{ "uniprot_canonical_ac": "O95235-1", "uniprot_ac": "O95235", "uniprot_id": "KI20A_HUMAN", "mass": { "chemical_mass": 100278.0, "monoisotopic_mass": 100278.0 }, "refseq": { "ac": "NP_005724", "name": "kinesin-like protein KIF20A", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005724" }, "gene_names": [ { "name": "KIF20A", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O95235", "id": "O95235" }, { "name": "KIF20A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005724", "id": "NP_005724" }, { "name": "MKLP2; RAB6KIFL; RCM6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005724", "id": "NP_005724" }, { "name": "MKLP2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O95235", "id": "O95235" }, { "name": "RAB6KIFL", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O95235", "id": "O95235" } ], "protein_names": [ { "name": "Kinesin-like protein KIF20A", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O95235" }, { "name": "GG10_2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95235" }, { "name": "MKlp2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95235" }, { "name": "Mitotic kinesin-like protein 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95235" }, { "name": "RAB6 interacting, kinesin-like (rabkinesin6); mitotic kinesin-like protein 2; GG10_2; rabkinesin-6; rab6-interacting kinesin-like protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005724", "id": "NP_005724" }, { "name": "Rab6-interacting kinesin-like protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95235" }, { "name": "Rabkinesin-6", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95235" }, { "name": "kinesin-like protein KIF20A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005724", "id": "NP_005724" } ], "function": [ { "annotation": "Circ_0084188 Regulates the progression of colorectal cancer through the miR-769-5p/KIF20A axis.", "evidence": [ { "database": "RefSeq", "id": "NP_005724", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005724" }, { "database": "PubMed", "id": "36763221", "url": "https://glygen.org/publication/PubMed/36763221" } ] }, { "annotation": "Grade scoring system reveals distinct molecular subtypes and identifies KIF20A as a novel biomarker for predicting temozolomide treatment efficiency in gliomas.", "evidence": [ { "database": "RefSeq", "id": "NP_005724", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005724" }, { "database": "PubMed", "id": "37248320", "url": "https://glygen.org/publication/PubMed/37248320" } ] }, { "annotation": "High expression of KIF20A in bladder cancer as a potential prognostic target for poor survival of renal cell carcinoma.", "evidence": [ { "database": "RefSeq", "id": "NP_005724", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005724" }, { "database": "PubMed", "id": "36637953", "url": "https://glygen.org/publication/PubMed/36637953" } ] }, { "annotation": "KIF20A (Rab6KIFL/MKlp2) is required for cytokinesis", "evidence": [ { "database": "RefSeq", "id": "NP_005724", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005724" }, { "database": "PubMed", "id": "11060022", "url": "https://glygen.org/publication/PubMed/11060022" } ] }, { "annotation": "KIF20A promotes the development of fibrosarcoma via PI3K-Akt signaling pathway.", "evidence": [ { "database": "RefSeq", "id": "NP_005724", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005724" }, { "database": "PubMed", "id": "36037925", "url": "https://glygen.org/publication/PubMed/36037925" } ] }, { "annotation": "MKLP2 functions in early mitosis to ensure proper chromosome congression.", "evidence": [ { "database": "RefSeq", "id": "NP_005724", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005724" }, { "database": "PubMed", "id": "35638575", "url": "https://glygen.org/publication/PubMed/35638575" } ] }, { "annotation": "Mitotic kinesin required for chromosome passenger complex (CPC)-mediated cytokinesis. Following phosphorylation by PLK1, involved in recruitment of PLK1 to the central spindle. Interacts with guanosine triphosphate (GTP)-bound forms of RAB6A and RAB6B. May act as a motor required for the retrograde RAB6 regulated transport of Golgi membranes and associated vesicles along microtubules. Has a microtubule plus end-directed motility.", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235#function" }, { "database": "PubMed", "id": "12939256", "url": "https://glygen.org/publication/PubMed/12939256" } ] } ], "disease": [ { "disease_id": "MONDO:0030330", "recommended_name": { "id": "MONDO:0030330", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0030330", "name": "cardiomyopathy, familial restrictive, 6", "description": "" }, "synonyms": [ { "id": "MONDO:0030330", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0030330", "name": "RCM6", "description": "" }, { "id": "MONDO:0030330", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0030330", "name": "cardiomyopathy, familial restrictive, 6", "description": "" }, { "id": "MIM:619433", "resource": "MIM", "url": "https://www.omim.org/entry/619433", "name": "Cardiomyopathy, familial restrictive 6", "description": "Cardiomyopathy, familial restrictive 6" } ], "evidence": [ { "id": "619433", "database": "MIM", "url": "https://www.omim.org/entry/619433" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 528, "end_pos": 528, "sequence_org": "S", "sequence_mut": "A", "comment": "Impairs phosphorylation by PLK1 and recruitment of PLK1 to the spindle.", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" }, { "database": "PubMed", "id": "12939256", "url": "https://glygen.org/publication/PubMed/12939256" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "56.28", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000112984", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000112