", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012836", "name": "systemic lupus erythematosus, susceptibility to, 12", "description": "" }, { "id": "MONDO:0013152", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013152", "name": "systemic lupus erythematosus, susceptibility to, 14", "description": "" }, { "id": "MONDO:0013152", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013152", "name": "SLEB14", "description": "" }, { "id": "MONDO:0013152", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013152", "name": "systemic lupus erythematosus, susceptibility to, 14", "description": "" }, { "id": "MONDO:0007915", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007915", "name": "systemic lupus erythematosus", "description": "An autoimmune multi-organ disease typically associated with vasculopathy and autoantibody production. Most patients have antinuclear antibodies (ANA). The presence of anti-dsDNA or anti-Smith antibodies are highly-specific." }, { "id": "MONDO:0007915", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007915", "name": "SLE", "description": "" }, { "id": "MONDO:0007915", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007915", "name": "SLE - lupus erythematosus, systemic", "description": "" }, { "id": "MONDO:0007915", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007915", "name": "disseminated lupus erythematosus", "description": "" }, { "id": "MONDO:0007915", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007915", "name": "lupus erythematosus, systemic", "description": "" }, { "id": "MONDO:0007915", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007915", "name": "systemic lupus erythematosus", "description": "" }, { "id": "MONDO:0007915", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007915", "name": "systemic lupus erythematosus (disease)", "description": "" }, { "id": "MONDO:0007915", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007915", "name": "systemic lupus erythematosus susceptibility to", "description": "" }, { "id": "MONDO:0007915", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007915", "name": "systemic lupus erythematosus, susceptibility to", "description": "" }, { "id": "MONDO:0007915", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007915", "name": "excess LMW-DNA", "description": "" }, { "id": "MONDO:0007915", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007915", "name": "excess lymphocyte low molecular weight DNA", "description": "" }, { "id": "MONDO:0007915", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007915", "name": "lupus nephritis, susceptibility to", "description": "" }, { "id": "MONDO:0010433", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010433", "name": "systemic lupus erythematosus, susceptibility to, 15", "description": "" }, { "id": "MONDO:0010433", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010433", "name": "SLEB15", "description": "" }, { "id": "MONDO:0010433", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010433", "name": "systemic lupus erythematosus, susceptibility to, 15", "description": "" }, { "id": "MONDO:0012036", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012036", "name": "systemic lupus erythematosus, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012036", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012036", "name": "SLEB4", "description": "" }, { "id": "MONDO:0012036", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012036", "name": "systemic lupus erythematosus, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012369", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012369", "name": "systemic lupus erythematosus, susceptibility to, 6", "description": "" }, { "id": "MONDO:0012369", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012369", "name": "SLEB6", "description": "" }, { "id": "MONDO:0012369", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012369", "name": "systemic lupus erythematosus, susceptibility to, 6", "description": "" }, { "id": "MONDO:0012884", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012884", "name": "systemic lupus erythematosus, susceptibility to, 13", "description": "" }, { "id": "MONDO:0012884", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012884", "name": "SLEB13", "description": "" }, { "id": "MONDO:0012884", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012884", "name": "systemic lupus erythematosus, susceptibility to, 13", "description": "" }, { "id": "MONDO:0011560", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011560", "name": "systemic lupus erythematosus, susceptibility to, 3", "description": "" }, { "id": "MONDO:0011560", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011560", "name": "SLEB3", "description": "" }, { "id": "MONDO:0011560", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011560", "name": "systemic lupus erythematosus, susceptibility to, 3", "description": "" }, { "id": "MONDO:0013743", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013743", "name": "autosomal systemic lupus erythematosus type 16", "description": "An instance of systemic lupus erythematosus (disease) that is caused by mutations in DNASE1L3." }, { "id": "MONDO:0013743", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013743", "name": "autosomal SLE", "description": "" }, { "id": "MONDO:0013743", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013743", "name": "familial SLE", "description": "" }, { "id": "MONDO:0013743", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013743", "name": "familial systemic lupus erythematosus", "description": "" }, { "id": "MONDO:0013743", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013743", "name": "SLEB16", "description": "" }, { "id": "MONDO:0013743", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013743", "name": "systemic lupus erythematosus 16", "description": "" }, { "id": "MONDO:0013743", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013743", "name": "systemic lupus erythematosus type 16", "description": "" }, { "id": "MIM:152700", "resource": "MIM", "url": "https://www.omim.org/entry/152700", "name": "Systemic lupus erythematosus", "description": "Systemic lupus erythematosus" }, { "id": "MIM:609939", "resource": "MIM", "url": "https://www.omim.org/entry/609939", "name": "Systemic lupus erythematosus 6", "description": "Systemic lupus erythematosus 6" }, { "id": "MIM:614420", "resource": "MIM", "url": "https://www.omim.org/entry/614420", "name": "Systemic lupus erythematosus 16", "description": "Systemic lupus erythematosus 16" } ], "evidence": [ { "id": "152700", "database": "MIM", "url": "https://www.omim.org/entry/152700" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 271, "end_pos": 271, "sequence_org": "R", "sequence_mut": "E", "comment": "Loss of function; prevents Ras activation.", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" }, { "database": "PubMed", "id": "12845332", "url": "https://glygen.org/publication/PubMed/12845332" }, { "database": "PubMed", "id": "23908768", "url": "https://glygen.org/publication/PubMed/23908768" } ] }, { "start_pos": 483, "end_pos": 487, "sequence_org": "DHDQD", "sequence_mut": "AHAQA", "comment": "Decrease of Ras activation indicated by decrease of ERK phosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" }, { "database": "PubMed", "id": "23908768", "url": "https://glygen.org/publication/PubMed/23908768" } ] }, { "start_pos": 494, "end_pos": 494, "sequence_org": "E", "sequence_mut": "A", "comment": "Decrease of Ras activation indicated by decrease of ERK phosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" }, { "database": "PubMed", "id": "23908768", "url": "https://glygen.org/publication/PubMed/23908768" } ] }, { "start_pos": 506, "end_pos": 506, "sequence_org": "F", "sequence_mut": "D", "comment": "Increase of Ras activation indicated by increase of ERK phosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" }, { "database": "PubMed", "id": "23908768", "url": "https://glygen.org/publication/PubMed/23908768" } ] }, { "start_pos": 508, "end_pos": 508, "sequence_org": "V", "sequence_mut": "D", "comment": "Increase of Ras activation indicated by increase of ERK phosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" }, { "database": "PubMed", "id": "23908768", "url": "https://glygen.org/publication/PubMed/23908768" } ] }, { "start_pos": 549, "end_pos": 549, "sequence_org": "Y", "sequence_mut": "F", "comment": "Loss of localization to the endoplasmic reticulum and the Golgi apparatus.", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" }, { "database": "PubMed", "id": "12782630", "url": "https://glygen.org/publication/PubMed/12782630" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "71.3", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000172575", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172575" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "81.95", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000172575", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172575" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "65.85", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000172575", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172575" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000172575", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172575" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "51.35", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000172575", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172575" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "74.72", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000172575", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172575" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000172575", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172575" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "61.41", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000172575", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172575" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "59.35", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000172575", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172575" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000172575", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172575" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "67.71", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000172575", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172575" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "62.42", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000172575", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172575" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "68.38", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000172575", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172575" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O95267", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95267" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O95267", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95267" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O95267", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95267" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O95267", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95267" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O95267", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95267" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O95267", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95267" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O95267", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95267" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O95267", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95267" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O95267", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95267" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O95267", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95267" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O95267", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95267" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O95267", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95267" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "common_name": "Human" } ], "gene": [ { "name": "RASGRP1", "url": "https://www.uniprot.org/uniprot/O95267", "locus": { "chromosome": "15", "start_pos": 38488103, "end_pos": 38565575, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000172575", "url": "https://www.ensembl.org/id/ENSG00000172575" } ] } } ], "crossref": [ { "id": "ENSG00000172575", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172575", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00155", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00155", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd06224", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd06224", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd20860", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd20860", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd22290", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd22290", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL5953", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL5953", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "RASGRP1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=RASGRP1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "10125", "url": "https://www.ncbi.nlm.nih.gov/gene/10125", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "9878", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=9878", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O95267", "url": "https://www.ebi.ac.uk/intact/interactors/id:O95267*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000651", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000651", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001895", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001895", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002048", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002048", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002219", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002219", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008937", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008937", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011992", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011992", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018247", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018247", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020454", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020454", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023578", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023578", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036964", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036964", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046349", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046349", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:10125", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10125", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "152700", "url": "http://www.omim.org/entry/152700", "database": "MIM", "categories": [ "Other" ] }, { "id": "603962", "url": "http://www.omim.org/entry/603962", "database": "MIM", "categories": [ "Other" ] }, { "id": "618534", "url": "http://www.omim.org/entry/618534", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O95267", "url": "https://www.nextprot.org/entry/NX_O95267", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "CAKWENG", "url": "https://omabrowser.org/oma/group/CAKWENG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4260488at2759", "url": "http://www.orthodb.org/?query=4260488at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23113", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23113", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23113:SF174", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23113:SF174", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "4L9M", "url": "https://www.rcsb.org/structure/4L9M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4L9U", "url": "https://www.rcsb.org/structure/4L9U", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00130", "url": "http://pfam.xfam.org/family/PF00130", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00617", "url": "http://pfam.xfam.org/family/PF00617", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00618", "url": "http://pfam.xfam.org/family/PF00618", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O95267", "url": "https://pharos.nih.gov/targets/O95267", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O95267", "url": "http://purl.obolibrary.org/obo/PR_O95267", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-114508", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114508", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-1169092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169092", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-392517", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-392517", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001122074", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122074", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A8V8TL86", "url": "https://www.uniprot.org/uniprot/A0A8V8TL86", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TL86-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TL86-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TLA7", "url": "https://www.uniprot.org/uniprot/A0A8V8TLA7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TLA7-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TLA7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TMY1", "url": "https://www.uniprot.org/uniprot/A0A8V8TMY1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TMY1-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TMY1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TMY7", "url": "https://www.uniprot.org/uniprot/A0A8V8TMY7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TMY7-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TMY7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YKM0", "url": "https://www.uniprot.org/uniprot/H0YKM0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YKM0-1", "url": "https://www.uniprot.org/uniprot/H0YKM0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YKP8", "url": "https://www.uniprot.org/uniprot/H0YKP8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YKP8-1", "url": "https://www.uniprot.org/uniprot/H0YKP8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YMT0", "url": "https://www.uniprot.org/uniprot/H0YMT0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YMT0-1", "url": "https://www.uniprot.org/uniprot/H0YMT0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YN83", "url": "https://www.uniprot.org/uniprot/H0YN83", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YN83-1", "url": "https://www.uniprot.org/uniprot/H0YN83-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YNG8", "url": "https://www.uniprot.org/uniprot/H0YNG8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YNG8-1", "url": "https://www.uniprot.org/uniprot/H0YNG8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YNK9", "url": "https://www.uniprot.org/uniprot/H0YNK9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YNK9-1", "url": "https://www.uniprot.org/uniprot/H0YNK9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95267-1", "url": "https://www.uniprot.org/uniprot/O95267-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95267-2", "url": "https://www.uniprot.org/uniprot/O95267-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95267-3", "url": "https://www.uniprot.org/uniprot/O95267-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95267-4", "url": "https://www.uniprot.org/uniprot/O95267-4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95267-5", "url": "https://www.uniprot.org/uniprot/O95267-5", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGTLGKAREAPRKPSHGCRAASKARLEAKPANSPFPSHPSLAHITQFRMMVSLGHLAKGASLDDLIDSCIQSFDADGNLCRSNQLLQVMLTMHRIVISSAELLQKVITLYKDALAKNSPGLCLKICYFVRYWITEFWVMFKMDASLTDTMEEFQELVKAKGEELHCRLIDTTQINARDWSRKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKENPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIQVAQKLHQLQNFNTLMAVIGGLCHSSISRLKETSSHVPHEINKVLGEMTELLSSSRNYDNYRRAYGECTDFKIPILGVHLKDLISLYEAMPDYLEDGKVNVHKLLALYNHISELVQLQEVAPPLEANKDLVHLLTLSLDLYYTEDEIYELSYAREPRNHRAPPLTPSKPPVVVDWASGVSPKPDPKTISKHVQRMVDSVFKNYDHDQDGYISQEEFEKIAASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGFPHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRAKNPVAPTENNTSVGPVSNLCSLGAKDLLHAPEEGPFTFPNGEAVEHGEESKDRTIMLMGVSSQKISLRLKRAVAHKATQTESQPWIGSEGPSGPFVLSSPRKTAQDTLYVLPSPTSPCPSPVLVRKRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQLEKSNHVLAQMEQGDCS", "length": 797, "header": "sp|O95267-1|GRP1_HUMAN Isoform 1 of RAS guanyl-releasing protein 1 OS=Homo sapiens OX=9606 GN=RASGRP1 PE=1 SV=2 CANONICAL=O95267-1" }, "isoforms": [ { "isoform_ac": "A0A8V8TL86-1", "url": "", "sequence": { "sequence": "MGTLGKAREAPRKPSHGCRAASKARLEAKPANSPFPSHPSLAHITQFRMMVSLGHLAKGASLDDLIDSCIQSFDADGNLCRSNQLLQVMLTMHRIVISSAELLQKVITLYKDALAKNSPGLCLKICYFVRYWITEFWVMFKMDASLTDTMEEFQELVKAKGEELHCRLIDTTQINARDWSRKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKENPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIQVAQVNNWFKTFGLGYKKLHQLQNFNTLMAVIGGLCHSSISRLKETSSHVPHEINKVLGEMTELLSSSRNYDNYRRAYGECTDFKIPILGVHLKDLISLYEAMPDYLEDGKVNVHKLLALYNHISELVQLQEVAPPLEANKDLVHLLTLSLDLYYTEDEIYELSYAREPRNHRAPPLTPSKPPVVVDWASGVSPKPDPKTISKHVQRMVDSVFKNYDHDQDGYISQEEFEKIAASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGFPHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRAKNPVAPTENNTSVGPVSNLCSLGAKDLLHAPEEGPFTFPNGEAVEHGEESKDRTIMLMGVSSQKISLRLKRAVAHKATQTESQPWIGSEGPSGPFVLSSPRKTAQDTLYVLPSPTSPCPSPVLVRKRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQLEKSNHVLAQMEQGDCS", "length": 810, "header": "tr|A0A8V8TL86-1|A0A8V8TL86_HUMAN Computationally mapped isoform of RAS guanyl-releasing protein 1 OS=Homo sapiens OX=9606 GN=RASGRP1 PE=1 SV=1 CANONICAL=O95267-1" }, "locus": { "chromosome": "15", "start_pos": 38564628, "end_pos": 38490557, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000697782.1", "url": "https://www.ensembl.org/id/ENST00000697782.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000513437.1", "url": "https://www.ensembl.org/id/ENSP00000513437.1" } ] } }, { "isoform_ac": "A0A8V8TLA7-1", "url": "", "sequence": { "sequence": "MGTLGKAREAPRKPSHGCRAASKARLEAKPANSPFPSHPSLAHITQFRMMVSLGHLAKGASLDDLIDSCIQSFDADGNLCRSNQLLQVMLTMHRIVISSAELLQKVITLYKDALAKNSPGLCLKICYFVRYWITEFWVMFKMDASLTDTMEEFQELVKAKGEELHCRLIDTTQINARDWSRKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKENPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIQVAQVLGEMTELLSSSRNYDNYRRAYGECTDFKIPILGVHLKDLISLYEAMPDYLEDGKVNVHKLLALYNHISELVQLQEVAPPLEANKDLVHLLTLSLDLYYTEDEIYELSYAREPRNHRAPPLTPSKPPVVVDWASGVSPKPDPKTISKHVQRMVDSVFKNYDHDQDGYISQEEFEKIAASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGFPHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRAKNPVAPTENNTSVGPVSNLCSLGAKDLLHAPEEGPFTFPNGEAVEHGEESKDRTIMLMGVSSQKISLRLKRAVAHKATQTESQPWIGSEGPSGPFVLSSPRKTAQDTLYVLPSPTSPCPSPVLVRKRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQLEKSNHVLAQMEQGDCS", "length": 758, "header": "tr|A0A8V8TLA7-1|A0A8V8TLA7_HUMAN Computationally mapped isoform of RAS guanyl-releasing protein 1 OS=Homo sapiens OX=9606 GN=RASGRP1 PE=1 SV=1 CANONICAL=O95267-1" }, "locus": { "chromosome": "15", "start_pos": 38564628, "end_pos": 38490557, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000697783.1", "url": "https://www.ensembl.org/id/ENST00000697783.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000513438.1", "url": "https://www.ensembl.org/id/ENSP00000513438.1" } ] } }, { "isoform_ac": "A0A8V8TMY1-1", "url": "", "sequence": { "sequence": "MMVSLGHLAKGASLDDLIDSCIQSFDADGNLCRSNQLLQVMLTMHRIVISSAELLQKVITLYKDALAKNSPGLCLKICYFVRYWITEFWVMFKMDASLTDTMEEFQELVKAKGEELHCRLIDTTQINARDWSRKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKENPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIQVAQVLGEMTELLSSSRNYDNYRRAYGECTDFKIPILGVHLKDLISLYEAMPDYLEDGKVNVHKLLALYNHISELVQLQEVAPPLEANKDLVHLLTLSLDLYYTEDEIYELSYAREPRNHRAPSVFKNYDHDQDGYISQEEFEKIAASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGFPHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRAKNPVAPTENNTSVGPVSNLCSLGAKDLLHAPEEGPFTFPNGEAVEHGEESKDRTIMLMGVSSQKISLRLKRAVAHKATQTESQPWIGSEGPSGPFVLSSPRKTAQDTLYVLPSPTSPCPSPVLVRKRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQLEKSNHVLAQMEQGDCS", "length": 675, "header": "tr|A0A8V8TMY1-1|GRP1_HUMAN Computationally mapped isoform of RAS guanyl-releasing protein 1 OS=Homo sapiens OX=9606 GN=RASGRP1 PE=1 SV=1 CANONICAL=O95267-1" }, "locus": { "chromosome": "15", "start_pos": 38559896, "end_pos": 38490557, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000697780.1", "url": "https://www.ensembl.org/id/ENST00000697780.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000513436.1", "url": "https://www.ensembl.org/id/ENSP00000513436.1" } ] } }, { "isoform_ac": "A0A8V8TMY7-1", "url": "", "sequence": { "sequence": "MMVSLGHLAKGASLDDLIDSCIQSFALPIRMLWQRIHQDFA", "length": 41, "header": "tr|A0A8V8TMY7-1|GRP1_HUMAN Computationally mapped isoform of RAS guanyl-releasing protein 1 OS=Homo sapiens OX=9606 GN=RASGRP1 PE=1 SV=1 CANONICAL=O95267-1" }, "locus": { "chromosome": "15", "start_pos": 38559896, "end_pos": 38519331, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000697786.1", "url": "https://www.ensembl.org/id/ENST00000697786.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000513441.1", "url": "https://www.ensembl.org/id/ENSP00000513441.1" } ] } }, { "isoform_ac": "H0YKM0-1", "url": "", "sequence": { "sequence": "MKVVPTSPTPTDARRPRLGQIWITPVERTSTQAALVQGAGRRAQGTCLRPSPADGYLETPGHRKPSHGCRAASKARLEAKPANSPFPSHPSLAHITQFRMMVSLGHLAKGASLDDLIDSCIQSFDADGNLCRSNQLLQVMLTMHRIVISSAELLQKVITLYKDALAKNSPGLCLKICYFVRYWITEFWVMFKMDASLTDTMEEFQELVKAKGEELHCRLIDTTQINARDWSRKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKENPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIQVAQKLHQLQNFNTLMAVIGGLCHSSISRLKETSSHVPHEINKVLGEMTELLSSSRNYDNYRRAYGECTDFKIPILGVHLKDLISLYEAMPDYLEDGKVNVHKLLALYNHISELVQLQEVAPPLEANKDLVHLLTLSLDLYYTEDEIYELSYAREPRNHRAPPLTPSKPPVVVDWASGVSPKPDPKTISKHVQRMVDSVFKNYDHDQDGYISQEEFEKIAASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGFPHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRAKNPVAPTENNTSVGPVSNLCSLGAKDLLHAPEEGPFTFPNGEAVEHGEESKDRTIMLMGVSSQKISLRLKRAVAHKATQTESQPWIGSEGPSGPFVLSSPRKTAQDTLYVLPSPTSPCPSPVLVRKRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQLEKSNHVLAQMEQGDCS", "length": 848, "header": "tr|H0YKM0-1|GRP1_HUMAN Computationally mapped isoform of RAS guanyl-releasing protein 1 OS=Homo sapiens OX=9606 GN=RASGRP1 PE=1 SV=1 CANONICAL=O95267-1" }, "locus": { "chromosome": "15", "start_pos": 38565489, "end_pos": 38490557, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000561180.5", "url": "https://www.ensembl.org/id/ENST00000561180.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000452859.1", "url": "https://www.ensembl.org/id/ENSP00000452859.1" } ] } }, { "isoform_ac": "H0YKP8-1", "url": "", "sequence": { "sequence": "MMVSLGHLAKGASLDDLIDSCIQSFDADGNLC", "length": 32, "header": "tr|H0YKP8-1|H0YKP8_HUMAN Computationally mapped isoform of RAS guanyl releasing protein 1 OS=Homo sapiens OX=9606 GN=RASGRP1 PE=4 SV=1 CANONICAL=O95267-1" }, "locus": { "chromosome": "15", "start_pos": 38559896, "end_pos": 38526385, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000560929.1", "url": "https://www.ensembl.org/id/ENST00000560929.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000452892.1", "url": "https://www.ensembl.org/id/ENSP00000452892.1" } ] } }, { "isoform_ac": "H0YMT0-1", "url": "", "sequence": { "sequence": "ETTYLKPTFCDNCAGFLWGVIKQGYRCKDIRILLLMLRFTDKGYIKSVSSGLHQVRRMLASLGMLSVLAPEDRTDMCDKKALHEFGCETHWGREKSERLLDPGCLVHRLRDELSQTMQRSGCV", "length": 123, "header": "tr|H0YMT0-1|H0YMT0_HUMAN Computationally mapped isoform of RAS guanyl releasing protein 1 OS=Homo sapiens OX=9606 GN=RASGRP1 PE=4 SV=1 CANONICAL=O95267-1" }, "locus": { "chromosome": "15", "start_pos": 38501190, "end_pos": 38498901, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000557875.1", "url": "https://www.ensembl.org/id/ENST00000557875.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000453729.1", "url": "https://www.ensembl.org/id/ENSP00000453729.1" } ] } }, { "isoform_ac": "H0YN83-1", "url": "", "sequence": { "sequence": "MMVSLGHLAKGASLDDLIDSCIQSFDADGNLCRSNQLLQVMLTMHRIVISSAELLQKVITLYKDALAKNSPGLCLKICYFVRYWITEFWVMFKMDASLTDTMEEFQELVKAKGEELHCRLIDTTQINARDWSRKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKENPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIQVAQKLHQLQNFNTLMAVIGGLCHSSISRLKETSSHVPHEINKVLGEMTELLSSSRNYDNYRRAYGECTDFKIPILGVHLKDLISLYEAMPDYLEDGKVNVHKLLALYNHISELVQLQEVAPPLEANKDLVHLLTLSLDLYYTEDEIYELSYAREPRNHRAPPLTPSKPPVVVDWASGVSPKPDPKTISKHVQRMVDSVFKNYDHDQDGYISQEEFEKIAASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGFPHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRAKNPVAPTENNTSVGPVSNLCSLGAKDLLHAPEEGPFTFPNGEAVEHGEESKDRTIMLMGVSSQKISLRLKRAVAHKATQTESQPWIGSEGPSGPFVLSSPRKTAQDTLYVLPSPTSPCPSPVLVRKRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQLEKSNHVLAQMEQGDCS", "length": 749, "header": "tr|H0YN83-1|GRP1_HUMAN Computationally mapped isoform of RAS guanyl-releasing protein 1 OS=Homo sapiens OX=9606 GN=RASGRP1 PE=1 SV=2 CANONICAL=O95267-1" }, "locus": { "chromosome": "15", "start_pos": 38559896, "end_pos": 38490557, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000697785.1", "url": "https://www.ensembl.org/id/ENST00000697785.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000513440.1", "url": "https://www.ensembl.org/id/ENSP00000513440.1" } ] } }, { "isoform_ac": "H0YNG8-1", "url": "", "sequence": { "sequence": "MMVSLGHLAKGASLDDLIDSCIQSFDADGNLCRSNQLLQVMLTMHRIVISSAELLQKVITLYKDALAKNSPGLCLKICYFVRYWITEFWVMFKMDASLTDTMEEFQELVKAKGEELHCRLIDTTQINARDWSRKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKENPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIQVAQKLHQLQNFNTLMAVIGGLCHSSISRLKETSSHVPHEINKVLGEMTELLSSSRNYDNYRRAYGECTDFKIPILGVHLKDLISLYEAMPDYLEDGKVNVHKLLALYNHISELVQLQEVAPPLEANKDLVHLLTLSLDLYYTEDEIYELSYAREPRNHRAPPLTPSKPPVVVDWASGVSPKPDPKTISKHVQRMVDSVFKNYDHDQDGYISQEEFEKIAASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGFPHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRAKNPVAPTENNTSVGPVSNLCSLGAKDLLHAPEEGPFTFPNGEAVEHGEESKDRTIMLMGVSSQKISLRLKRAVAHKATQTESQPWIGSEGPSGPFVLSSPRKTAQDTLYVLPSPTSPCPSPVLVRKRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEEECLSGFSQKHQGLHCVFGDLSVQTQNQYPASRIPYIILHSTD", "length": 749, "header": "tr|H0YNG8-1|GRP1_HUMAN Computationally mapped isoform of RAS guanyl-releasing protein 1 OS=Homo sapiens OX=9606 GN=RASGRP1 PE=1 SV=2 CANONICAL=O95267-1" }, "locus": { "chromosome": "15", "start_pos": 38559896, "end_pos": 38492459, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000561117.6", "url": "https://www.ensembl.org/id/ENST00000561117.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000454005.2", "url": "https://www.ensembl.org/id/ENSP00000454005.2" } ] } }, { "isoform_ac": "H0YNK9-1", "url": "", "sequence": { "sequence": "QNFNTLMAVIGGLCHSSISRLKETSSHVPHEINKVLGEMTELLSSSRNYDNYRRAYGECTDFKIPILGVHLKDLISLYEAMPDYLEDGKVNVHKLLALYNHISELVQLQEVAPPLEANKDLVHLLTLSLDLYYTEDEIYELSYAREPRNHRAPSVFKNYDHDQDGYISQEEFEKIAASFPFSFCVMDKDRAHGSNHEVAHTILPLRIKRKGRPHQQG", "length": 217, "header": "tr|H0YNK9-1|GRP1_HUMAN Computationally mapped isoform of RAS guanyl-releasing protein 1 OS=Homo sapiens OX=9606 GN=RASGRP1 PE=1 SV=1 CANONICAL=O95267-1" }, "locus": { "chromosome": "15", "start_pos": 38511705, "end_pos": 38501267, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000560425.1", "url": "https://www.ensembl.org/id/ENST00000560425.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000454053.1", "url": "https://www.ensembl.org/id/ENSP00000454053.1" } ] } }, { "isoform_ac": "O95267-1", "url": "", "sequence": { "sequence": "MGTLGKAREAPRKPSHGCRAASKARLEAKPANSPFPSHPSLAHITQFRMMVSLGHLAKGASLDDLIDSCIQSFDADGNLCRSNQLLQVMLTMHRIVISSAELLQKVITLYKDALAKNSPGLCLKICYFVRYWITEFWVMFKMDASLTDTMEEFQELVKAKGEELHCRLIDTTQINARDWSRKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKENPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIQVAQKLHQLQNFNTLMAVIGGLCHSSISRLKETSSHVPHEINKVLGEMTELLSSSRNYDNYRRAYGECTDFKIPILGVHLKDLISLYEAMPDYLEDGKVNVHKLLALYNHISELVQLQEVAPPLEANKDLVHLLTLSLDLYYTEDEIYELSYAREPRNHRAPPLTPSKPPVVVDWASGVSPKPDPKTISKHVQRMVDSVFKNYDHDQDGYISQEEFEKIAASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGFPHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRAKNPVAPTENNTSVGPVSNLCSLGAKDLLHAPEEGPFTFPNGEAVEHGEESKDRTIMLMGVSSQKISLRLKRAVAHKATQTESQPWIGSEGPSGPFVLSSPRKTAQDTLYVLPSPTSPCPSPVLVRKRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQLEKSNHVLAQMEQGDCS", "length": 797, "header": "sp|O95267-1|GRP1_HUMAN Isoform 1 of RAS guanyl-releasing protein 1 OS=Homo sapiens OX=9606 GN=RASGRP1 PE=1 SV=2 CANONICAL=O95267-1" }, "locus": { "chromosome": "15", "start_pos": 38564628, "end_pos": 38490557, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000310803.10", "url": "https://www.ensembl.org/id/ENST00000310803.10" }, { "database": "Ensembl Peptide", "id": "ENSP00000310244.5", "url": "https://www.ensembl.org/id/ENSP00000310244.5" } ] } }, { "isoform_ac": "O95267-2", "url": "", "sequence": { "sequence": "MGTLGKAREAPRKPSHGCRAASKARLEAKPANSPFPSHPSLAHITQFRMMVSLGHLAKGASLDDLIDSCIQSFDADGNLCRSNQLLQVMLTMHRIVISSAELLQKVITLYKDALAKNSPGLCLKICYFVRYWITEFWVMFKMDASLTDTMEEFQELVKAKGEELHCRLIDTTQINARDWSRKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKENPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIQVAQKLHQLQNFNTLMAVIGGLCHSSISRLKETSSHVPHEINKVLGEMTELLSSSRNYDNYRRAYGECTDFKIPILGVHLKDLISLYEAMPDYLEDGKVNVHKLLALYNHISELVQLQEVAPPLEANKDLVHLLTLSLDLYYTEDEIYELSYAREPRNHRAPSVFKNYDHDQDGYISQEEFEKIAASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGFPHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRAKNPVAPTENNTSVGPVSNLCSLGAKDLLHAPEEGPFTFPNGEAVEHGEESKDRTIMLMGVSSQKISLRLKRAVAHKATQTESQPWIGSEGPSGPFVLSSPRKTAQDTLYVLPSPTSPCPSPVLVRKRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQLEKSNHVLAQMEQGDCS", "length": 762, "header": "sp|O95267-2|GRP1_HUMAN Isoform 2 of RAS guanyl-releasing protein 1 OS=Homo sapiens OX=9606 GN=RASGRP1 PE=1 SV=2 CANONICAL=O95267-1" }, "locus": { "chromosome": "15", "start_pos": 38564628, "end_pos": 38490557, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000450598.6", "url": "https://www.ensembl.org/id/ENST00000450598.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000388540.2", "url": "https://www.ensembl.org/id/ENSP00000388540.2" } ] } }, { "isoform_ac": "O95267-3", "url": "", "sequence": { "sequence": "MGTLGKAREAPRKPSHGCRAASKARLEAKPANSPFPSHPSLAHITQFRMMVSLGHLAKGASLDDLIDSCIQSFDADGNLCRSNQLLQVMLTMHRIVISSAELLQKVITLYKDALAKNSPGLCLKICYFVRYWITEFWVMFKMDASLTDTMEEFQELVKAKGEELHCRLIDTTQINARDWSRKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKENPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIQVAQKLHQLQNFNTLMAVIGGLCHSSISRLKETSSHVPHEINKVLGEMTELLSSSRNYDNYRRAYGECTDFKIPILGVHLKDLISLYEAMPDYLEDGKVNVHKLLALYNHISELVQLQEVAPPLEANKDLVHLLTLSLDLYYTEDEIYELSYAREPRNHRAPSVFKNYDHDQDGYISQEEFEKIAASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGFPHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRAKNPVAPTENNTSVGPVSNLCSLGAKDLLHGNKYSESR", "length": 597, "header": "sp|O95267-3|GRP1_HUMAN Isoform 3 of RAS guanyl-releasing protein 1 OS=Homo sapiens OX=9606 GN=RASGRP1 PE=1 SV=2 CANONICAL=O95267-1" }, "locus": { "chromosome": "15", "start_pos": 38564628, "end_pos": 38490666, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000559830.5", "url": "https://www.ensembl.org/id/ENST00000559830.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000452721.1", "url": "https://www.ensembl.org/id/ENSP00000452721.1" } ] } }, { "isoform_ac": "O95267-4", "url": "", "sequence": { "sequence": "MGTLGKAREAPRKPSHGCRAASKARLEAKPANSPFPSHPSLAHITQFRMMVSLGHLAKGASLDDLIDSCIQSFDADGNLCRSNQLLQVMLTMHRIVISSAELLQKVITLYKDALAKNSPGLCLKICYFVRYWITEFWVMFKMDASLTDTMEEFQELVKAKGEELHCRLIDTTQINARDWSRKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKENPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIQVAQKLHQLQNFNTLMAVIGGLCHSSISRLKETSSHVPHEINKVLGEMTELLSSSRNYDNYRRAYGECTDFKIPILGVHLKDLISLYEAMPDYLEDGKVNVHKLLALYNHISELVQLQEVAPPLEANKDLVHLLTLSLDLYYTEDEIYELSYAREPRNHRAPSVFKNYDHDQDGYISQEEFEKIAASFPFSFCVMDKDSSGE", "length": 481, "header": "sp|O95267-4|GRP1_HUMAN Isoform 4 of RAS guanyl-releasing protein 1 OS=Homo sapiens OX=9606 GN=RASGRP1 PE=1 SV=2 CANONICAL=O95267-1" }, "locus": { "chromosome": "15", "start_pos": 38564628, "end_pos": 38500130, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000414708.6", "url": "https://www.ensembl.org/id/ENST00000414708.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000413105.2", "url": "https://www.ensembl.org/id/ENSP00000413105.2" } ] } }, { "isoform_ac": "O95267-5", "url": "", "sequence": { "sequence": "MGTLGKAREAPRKPSHGCRAASKARLEAKPANSPFPSHPSLAHITQFRMMVSLGHLAKGASLDDLIDSCIQSFDADGNLCRSNQLLQVMLTMHRIVISSAELLQKVITLYKDALAKNSPGLCLKICYFVRYWITEFWVMFKMDASLTDTMEEFQELVKAKGEELHCRLIDTTQINARDWSRKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKENPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIQVAQKLHQLQNFNTLMAVIGGLCHSSISRLKETSSHVPHEINKVLGEMTELLSSSRNYDNYRRAYGECTDFKIPILGVHLKDLISLYEAMPDYLEDGKVNVHKLLALYNHISELVQLQEVAPPLEANKDLVHLLTLSLDLYYTEDEIYELSYAREPRNHRAPSVFKNYDHDQDGYISQEEFEKIAASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGFPHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKGNKYSESR", "length": 546, "header": "sp|O95267-5|GRP1_HUMAN Isoform 5 of RAS guanyl-releasing protein 1 OS=Homo sapiens OX=9606 GN=RASGRP1 PE=1 SV=2 CANONICAL=O95267-1" }, "locus": { "chromosome": "15", "start_pos": 38564628, "end_pos": 38490666, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000558164.5", "url": "https://www.ensembl.org/id/ENST00000558164.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000454164.1", "url": "https://www.ensembl.org/id/ENSP00000454164.1" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 184, "end_pos": 184, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by PKC", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" }, { "database": "iPTMnet", "id": "O95267", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95267" }, { "database": "PubMed", "id": "15657177", "url": "https://glygen.org/publication/PubMed/15657177" }, { "database": "PubMed", "id": "15899849", "url": "https://glygen.org/publication/PubMed/15899849" }, { "database": "PubMed", "id": "28952923", "url": "https://glygen.org/publication/PubMed/28952923" } ], "site_lbl": "Thr184" }, { "start_pos": 91, "end_pos": 91, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95267", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95267" }, { "database": "PubMed", "id": "35494241", "url": "" } ], "site_lbl": "Thr91" } ], "glycation": [], "keywords": [], "publication": [ { "title": "RasGRP, a Ras activator: mouse and human cDNA sequences and chromosomal positions.", "journal": "Mamm. Genome", "date": "1999", "authors": "Bottorff D, Ebinu J, Stone JC", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "reference": [ { "type": "PubMed", "id": "10087292", "url": "https://glygen.org/publication/PubMed/10087292" } ] }, { "title": "Protein kinase C-theta (PKCtheta) distribution analysis in hematopoietic cells: proliferating T cells exhibit high proportions of PKCtheta in the particulate fraction.", "journal": "Cellular immunology", "date": "1999", "authors": "Meller N, Elitzur Y, Isakov N", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169092" } ], "reference": [ { "type": "PubMed", "id": "10222061", "url": "https://glygen.org/publication/PubMed/10222061" } ] }, { "title": "Integrin signaling.", "journal": "Science (New York, N.Y.)", "date": "1999", "authors": "Giancotti FG, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "10446041", "url": "https://glygen.org/publication/PubMed/10446041" } ] }, { "title": "Two co-existing mechanisms for nuclear import of MAP kinase: passive diffusion of a monomer and active transport of a dimer.", "journal": "The EMBO journal", "date": "1999", "authors": "Adachi M, Fukuda M, Nishida E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "10508167", "url": "https://glygen.org/publication/PubMed/10508167" } ] }, { "title": "TAK1 mitogen-activated protein kinase kinase kinase is activated by autophosphorylation within its activation loop.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Kishimoto K, Matsumoto K, Ninomiya-Tsuji J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "10702308", "url": "https://glygen.org/publication/PubMed/10702308" } ] }, { "title": "Regulatory proteins of R-Ras, TC21/R-Ras2, and M-Ras/R-Ras3.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Ohba Y, Mochizuki N, Yamashita S, Chan AM, Schrader JW, Hattori S, Nagashima K, Matsuda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169092" } ], "reference": [ { "type": "PubMed", "id": "10777492", "url": "https://glygen.org/publication/PubMed/10777492" } ] }, { "title": "RasGRP links T-cell receptor signaling to Ras.", "journal": "Blood", "date": "2000-05-15", "authors": "Ebinu J O, Stang S L, Teixeira C, Bottorff D A, Hooton J, Blumberg P M, Barry M, Bleakley R C, Ostergaard H L, Stone J C", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "reference": [ { "type": "PubMed", "id": "10807788", "url": "https://glygen.org/publication/PubMed/10807788" } ] }, { "title": "CalDAG-GEFIII activation of Ras, R-ras, and Rap1.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Yamashita S, Mochizuki N, Ohba Y, Tobiume M, Okada Y, Sawa H, Nagashima K, Matsuda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169092" } ], "reference": [ { "type": "PubMed", "id": "10835426", "url": "https://glygen.org/publication/PubMed/10835426" } ] }, { "title": "Phosphorylation-dependent activation of TAK1 mitogen-activated protein kinase kinase kinase by TAB1.", "journal": "FEBS letters", "date": "2000", "authors": "Sakurai H, Miyoshi H, Mizukami J, Sugita T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "10838074", "url": "https://glygen.org/publication/PubMed/10838074" } ] }, { "title": "A novel RalGEF-like protein, RGL3, as a candidate effector for rit and Ras.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Shao H, Andres DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "10869344", "url": "https://glygen.org/publication/PubMed/10869344" } ] }, { "title": "TAB2, a novel adaptor protein, mediates activation of TAK1 MAPKKK by linking TAK1 to TRAF6 in the IL-1 signal transduction pathway.", "journal": "Molecular cell", "date": "2000", "authors": "Takaesu G, Kishida S, Hiyama A, Yamaguchi K, Shibuya H, Irie K, Ninomiya-Tsuji J, Matsumoto K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "10882101", "url": "https://glygen.org/publication/PubMed/10882101" } ] }, { "title": "Threonine phosphorylation of the beta 3 integrin cytoplasmic tail, at a site recognized by PDK1 and Akt/PKB in vitro, regulates Shc binding.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Kirk RI, Sanderson MR, Lerea KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "10896934", "url": "https://glygen.org/publication/PubMed/10896934" } ] }, { "title": "Identification of guanine nucleotide exchange factors (GEFs) for the Rap1 GTPase. Regulation of MR-GEF by M-Ras-GTP interaction.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Rebhun JF, Castro AF, Quilliam LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169092" } ], "reference": [ { "type": "PubMed", "id": "10934204", "url": "https://glygen.org/publication/PubMed/10934204" } ] }, { "title": "Identification of shc as the primary protein binding to the tyrosine-phosphorylated beta 3 subunit of alpha IIbbeta 3 during outside-in integrin platelet signaling.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Cowan KJ, Law DA, Phillips DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "10964917", "url": "https://glygen.org/publication/PubMed/10964917" } ] }, { "title": "Flt3 ligand induces tyrosine phosphorylation of gab1 and gab2 and their association with shp-2, grb2, and PI3 kinase.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Zhang S, Broxmeyer HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "11027663", "url": "https://glygen.org/publication/PubMed/11027663" } ] }, { "title": "Properties and functions of diacylglycerol kinases.", "journal": "Cellular signalling", "date": "2000", "authors": "van Blitterswijk WJ, Houssa B", "evidence": [ { "database": "Reactome", "id": "R-HSA-114508", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114508" } ], "reference": [ { "type": "PubMed", "id": "11080611", "url": "https://glygen.org/publication/PubMed/11080611" } ] }, { "title": "Flt3 mutations from patients with acute myeloid leukemia induce transformation of 32D cells mediated by the Ras and STAT5 pathways.", "journal": "Blood", "date": "2000", "authors": "Mizuki M, Fenski R, Halfter H, Matsumura I, Schmidt R, Muller C, Gruning W, Kratz-Albers K, Serve S, Steur C, Buchner T, Kienast J, Kanakura Y, Berdel WE, Serve H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "11090077", "url": "https://glygen.org/publication/PubMed/11090077" } ] }, { "title": "Identification of paracaspases and metacaspases: two ancient families of caspase-like proteins, one of which plays a key role in MALT lymphoma.", "journal": "Molecular cell", "date": "2000", "authors": "Uren AG, O'Rourke K, Aravind LA, Pisabarro MT, Seshagiri S, Koonin EV, Dixit VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "11090634", "url": "https://glygen.org/publication/PubMed/11090634" } ] }, { "title": "Crystal structure and functional analysis of Ras binding to its effector phosphoinositide 3-kinase gamma.", "journal": "Cell", "date": "2000", "authors": "Pacold ME, Suire S, Perisic O, Lara-Gonzalez S, Davis CT, Walker EH, Hawkins PT, Stephens L, Eccleston JF, Williams RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "11136978", "url": "https://glygen.org/publication/PubMed/11136978" } ] }, { "title": "Phorbol esters modulate the Ras exchange factor RasGRP3.", "journal": "Cancer research", "date": "2001", "authors": "Lorenzo PS, Kung JW, Bottorff DA, Garfield SH, Stone JC, Blumberg PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169092" } ], "reference": [ { "type": "PubMed", "id": "11221888", "url": "https://glygen.org/publication/PubMed/11221888" } ] }, { "title": "Diacylglycerol kinase zeta regulates Ras activation by a novel mechanism.", "journal": "J. Cell Biol.", "date": "2001", "authors": "Topham M K, Prescott S M", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "reference": [ { "type": "PubMed", "id": "11257115", "url": "https://glygen.org/publication/PubMed/11257115" } ] }, { "title": "A novel potential effector of M-Ras and p21 Ras negatively regulates p21 Ras-mediated gene induction and cell growth.", "journal": "Oncogene", "date": "2001", "authors": "Ehrhardt GR, Korherr C, Wieler JS, Knaus M, Schrader JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "11313946", "url": "https://glygen.org/publication/PubMed/11313946" } ] }, { "title": "Persistent activation of NF-kappa B by the tax transforming protein involves chronic phosphorylation of IkappaB kinase subunits IKKbeta and IKKgamma.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Carter RS, Geyer BC, Xie M, Acevedo-Suarez CA, Ballard DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "11325957", "url": "https://glygen.org/publication/PubMed/11325957" } ] }, { "title": "The versatility and universality of calcium signalling.", "journal": "Nature reviews. Molecular cell biology", "date": "2000", "authors": "Berridge MJ, Lipp P, Bootman MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-114508", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114508" } ], "reference": [ { "type": "PubMed", "id": "11413485", "url": "https://glygen.org/publication/PubMed/11413485" } ] }, { "title": "TAK1 is a ubiquitin-dependent kinase of MKK and IKK.", "journal": "Nature", "date": "2001", "authors": "Wang C, Deng L, Hong M, Akkaraju GR, Inoue J, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "11460167", "url": "https://glygen.org/publication/PubMed/11460167" } ] }, { "title": "Biochemical signals and biological responses elicited by the focal adhesion kinase.", "journal": "Biochimica et biophysica acta", "date": "2001", "authors": "Schaller MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "11476890", "url": "https://glygen.org/publication/PubMed/11476890" } ] }, { "title": "Evidence for existence of a nuclear pore complex-mediated, cytosol-independent pathway of nuclear translocation of ERK MAP kinase in permeabilized cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Matsubayashi Y, Fukuda M, Nishida E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "11546808", "url": "https://glygen.org/publication/PubMed/11546808" } ] }, { "title": "PEA-15 mediates cytoplasmic sequestration of ERK MAP kinase.", "journal": "Developmental cell", "date": "2001", "authors": "Formstecher E, Ramos JW, Fauquet M, Calderwood DA, Hsieh JC, Canton B, Nguyen XT, Barnier JV, Camonis J, Ginsberg MH, Chneiweiss H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "11702783", "url": "https://glygen.org/publication/PubMed/11702783" } ] }, { "title": "Phosphorylation of the protein kinase C-theta activation loop and hydrophobic motif regulates its kinase activity, but only activation loop phosphorylation is critical to in vivo nuclear-factor-kappaB induction.", "journal": "The Biochemical journal", "date": "2002", "authors": "Liu Y, Graham C, Li A, Fisher RJ, Shaw S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "11772397", "url": "https://glygen.org/publication/PubMed/11772397" } ] }, { "title": "Cloning and functional expression of human short TRP7, a candidate protein for store-operated Ca2+ influx.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Riccio A, Mattei C, Kelsell RE, Medhurst AD, Calver AR, Randall AD, Davis JB, Benham CD, Pangalos MN", "evidence": [ { "database": "Reactome", "id": "R-HSA-114508", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114508" } ], "reference": [ { "type": "PubMed", "id": "11805119", "url": "https://glygen.org/publication/PubMed/11805119" } ] }, { "title": "Expression of a catalytically inactive form of diacylglycerol kinase alpha induces sustained signaling through RasGRP.", "journal": "FASEB J.", "date": "2002", "authors": "Jones David R, Sanju\u00e1n Miguel Angel, Stone James C, M\u00e9rida Isabel", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "reference": [ { "type": "PubMed", "id": "11919165", "url": "https://glygen.org/publication/PubMed/11919165" } ] }, { "title": "Coordinate interactions of Csk, Src, and Syk kinases with [alpha]IIb[beta]3 initiate integrin signaling to the cytoskeleton.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Obergfell A, Eto K, Mocsai A, Buensuceso C, Moores SL, Brugge JS, Lowell CA, Shattil SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "11940607", "url": "https://glygen.org/publication/PubMed/11940607" } ] }, { "title": "ERK2 enters the nucleus by a carrier-independent mechanism.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Whitehurst AW, Wilsbacher JL, You Y, Luby-Phelps K, Moore MS, Cobb MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "12032311", "url": "https://glygen.org/publication/PubMed/12032311" } ] }, { "title": "The phosphatidylinositol 3-Kinase AKT pathway in human cancer.", "journal": "Nature reviews. Cancer", "date": "2002", "authors": "Vivanco I, Sawyers CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "12094235", "url": "https://glygen.org/publication/PubMed/12094235" } ] }, { "title": "Activation of phosphoinositide 3-kinase gamma by Ras.", "journal": "Current biology : CB", "date": "2002", "authors": "Suire S, Hawkins P, Stephens L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "12121613", "url": "https://glygen.org/publication/PubMed/12121613" } ] }, { "title": "Protein kinase C-theta (PKC theta): a key enzyme in T cell life and death.", "journal": "Journal of biochemistry", "date": "2002", "authors": "Altman A, Villalba M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "12473184", "url": "https://glygen.org/publication/PubMed/12473184" } ] }, { "title": "Integration of DAG signaling systems mediated by PKC-dependent phosphorylation of RasGRP3.", "journal": "Blood", "date": "2003", "authors": "Teixeira C, Stang SL, Zheng Y, Beswick NS, Stone JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169092" } ], "reference": [ { "type": "PubMed", "id": "12730099", "url": "https://glygen.org/publication/PubMed/12730099" } ] }, { "title": "Exchange factors of the RasGRP family mediate Ras activation in the Golgi.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Caloca MJ, Zugaza JL, Bustelo XR", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "reference": [ { "type": "PubMed", "id": "12782630", "url": "https://glygen.org/publication/PubMed/12782630" } ] }, { "title": "Vav mediates Ras stimulation by direct activation of the GDP/GTP exchange factor Ras GRP1.", "journal": "The EMBO journal", "date": "2003-07-01", "authors": "Caloca Mar\u00eda J, Zugaza Jos\u00e9 L, Matallanas David, Crespo Piero, Bustelo Xos\u00e9 R", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "reference": [ { "type": "PubMed", "id": "12839994", "url": "https://glygen.org/publication/PubMed/12839994" } ] }, { "title": "Phospholipase Cgamma activates Ras on the Golgi apparatus by means of RasGRP1.", "journal": "Nature", "date": "2003", "authors": "Bivona TG, Perez De Castro I, Ahearn IM, Grana TM, Chiu VK, Lockyer PJ, Cullen PJ, Pellicer A, Cox AD, Philips MR", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "reference": [ { "type": "PubMed", "id": "12845332", "url": "https://glygen.org/publication/PubMed/12845332" } ] }, { "title": "PEA-15 binding to ERK1/2 MAPKs is required for its modulation of integrin activation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Chou FL, Hill JM, Hsieh JC, Pouyssegur J, Brunet A, Glading A, Uberall F, Ramos JW, Werner MH, Ginsberg MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "14506247", "url": "https://glygen.org/publication/PubMed/14506247" } ] }, { "title": "Signal-induced ubiquitination of I kappaB Kinase-beta.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Carter RS, Pennington KN, Ungurait BJ, Arrate P, Ballard DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "14514672", "url": "https://glygen.org/publication/PubMed/14514672" } ] }, { "title": "The death effector domain protein PEA-15 prevents nuclear entry of ERK2 by inhibiting required interactions.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Whitehurst AW, Robinson FL, Moore MS, Cobb MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "14707138", "url": "https://glygen.org/publication/PubMed/14707138" } ] }, { "title": "Integrin activation.", "journal": "Journal of cell science", "date": "2004", "authors": "Calderwood DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "14754902", "url": "https://glygen.org/publication/PubMed/14754902" } ] }, { "title": "Ras activation in Jurkat T cells following low-grade stimulation of the T-cell receptor is specific to N-Ras and occurs only on the Golgi apparatus.", "journal": "Molecular and cellular biology", "date": "2004-04", "authors": "Perez de Castro Ignacio, Bivona Trever G, Philips Mark R, Pellicer Angel", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "reference": [ { "type": "PubMed", "id": "15060167", "url": "https://glygen.org/publication/PubMed/15060167" } ] }, { "title": "The TRAF6 ubiquitin ligase and TAK1 kinase mediate IKK activation by BCL10 and MALT1 in T lymphocytes.", "journal": "Molecular cell", "date": "2004", "authors": "Sun L, Deng L, Ea CK, Xia ZP, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "15125833", "url": "https://glygen.org/publication/PubMed/15125833" } ] }, { "title": "Structural basis for integrin alphaIIbbeta3 clustering.", "journal": "Biochemical Society transactions", "date": "2004", "authors": "Li R, Bennett JS, Degrado WF", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "15157149", "url": "https://glygen.org/publication/PubMed/15157149" } ] }, { "title": "Inverted signaling hierarchy between RAS and RAC in T-lymphocytes.", "journal": "Oncogene", "date": "2004-07-29", "authors": "Zugaza Jos\u00e9 L, Caloca Mar\u00eda J, Bustelo Xos\u00e9 R", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "reference": [ { "type": "PubMed", "id": "15184873", "url": "https://glygen.org/publication/PubMed/15184873" } ] }, { "title": "TAB2 and TAB3 activate the NF-kappaB pathway through binding to polyubiquitin chains.", "journal": "Molecular cell", "date": "2004", "authors": "Kanayama A, Seth RB, Sun L, Ea CK, Hong M, Shaito A, Chiu YH, Deng L, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "15327770", "url": "https://glygen.org/publication/PubMed/15327770" } ] }, { "title": "CalDAG-GEFI integrates signaling for platelet aggregation and thrombus formation.", "journal": "Nature medicine", "date": "2004", "authors": "Crittenden JR, Bergmeier W, Zhang Y, Piffath CL, Liang Y, Wagner DD, Housman DE, Graybiel AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "15334074", "url": "https://glygen.org/publication/PubMed/15334074" } ] }, { "title": "Phosphorylation of Grb2-associated binder 2 on serine 623 by ERK MAPK regulates its association with the phosphatase SHP-2 and decreases STAT5 activation.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2004", "authors": "Arnaud M, Crouin C, Deon C, Loyaux D, Bertoglio J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "15356145", "url": "https://glygen.org/publication/PubMed/15356145" } ] }, { "title": "Nuclear localization and regulation of erk- and rsk-encoded protein kinases.", "journal": "Molecular and cellular biology", "date": "1992", "authors": "Chen RH, Sarnecki C, Blenis J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "1545823", "url": "https://glygen.org/publication/PubMed/1545823" } ] }, { "title": "RIAM, an Ena/VASP and Profilin ligand, interacts with Rap1-GTP and mediates Rap1-induced adhesion.", "journal": "Developmental cell", "date": "2004", "authors": "Lafuente EM, van Puijenbroek AA, Krause M, Carman CV, Freeman GJ, Berezovskaya A, Constantine E, Springer TA, Gertler FB, Boussiotis VA", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "15469846", "url": "https://glygen.org/publication/PubMed/15469846" } ] }, { "title": "Live Cell Imaging of ERK and MEK: simple binding equilibrium explains the regulated nucleocytoplasmic distribution of ERK.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Burack WR, Shaw AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "15546878", "url": "https://glygen.org/publication/PubMed/15546878" } ] }, { "title": "Rap1GAP2 is a new GTPase-activating protein of Rap1 expressed in human platelets.", "journal": "Blood", "date": "2005", "authors": "Schultess J, Danielewski O, Smolenski AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-392517", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-392517" } ], "reference": [ { "type": "PubMed", "id": "15632203", "url": "https://glygen.org/publication/PubMed/15632203" } ] }, { "title": "Phosphorylation of RasGRP3 on threonine 133 provides a mechanistic link between PKC and Ras signaling systems in B cells.", "journal": "Blood", "date": "2005", "authors": "Zheng Y, Liu H, Coughlin J, Zheng J, Li L, Stone JC", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" }, { "database": "Reactome", "id": "R-HSA-1169092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169092" }, { "database": "iPTMnet", "id": "O95267", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95267" } ], "reference": [ { "type": "PubMed", "id": "15657177", "url": "https://glygen.org/publication/PubMed/15657177" } ] }, { "title": "A diacylglycerol-protein kinase C-RasGRP1 pathway directs Ras activation upon antigen receptor stimulation of T cells.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Roose JP, Mollenauer M, Gupta VA, Stone J, Weiss A", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" }, { "database": "iPTMnet", "id": "O95267", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95267" } ], "reference": [ { "type": "PubMed", "id": "15899849", "url": "https://glygen.org/publication/PubMed/15899849" } ] }, { "title": "Integrins and Src: dynamic duo of adhesion signaling.", "journal": "Trends in cell biology", "date": "2005", "authors": "Shattil SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "16005629", "url": "https://glygen.org/publication/PubMed/16005629" } ] }, { "title": "Multi-step fibrinogen binding to the integrin (alpha)IIb(beta)3 detected using force spectroscopy.", "journal": "Biophysical journal", "date": "2005", "authors": "Litvinov RI, Bennett JS, Weisel JW, Shuman H", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "16040750", "url": "https://glygen.org/publication/PubMed/16040750" } ] }, { "title": "Multiple roles of Rap1 in hematopoietic cells: complementary versus antagonistic functions.", "journal": "Blood", "date": "2005", "authors": "Stork PJ, Dillon TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "16076873", "url": "https://glygen.org/publication/PubMed/16076873" } ] }, { "title": "PTP-1B is an essential positive regulator of platelet integrin signaling.", "journal": "The Journal of cell biology", "date": "2005", "authors": "Arias-Salgado EG, Haj F, Dubois C, Moran B, Kasirer-Friede A, Furie BC, Furie B, Neel BG, Shattil SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "16115959", "url": "https://glygen.org/publication/PubMed/16115959" } ] }, { "title": "Essential function for the kinase TAK1 in innate and adaptive immune responses.", "journal": "Nature immunology", "date": "2005", "authors": "Sato S, Sanjo H, Takeda K, Ninomiya-Tsuji J, Yamamoto M, Kawai T, Matsumoto K, Takeuchi O, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "16186825", "url": "https://glygen.org/publication/PubMed/16186825" } ] }, { "title": "Critical role of novel Thr-219 autophosphorylation for the cellular function of PKCtheta in T lymphocytes.", "journal": "The EMBO journal", "date": "2005", "authors": "Thuille N, Heit I, Fresser F, Krumbock N, Bauer B, Leuthaeusser S, Dammeier S, Graham C, Copeland TD, Shaw S, Baier G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "16252004", "url": "https://glygen.org/publication/PubMed/16252004" } ] }, { "title": "RasGRP1 and RasGRP3 regulate B cell proliferation by facilitating B cell receptor-Ras signaling.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2005", "authors": "Coughlin JJ, Stang SL, Dower NA, Stone JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169092" } ], "reference": [ { "type": "PubMed", "id": "16301621", "url": "https://glygen.org/publication/PubMed/16301621" } ] }, { "title": "Phosphorylation of CARMA1: the link(er) to NF-kappaB activation.", "journal": "Immunity", "date": "2005", "authors": "Rueda D, Thome M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "16356853", "url": "https://glygen.org/publication/PubMed/16356853" } ] }, { "title": "Phosphorylation of CARMA1 plays a critical role in T Cell receptor-mediated NF-kappaB activation.", "journal": "Immunity", "date": "2005", "authors": "Matsumoto R, Wang D, Blonska M, Li H, Kobayashi M, Pappu B, Chen Y, Wang D, Lin X", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "16356856", "url": "https://glygen.org/publication/PubMed/16356856" } ] }, { "title": "Roles of tyrosine 589 and 591 in STAT5 activation and transformation mediated by FLT3-ITD.", "journal": "Blood", "date": "2006", "authors": "Rocnik JL, Okabe R, Yu JC, Lee BH, Giese N, Schenkein DP, Gilliland DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "16627759", "url": "https://glygen.org/publication/PubMed/16627759" } ] }, { "title": "Identification of Y589 and Y599 in the juxtamembrane domain of Flt3 as ligand-induced autophosphorylation sites involved in binding of Src family kinases and the protein tyrosine phosphatase SHP2.", "journal": "Blood", "date": "2006", "authors": "Heiss E, Masson K, Sundberg C, Pedersen M, Sun J, Bengtsson S, Ronnstrand L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "16684964", "url": "https://glygen.org/publication/PubMed/16684964" } ] }, { "title": "Rap1 regulation of RIAM and cell adhesion.", "journal": "Methods in enzymology", "date": "2006", "authors": "Lafuente E, Boussiotis VA", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "16757337", "url": "https://glygen.org/publication/PubMed/16757337" } ] }, { "title": "The IRAK-1-BCL10-MALT1-TRAF6-TAK1 cascade mediates signaling to NF-kappaB from Toll-like receptor 4.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Dong W, Liu Y, Peng J, Chen L, Zou T, Xiao H, Liu Z, Li W, Bu Y, Qi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "16831874", "url": "https://glygen.org/publication/PubMed/16831874" } ] }, { "title": "Integrin-regulated FAK-Src signaling in normal and cancer cells.", "journal": "Current opinion in cell biology", "date": "2006", "authors": "Mitra SK, Schlaepfer DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "16919435", "url": "https://glygen.org/publication/PubMed/16919435" } ] }, { "title": "Selective function of PKC-theta in T cells.", "journal": "Cellular & molecular immunology", "date": "2006", "authors": "Manicassamy S, Gupta S, Sun Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "16978534", "url": "https://glygen.org/publication/PubMed/16978534" } ] }, { "title": "Regulation and function of IKK and IKK-related kinases.", "journal": "Science's STKE : signal transduction knowledge environment", "date": "2006", "authors": "Hacker H, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "17047224", "url": "https://glygen.org/publication/PubMed/17047224" } ] }, { "title": "Site-specific Lys-63-linked tumor necrosis factor receptor-associated factor 6 auto-ubiquitination is a critical determinant of I kappa B kinase activation.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Lamothe B, Besse A, Campos AD, Webster WK, Wu H, Darnay BG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "17135271", "url": "https://glygen.org/publication/PubMed/17135271" } ] }, { "title": "TAK1-dependent signaling requires functional interaction with TAB2/TAB3.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Besse A, Lamothe B, Campos AD, Webster WK, Maddineni U, Lin SC, Wu H, Darnay BG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "17158449", "url": "https://glygen.org/publication/PubMed/17158449" } ] }, { "title": "Association of p21ras with phosphatidylinositol 3-kinase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1991", "authors": "Sjolander A, Yamamoto K, Huber BE, Lapetina EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "1716764", "url": "https://glygen.org/publication/PubMed/1716764" } ] }, { "title": "Structural basis of integrin activation by talin.", "journal": "Cell", "date": "2007", "authors": "Wegener KL, Partridge AW, Han J, Pickford AR, Liddington RC, Ginsberg MH, Campbell ID", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "17218263", "url": "https://glygen.org/publication/PubMed/17218263" } ] }, { "title": "CSK: a protein-tyrosine kinase involved in regulation of src family kinases.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Okada M, Nada S, Yamanashi Y, Yamamoto T, Nakagawa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "1722201", "url": "https://glygen.org/publication/PubMed/1722201" } ] }, { "title": "Unusual interplay of two types of Ras activators, RasGRP and SOS, establishes sensitive and robust Ras activation in lymphocytes.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Roose JP, Mollenauer M, Ho M, Kurosaki T, Weiss A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169092" } ], "reference": [ { "type": "PubMed", "id": "17283063", "url": "https://glygen.org/publication/PubMed/17283063" } ] }, { "title": "CARMA1 coiled-coil domain is involved in the oligomerization and subcellular localization of CARMA1 and is required for T cell receptor-induced NF-kappaB activation.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Tanner MJ, Hanel W, Gaffen SL, Lin X", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "17428801", "url": "https://glygen.org/publication/PubMed/17428801" } ] }, { "title": "Ubiquitin-mediated activation of TAK1 and IKK.", "journal": "Oncogene", "date": "2007", "authors": "Adhikari A, Xu M, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "17496917", "url": "https://glygen.org/publication/PubMed/17496917" } ] }, { "title": "Platelet integrins and immunoreceptors.", "journal": "Immunological reviews", "date": "2007", "authors": "Kasirer-Friede A, Kahn ML, Shattil SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "17624957", "url": "https://glygen.org/publication/PubMed/17624957" } ] }, { "title": "SKAP55 modulates T cell antigen receptor-induced activation of the Ras-Erk-AP1 pathway by binding RasGRP1.", "journal": "Mol. Immunol.", "date": "2008", "authors": "Kosco Karena A, Cerignoli Fabio, Williams Scott, Abraham Robert T, Mustelin Tomas", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "reference": [ { "type": "PubMed", "id": "17658605", "url": "https://glygen.org/publication/PubMed/17658605" } ] }, { "title": "Defective expression of ras guanyl nucleotide-releasing protein 1 in a subset of patients with systemic lupus erythematosus.", "journal": "J. Immunol.", "date": "2007", "authors": "Yasuda Shinsuke, Stevens Richard L, Terada Tomoko, Takeda Masumi, Hashimoto Toko, Fukae Jun, Horita Tetsuya, Kataoka Hiroshi, Atsumi Tatsuya, Koike Takao", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "reference": [ { "type": "PubMed", "id": "17878389", "url": "https://glygen.org/publication/PubMed/17878389" } ] }, { "title": "Malt1 ubiquitination triggers NF-kappaB signaling upon T-cell activation.", "journal": "The EMBO journal", "date": "2007", "authors": "Oeckinghaus A, Wegener E, Welteke V, Ferch U, Arslan SC, Ruland J, Scheidereit C, Krappmann D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "17948050", "url": "https://glygen.org/publication/PubMed/17948050" } ] }, { "title": "Oncogenic signaling of class I PI3K isoforms.", "journal": "Oncogene", "date": "2008", "authors": "Denley A, Kang S, Karst U, Vogt PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "17998941", "url": "https://glygen.org/publication/PubMed/17998941" } ] }, { "title": "Cyclic nucleotide-dependent protein kinases inhibit binding of 14-3-3 to the GTPase-activating protein Rap1GAP2 in platelets.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Hoffmeister M, Riha P, Neumuller O, Danielewski O, Schultess J, Smolenski AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-392517", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-392517" } ], "reference": [ { "type": "PubMed", "id": "18039662", "url": "https://glygen.org/publication/PubMed/18039662" } ] }, { "title": "Talin at a glance.", "journal": "Journal of cell science", "date": "2008", "authors": "Critchley DR, Gingras AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "18434644", "url": "https://glygen.org/publication/PubMed/18434644" } ] }, { "title": "Purification of a plasma membrane-associated GTPase-activating protein specific for rap1/Krev-1 from HL60 cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1991", "authors": "Polakis PG, Rubinfeld B, Evans T, McCormick F", "evidence": [ { "database": "Reactome", "id": "R-HSA-392517", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-392517" } ], "reference": [ { "type": "PubMed", "id": "1846040", "url": "https://glygen.org/publication/PubMed/1846040" } ] }, { "title": "TRAF6 specifically contributes to FcepsilonRI-mediated cytokine production but not mast cell degranulation.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Yang YJ, Chen W, Carrigan SO, Chen WM, Roth K, Akiyama T, Inoue J, Marshall JS, Berman JN, Lin TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "18772140", "url": "https://glygen.org/publication/PubMed/18772140" } ] }, { "title": "Essential role of ERK dimers in the activation of cytoplasmic but not nuclear substrates by ERK-scaffold complexes.", "journal": "Molecular cell", "date": "2008", "authors": "Casar B, Pinto A, Crespo P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "18775330", "url": "https://glygen.org/publication/PubMed/18775330" } ] }, { "title": "The GTPase superfamily: conserved structure and molecular mechanism.", "journal": "Nature", "date": "1991", "authors": "Bourne HR, Sanders DA, McCormick F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "1898771", "url": "https://glygen.org/publication/PubMed/1898771" } ] }, { "title": "Lipid activation of protein kinases.", "journal": "Journal of lipid research", "date": "2009", "authors": "Newton AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-114508", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114508" } ], "reference": [ { "type": "PubMed", "id": "19033211", "url": "https://glygen.org/publication/PubMed/19033211" } ] }, { "title": "ERK dimers and scaffold proteins: unexpected partners for a forgotten (cytoplasmic) task.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2009", "authors": "Casar B, Pinto A, Crespo P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "19279408", "url": "https://glygen.org/publication/PubMed/19279408" } ] }, { "title": "ERK nuclear translocation is dimerization-independent but controlled by the rate of phosphorylation.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Lidke DS, Huang F, Post JN, Rieger B, Wilsbacher J, Thomas JL, Pouyssegur J, Jovin TM, Lenormand P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "19920141", "url": "https://glygen.org/publication/PubMed/19920141" } ] }, { "title": "RasGRP1 is required for human NK cell function.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2009-12-15", "authors": "Lee Suk Hyung, Yun Sohyun, Lee Jiwon, Kim Mi Jeong, Piao Zheng-Hao, Jeong Mira, Chung Jin Woong, Kim Tae-Don, Yoon Suk Ran, Greenberg Philip D, Choi Inpyo", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "reference": [ { "type": "PubMed", "id": "19933860", "url": "https://glygen.org/publication/PubMed/19933860" } ] }, { "title": "The IKK complex, a central regulator of NF-kappaB activation.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2010", "authors": "Israel A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "20300203", "url": "https://glygen.org/publication/PubMed/20300203" } ] }, { "title": "RalGDS family members couple Ras to Ral signalling and that's not all.", "journal": "Cellular signalling", "date": "2010", "authors": "Ferro E, Trabalzini L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "20478380", "url": "https://glygen.org/publication/PubMed/20478380" } ] }, { "title": "Antigen receptor signaling to NF-kappaB via CARMA1, BCL10, and MALT1.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2010", "authors": "Thome M, Charton JE, Pelzer C, Hailfinger S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "20685844", "url": "https://glygen.org/publication/PubMed/20685844" } ] }, { "title": "Ras superfamily GEFs and GAPs: validated and tractable targets for cancer therapy?", "journal": "Nature reviews. Cancer", "date": "2010", "authors": "Vigil D, Cherfils J, Rossman KL, Der CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "21102635", "url": "https://glygen.org/publication/PubMed/21102635" } ] }, { "title": "Activation and function of the MAPKs and their substrates, the MAPK-activated protein kinases.", "journal": "Microbiology and molecular biology reviews : MMBR", "date": "2011", "authors": "Cargnello M, Roux PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "21372320", "url": "https://glygen.org/publication/PubMed/21372320" } ] }, { "title": "Purification, cDNA-cloning and expression of human diacylglycerol kinase.", "journal": "FEBS letters", "date": "1990", "authors": "Schaap D, de Widt J, van der Wal J, Vandekerckhove J, van Damme J, Gussow D, Ploegh HL, van Blitterswijk WJ, van der Bend RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-114508", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114508" } ], "reference": [ { "type": "PubMed", "id": "2175712", "url": "https://glygen.org/publication/PubMed/2175712" } ] }, { "title": "RAS Interaction with PI3K: More Than Just Another Effector Pathway.", "journal": "Genes & cancer", "date": "2011", "authors": "Castellano E, Downward J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "21779497", "url": "https://glygen.org/publication/PubMed/21779497" } ] }, { "title": "Therapeutic strategies for targeting ras proteins.", "journal": "Genes & cancer", "date": "2011", "authors": "Gysin S, Salt M, Young A, McCormick F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "21779505", "url": "https://glygen.org/publication/PubMed/21779505" } ] }, { "title": "Oligomeric structure of the MALT1 tandem Ig-like domains.", "journal": "PloS one", "date": "2011", "authors": "Qiu L, Dhe-Paganon S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "21966355", "url": "https://glygen.org/publication/PubMed/21966355" } ] }, { "title": "RAS oncogenes: weaving a tumorigenic web.", "journal": "Nature reviews. Cancer", "date": "2011", "authors": "Pylayeva-Gupta Y, Grabocka E, Bar-Sagi D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "21993244", "url": "https://glygen.org/publication/PubMed/21993244" } ] }, { "title": "ERK1/2 MAP kinases: structure, function, and regulation.", "journal": "Pharmacological research", "date": "2012", "authors": "Roskoski R Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "22569528", "url": "https://glygen.org/publication/PubMed/22569528" } ] }, { "title": "A comprehensive survey of Ras mutations in cancer.", "journal": "Cancer research", "date": "2012", "authors": "Prior IA, Lewis PD, Mattos C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "22589270", "url": "https://glygen.org/publication/PubMed/22589270" } ] }, { "title": "Probing the GTPase cycle with real-time NMR: GAP and GEF activities in cell extracts.", "journal": "Methods (San Diego, Calif.)", "date": "2012", "authors": "Marshall CB, Meiri D, Smith MJ, Mazhab-Jafari MT, Gasmi-Seabrook GM, Rottapel R, Stambolic V, Ikura M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "22750304", "url": "https://glygen.org/publication/PubMed/22750304" } ] }, { "title": "Regulation of PKC-theta function by phosphorylation in T cell receptor signaling.", "journal": "Frontiers in immunology", "date": "2012", "authors": "Wang X, Chuang HC, Li JP, Tan TH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "22798961", "url": "https://glygen.org/publication/PubMed/22798961" } ] }, { "title": "The protein tyrosine phosphatase, Shp2, positively contributes to FLT3-ITD-induced hematopoietic progenitor hyperproliferation and malignant disease in vivo.", "journal": "Leukemia", "date": "2013", "authors": "Nabinger SC, Li XJ, Ramdas B, He Y, Zhang X, Zeng L, Richine B, Bowling JD, Fukuda S, Goenka S, Liu Z, Feng GS, Yu M, Sandusky GE, Boswell HS, Zhang ZY, Kapur R, Chan RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "23103841", "url": "https://glygen.org/publication/PubMed/23103841" } ] }, { "title": "Regulation of small GTPases by GEFs, GAPs, and GDIs.", "journal": "Physiological reviews", "date": "2013", "authors": "Cherfils J, Zeghouf M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "23303910", "url": "https://glygen.org/publication/PubMed/23303910" } ] }, { "title": "Nonredundant functions for Ras GTPase-activating proteins in tissue homeostasis.", "journal": "Science signaling", "date": "2013", "authors": "King PD, Lubeck BA, Lapinski PE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "23443682", "url": "https://glygen.org/publication/PubMed/23443682" } ] }, { "title": "Structure of ERK2 bound to PEA-15 reveals a mechanism for rapid release of activated MAPK.", "journal": "Nature communications", "date": "2013", "authors": "Mace PD, Wallez Y, Egger MF, Dobaczewska MK, Robinson H, Pasquale EB, Riedl SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "23575685", "url": "https://glygen.org/publication/PubMed/23575685" } ] }, { "title": "Structural analysis of autoinhibition in the Ras-specific exchange factor RasGRP1.", "journal": "eLife", "date": "2013", "authors": "Iwig JS, Vercoulen Y, Das R, Barros T, Limnander A, Che Y, Pelton JG, Wemmer DE, Roose JP, Kuriyan J", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "reference": [ { "type": "PubMed", "id": "23908768", "url": "https://glygen.org/publication/PubMed/23908768" } ] }, { "title": "PI3K/AKT signaling pathway and cancer: an updated review.", "journal": "Annals of medicine", "date": "2014", "authors": "Martini M, De Santis MC, Braccini L, Gulluni F, Hirsch E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "24897931", "url": "https://glygen.org/publication/PubMed/24897931" } ] }, { "title": "`RAF` neighborhood: protein-protein interaction in the Raf/Mek/Erk pathway.", "journal": "FEBS letters", "date": "2014", "authors": "Cseh B, Doma E, Baccarini M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "24937142", "url": "https://glygen.org/publication/PubMed/24937142" } ] }, { "title": "Ral small GTPase signaling and oncogenesis: More than just 15minutes of fame.", "journal": "Biochimica et biophysica acta", "date": "2014", "authors": "Gentry LR, Martin TD, Reiner DJ, Der CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "25219551", "url": "https://glygen.org/publication/PubMed/25219551" } ] }, { "title": "Ras activation revisited: role of GEF and GAP systems.", "journal": "Biological chemistry", "date": "2015", "authors": "Hennig A, Markwart R, Esparza-Franco MA, Ladds G, Rubio I", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "25781681", "url": "https://glygen.org/publication/PubMed/25781681" } ] }, { "title": "The Key Role of Calmodulin in KRAS-Driven Adenocarcinomas.", "journal": "Molecular cancer research : MCR", "date": "2015", "authors": "Nussinov R, Muratcioglu S, Tsai CJ, Jang H, Gursoy A, Keskin O", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "26085527", "url": "https://glygen.org/publication/PubMed/26085527" } ] }, { "title": "RASGRP1 deficiency causes immunodeficiency with impaired cytoskeletal dynamics.", "journal": "Nature immunology", "date": "2016", "authors": "Salzer E, Cagdas D, Hons M, Mace EM, Garncarz W, Petronczki OY, Platzer R, Pfajfer L, Bilic I, Ban SA, Willmann KL, Mukherjee M, Supper V, Hsu HT, Banerjee PP, Sinha P, McClanahan F, Zlabinger GJ, Pickl WF, Gribben JG, Stockinger H, Bennett KL, Huppa JB, Dupre L, Sanal O, Jager U, Sixt M, Tezcan I, Orange JS, Boztug K", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "reference": [ { "type": "PubMed", "id": "27776107", "url": "https://glygen.org/publication/PubMed/27776107" } ] }, { "title": "Targeting Ras with Macromolecules.", "journal": "Cold Spring Harbor perspectives in medicine", "date": "2018", "authors": "Pei D, Chen K, Liao H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "28778966", "url": "https://glygen.org/publication/PubMed/28778966" } ] }, { "title": "Combined immunodeficiency with EBV positive B cell lymphoma and epidermodysplasia verruciformis due to a novel homozygous mutation in RASGRP1.", "journal": "Clinical immunology (Orlando, Fla.)", "date": "2017", "authors": "Platt CD, Fried AJ, Hoyos-Bachiloglu R, Usmani GN, Schmidt B, Whangbo J, Chiarle R, Chou J, Geha RS", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "reference": [ { "type": "PubMed", "id": "28822832", "url": "https://glygen.org/publication/PubMed/28822832" } ] }, { "title": "A Histidine pH sensor regulates activation of the Ras-specific guanine nucleotide exchange factor RasGRP1.", "journal": "eLife", "date": "2017", "authors": "Vercoulen Y, Kondo Y, Iwig JS, Janssen AB, White KA, Amini M, Barber DL, Kuriyan J, Roose JP", "evidence": [ { "database": "iPTMnet", "id": "O95267", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95267" } ], "reference": [ { "type": "PubMed", "id": "28952923", "url": "https://glygen.org/publication/PubMed/28952923" } ] }, { "title": "RASGRP1 mutation in autoimmune lymphoproliferative syndrome-like disease.", "journal": "The Journal of allergy and clinical immunology", "date": "2018", "authors": "Mao H, Yang W, Latour S, Yang J, Winter S, Zheng J, Ni K, Lv M, Liu C, Huang H, Chan KW, Pui-Wah Lee P, Tu W, Fischer A, Lau YL", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "reference": [ { "type": "PubMed", "id": "29155103", "url": "https://glygen.org/publication/PubMed/29155103" } ] }, { "title": "The structural basis for Ras activation of PI3Kalpha lipid kinase.", "journal": "Physical chemistry chemical physics : PCCP", "date": "2019", "authors": "Zhang M, Jang H, Nussinov R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "31135801", "url": "https://glygen.org/publication/PubMed/31135801" } ] }, { "title": "Nurr1 performs its anti-inflammatory function by regulating RasGRP1 expression in neuro-inflammation.", "journal": "Scientific reports", "date": "2020", "authors": "Oh M, Kim SY, Gil JE, Byun JS, Cha DW, Ku B, Lee W, Kim WK, Oh KJ, Lee EW, Bae KH, Lee SC, Han BS", "evidence": [ { "database": "RefSeq", "id": "NP_001122074", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122074" } ], "reference": [ { "type": "PubMed", "id": "32612143", "url": "https://glygen.org/publication/PubMed/32612143" } ] }, { "title": "Novel tumour suppressor roles for GZMA and RASGRP1 in Theileria annulata-transformed macrophages and human B lymphoma cells.", "journal": "Cellular microbiology", "date": "2020", "authors": "Rchiad Z, Haidar M, Ansari HR, Tajeri S, Mfarrej S, Ben Rached F, Kaushik A, Langsley G, Pain A", "evidence": [ { "database": "RefSeq", "id": "NP_001122074", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122074" } ], "reference": [ { "type": "PubMed", "id": "32830401", "url": "https://glygen.org/publication/PubMed/32830401" } ] }, { "title": "Dysregulated RASGRP1 expression through RUNX1 mediated transcription promotes autoimmunity.", "journal": "European journal of immunology", "date": "2021", "authors": "Baars MJD, Douma T, Simeonov DR, Myers DR, Kulhanek K, Banerjee S, Zwakenberg S, Baltissen MP, Amini M, de Roock S, van Wijk F, Vermeulen M, Marson A, Roose JP, Vercoulen Y", "evidence": [ { "database": "RefSeq", "id": "NP_001122074", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122074" } ], "reference": [ { "type": "PubMed", "id": "33065764", "url": "https://glygen.org/publication/PubMed/33065764" } ] }, { "title": "Abnormal RasGRP1 Expression in the Post-Mortem Brain and Blood Serum of Schizophrenia Patients.", "journal": "Biomolecules", "date": "2022", "authors": "De Rosa A, Di Maio A, Torretta S, Garofalo M, Giorgelli V, Masellis R, Nuzzo T, Errico F, Bertolino A, Subramaniam S, Rampino A, Usiello A", "evidence": [ { "database": "RefSeq", "id": "NP_001122074", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122074" } ], "reference": [ { "type": "PubMed", "id": "35204828", "url": "https://glygen.org/publication/PubMed/35204828" } ] }, { "title": "A Focused Review of Ras Guanine Nucleotide-Releasing Protein 1 in Immune Cells and Cancer.", "journal": "International journal of molecular sciences", "date": "2023", "authors": "Hsu TC, Rodrigues GOL, Winer H, Hixon JA, Li W, Tarasova NI, Durum SK", "evidence": [ { "database": "RefSeq", "id": "NP_001122074", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122074" } ], "reference": [ { "type": "PubMed", "id": "36675167", "url": "https://glygen.org/publication/PubMed/36675167" } ] }, { "title": "Intrinsic GTPase activity distinguishes normal and oncogenic ras p21 molecules.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1984", "authors": "Gibbs JB, Sigal IS, Poe M, Scolnick EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "6148751", "url": "https://glygen.org/publication/PubMed/6148751" } ] }, { "title": "Syk activation by the Src-family tyrosine kinase in the B cell receptor signaling.", "journal": "The Journal of experimental medicine", "date": "1994", "authors": "Kurosaki T, Takata M, Yamanashi Y, Inazu T, Taniguchi T, Yamamoto T, Yamamura H", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "7513017", "url": "https://glygen.org/publication/PubMed/7513017" } ] }, { "title": "Identification of the guanine nucleotide dissociation stimulator for Ral as a putative effector molecule of R-ras, H-ras, K-ras, and Rap.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Spaargaren M, Bischoff JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "7809086", "url": "https://glygen.org/publication/PubMed/7809086" } ] }, { "title": "ralGDS family members interact with the effector loop of ras p21.", "journal": "Molecular and cellular biology", "date": "1994", "authors": "Kikuchi A, Demo SD, Ye ZH, Chen YW, Williams LT", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "7935463", "url": "https://glygen.org/publication/PubMed/7935463" } ] }, { "title": "Activated Ras interacts with the Ral guanine nucleotide dissociation stimulator.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Hofer F, Fields S, Schneider C, Martin GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "7972015", "url": "https://glygen.org/publication/PubMed/7972015" } ] }, { "title": "Phosphatidylinositol-3-OH kinase as a direct target of Ras.", "journal": "Nature", "date": "1994", "authors": "Rodriguez-Viciana P, Warne PH, Dhand R, Vanhaesebroeck B, Gout I, Fry MJ, Waterfield MD, Downward J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "8052307", "url": "https://glygen.org/publication/PubMed/8052307" } ] }, { "title": "RapV12 antagonizes Ras-dependent activation of ERK1 and ERK2 by LPA and EGF in Rat-1 fibroblasts.", "journal": "The EMBO journal", "date": "1993", "authors": "Cook SJ, Rubinfeld B, Albert I, McCormick F", "evidence": [ { "database": "Reactome", "id": "R-HSA-392517", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-392517" } ], "reference": [ { "type": "PubMed", "id": "8253074", "url": "https://glygen.org/publication/PubMed/8253074" } ] }, { "title": "Growth factors induce nuclear translocation of MAP kinases (p42mapk and p44mapk) but not of their activator MAP kinase kinase (p45mapkk) in fibroblasts.", "journal": "The Journal of cell biology", "date": "1993", "authors": "Lenormand P, Sardet C, Pages G, L'Allemain G, Brunet A, Pouyssegur J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "8394845", "url": "https://glygen.org/publication/PubMed/8394845" } ] }, { "title": "Human Sos1: a guanine nucleotide exchange factor for Ras that binds to GRB2.", "journal": "Science (New York, N.Y.)", "date": "1993", "authors": "Chardin P, Camonis JH, Gale NW, van Aelst L, Schlessinger J, Wigler MH, Bar-Sagi D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "8493579", "url": "https://glygen.org/publication/PubMed/8493579" } ] }, { "title": "Outside-in integrin signal transduction. Alpha IIb beta 3-(GP IIb IIIa) tyrosine phosphorylation induced by platelet aggregation.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Law DA, Nannizzi-Alaimo L, Phillips DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "8631894", "url": "https://glygen.org/publication/PubMed/8631894" } ] }, { "title": "Activation of phosphoinositide 3-kinase by interaction with Ras and by point mutation.", "journal": "The EMBO journal", "date": "1996", "authors": "Rodriguez-Viciana P, Warne PH, Vanhaesebroeck B, Waterfield MD, Downward J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "8665852", "url": "https://glygen.org/publication/PubMed/8665852" } ] }, { "title": "RalGDS-like factor (Rlf) is a novel Ras and Rap 1A-associating protein.", "journal": "Oncogene", "date": "1996", "authors": "Wolthuis RM, Bauer B, van 't Veer LJ, de Vries-Smits AM, Cool RH, Spaargaren M, Wittinghofer A, Burgering BM, Bos JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "8710374", "url": "https://glygen.org/publication/PubMed/8710374" } ] }, { "title": "Not all Shc's roads lead to Ras.", "journal": "Trends in biochemical sciences", "date": "1996", "authors": "Bonfini L, Migliaccio E, Pelicci G, Lanfrancone L, Pelicci PG", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "8755247", "url": "https://glygen.org/publication/PubMed/8755247" } ] }, { "title": "Identification of a novel RalGDS-related protein as a candidate effector for Ras and Rap1.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Peterson SN, Trabalzini L, Brtva TR, Fischer T, Altschuler DL, Martelli P, Lapetina EG, Der CJ, White GC 2nd", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "8939933", "url": "https://glygen.org/publication/PubMed/8939933" } ] }, { "title": "Coassociation of Rap1A and Ha-Ras with Raf-1 N-terminal region interferes with ras-dependent activation of Raf-1.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Hu CD, Kariya Ki, Kotani G, Shirouzu M, Yokoyama S, Kataoka T", "evidence": [ { "database": "Reactome", "id": "R-HSA-392517", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-392517" } ], "reference": [ { "type": "PubMed", "id": "9115221", "url": "https://glygen.org/publication/PubMed/9115221" } ] }, { "title": "Human SPA-1 gene product selectively expressed in lymphoid tissues is a specific GTPase-activating protein for Rap1 and Rap2. Segregate expression profiles from a rap1GAP gene product.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Kurachi H, Wada Y, Tsukamoto N, Maeda M, Kubota H, Hattori M, Iwai K, Minato N", "evidence": [ { "database": "Reactome", "id": "R-HSA-392517", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-392517" } ], "reference": [ { "type": "PubMed", "id": "9346962", "url": "https://glygen.org/publication/PubMed/9346962" } ] }, { "title": "Regulation of the pp72syk protein tyrosine kinase by platelet integrin alpha IIb beta 3.", "journal": "The EMBO journal", "date": "1997", "authors": "Gao J, Zoller KE, Ginsberg MH, Brugge JS, Shattil SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "9351824", "url": "https://glygen.org/publication/PubMed/9351824" } ] }, { "title": "The extended protein kinase C superfamily.", "journal": "The Biochemical journal", "date": "1998", "authors": "Mellor H, Parker PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-114508", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114508" } ], "reference": [ { "type": "PubMed", "id": "9601053", "url": "https://glygen.org/publication/PubMed/9601053" } ] }, { "title": "Phosphorylation of the MAP kinase ERK2 promotes its homodimerization and nuclear translocation.", "journal": "Cell", "date": "1998", "authors": "Khokhlatchev AV, Canagarajah B, Wilsbacher J, Robinson M, Atkinson M, Goldsmith E, Cobb MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "9604935", "url": "https://glygen.org/publication/PubMed/9604935" } ] }, { "title": "A Rap guanine nucleotide exchange factor enriched highly in the basal ganglia.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1998", "authors": "Kawasaki H, Springett GM, Toki S, Canales JJ, Harlan P, Blumenstiel JP, Chen EJ, Bany IA, Mochizuki N, Ashbacher A, Matsuda M, Housman DE, Graybiel AM", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" }, { "database": "Reactome", "id": "R-HSA-392517", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-392517" } ], "reference": [ { "type": "PubMed", "id": "9789079", "url": "https://glygen.org/publication/PubMed/9789079" } ] }, { "title": "Nuclear translocation of p42/p44 mitogen-activated protein kinase is required for growth factor-induced gene expression and cell cycle entry.", "journal": "The EMBO journal", "date": "1999", "authors": "Brunet A, Roux D, Lenormand P, Dowd S, Keyse S, Pouyssegur J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "9927426", "url": "https://glygen.org/publication/PubMed/9927426" } ] }, { "title": "Direct activation of human TRPC6 and TRPC3 channels by diacylglycerol.", "journal": "Nature", "date": "1999", "authors": "Hofmann T, Obukhov AG, Schaefer M, Harteneck C, Gudermann T, Schultz G", "evidence": [ { "database": "Reactome", "id": "R-HSA-114508", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114508" } ], "reference": [ { "type": "PubMed", "id": "9930701", "url": "https://glygen.org/publication/PubMed/9930701" } ] } ], "pathway": [ { "id": "hsa:10125", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10125", "resource": "KEGG Pathway" }, { "id": "R-HSA-114508", "name": "Effects of PIP2 hydrolysis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114508", "resource": "Reactome", "description": "Effects of PIP2 hydrolysis" }, { "id": "R-HSA-1169092", "name": "Activation of RAS in B cells", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169092", "resource": "Reactome", "description": "Activation of RAS in B cells" }, { "id": "R-HSA-2871837", "name": "FCERI mediated NF-kB activation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837", "resource": "Reactome", "description": "FCERI mediated NF-kB activation" }, { "id": "R-HSA-354192", "name": "Integrin signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192", "resource": "Reactome", "description": "Integrin signaling" }, { "id": "R-HSA-392517", "name": "Rap1 signalling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-392517", "resource": "Reactome", "description": "Rap1 signalling" }, { "id": "R-HSA-5673001", "name": "RAF/MAP kinase cascade", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001", "resource": "Reactome", "description": "RAF/MAP kinase cascade" } ], "orthologs": [ { "uniprot_canonical_ac": "Q9R1K8-1", "protein_name": "RAS guanyl-releasing protein 1", "gene_name": "Rasgrp1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGTLGKAREAPRKPCHGSRAGPKGRLEAKSTNSPLPAQPSLAQITQFRMMVSLGHLAKGASLDDLIDSCIQSFDADGNLCRSNQLLQVMLTMHRIIISSAELLQKLMNLYKDALEKNSPGICLKICYFVRYWITEFWIMFKMDASLTSTMEEFQDLVKANGEESHCHLIDTTQINSRDWSRKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKENPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIHVAQKLHQLQNFNTLMAVIGGLCHSSISRLKETSSHVPHEINKVLGEMTELLSSCRNYDNYRRAYGECTHFKIPILGVHLKDLISLYEAMPDYLEDGKVNVQKLLALYNHINELVQLQDVAPPLDANKDLVHLLTLSLDLYYTEDEIYELSYAREPRNHRAPPLTPSKPPVVVDWASGVSPKPDPKTISKHVQRMVDSVFKNYDLDQDGYISQEEFEKIAASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGFPHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRSKSPAVSTENISSVVPMSTLCPLGTKDLLHAPEEGSFIFQNGEVVDHSEESKDRTIMLLGVSSQKISVRLKRTVAHKTTQTESFPWVGGEMPPGHFVLTSPRKSAQGALYVHSPASPCPSPALVRKRAFVKWENKESLIKPKPELHLRLRTYQELEQEVNTLRADNDALKIQLKYAQKQIESLQLGKSNHVLAQMDHGDGT", "length": 795 }, "evidence": [ { "id": "45935963", "url": "http://www.informatics.jax.org/homology/45935963", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9Z1S3-1", "protein_name": "RAS guanyl-releasing protein 1", "gene_name": "Rasgrp1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGTLGKAREAPRKPCHGSRAGPKARLEAKSTNSPLPAQPSLAQITQFRMMVSLGHLAKGASLDDLIDSCIQSFDADGNLCRNNQLLQVMLTMHRIIISSAELLQKVMNLYKDALEKNSPGVCLKICYFVRYWITEFWIMFKMDASLTSTMEEFQDLVKANGEETHCHLIDTTQINSRDWSRKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKENPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIHVAQKLHQLQNFNTLMAVIGGLCHSSISRLKETSSHVPHEINKVLGEMTELLSSCRNYDNYRRAYGECTHFKIPILGVHLKDLISLYEAMPDYLEDGKVNVQKLLALYNHINELVQLQEMAPPLDANKDLVHLLTLSLDLYYTEDEIYELSYAREPRNHRAPPLTPSKPPVVVDWASGVSPKPDPKTISKHVQRMVDSVFKNYDLDQDGYISQEEFEKIAASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGFPHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRIKSPAISTENISSVVPMSTLCPLGTKDLLHAPEEGSFIFQNGEIVDHSEESKDRTIMLLGVSSQKISVRLKRTVAHKSTQTESFPWVGGETTPGHFVLSSPRKSAQGALYVHSPASPCPSPALVRKRAFVKWENKESLIKPKPELHLRLRTYQELEQEINTLKADNDALKIQLKYAQKKIESLQLGKSNHVLAQMDHGDSA", "length": 795 }, "evidence": [ { "id": "45935963", "url": "http://www.informatics.jax.org/homology/45935963", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "Golgi membrane", "id": "GO:0000139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000139", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 7, "go_terms": [ { "name": "calcium ion binding", "id": "GO:0005509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "guanyl-nucleotide exchange factor activity", "id": "GO:0005085", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005085", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "lipid binding", "id": "GO:0008289", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008289", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "phosphatidylcholine binding", "id": "GO:0031210", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031210", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "diacylglycerol binding", "id": "GO:0019992", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019992", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 28, "go_terms": [ { "name": "small GTPase mediated signal transduction", "id": "GO:0007264", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007264", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction", "id": "GO:0051896", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051896", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "positive regulation of Ras protein signal transduction", "id": "GO:0046579", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046579", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "positive regulation of protein phosphorylation", "id": "GO:0001934", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001934", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "cell differentiation", "id": "GO:0030154", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030154", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "positive regulation of GTPase activity", "id": "GO:0043547", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043547", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "positive regulation of JNK cascade", "id": "GO:0046330", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046330", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "positive regulation of ERK1 and ERK2 cascade", "id": "GO:0070374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070374", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "inflammatory response to antigenic stimulus", "id": "GO:0002437", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002437", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "T cell activation", "id": "GO:0042110", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042110", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "B cell activation", "id": "GO:0042113", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042113", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "positive regulation of T cell differentiation in thymus", "id": "GO:0033089", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033089", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "Ras protein signal transduction", "id": "GO:0007265", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007265", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "positive regulation of MAP kinase activity", "id": "GO:0043406", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043406", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "positive regulation of tumor necrosis factor production", "id": "GO:0032760", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032760", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "positive regulation of type II interferon production", "id": "GO:0032729", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032729", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "activation of GTPase activity", "id": "GO:0090630", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090630", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "regulation of ERK1 and ERK2 cascade", "id": "GO:0070372", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070372", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "positive regulation of natural killer cell mediated cytotoxicity", "id": "GO:0045954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045954", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "natural killer cell activation", "id": "GO:0030101", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030101", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "vesicle transport along microtubule", "id": "GO:0047496", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0047496", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "positive regulation of granulocyte macrophage colony-stimulating factor production", "id": "GO:0032725", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032725", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "B cell proliferation", "id": "GO:0042100", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042100", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "mast cell degranulation", "id": "GO:0043303", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043303", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "T cell proliferation", "id": "GO:0042098", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042098", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "positive regulation of natural killer cell differentiation", "id": "GO:0032825", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032825", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" }, { "name": "secretory granule localization", "id": "GO:0032252", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032252", "evidence": [ { "database": "UniProtKB", "id": "O95267", "url": "https://www.uniprot.org/uniprot/O95267" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 190, "end_pos": 192, "annotation": "n_glycosylation_sequon" }, { "start_pos": 604, "end_pos": 606, "annotation": "n_glycosylation_sequon" }, { "start_pos": 605, "end_pos": 607, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 91, 184 ], "sequon_annotation_sites": [ { "start_pos": 190, "end_pos": 192 }, { "start_pos": 604, "end_pos": 606 }, { "start_pos": 605, "end_pos": 607 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 153 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }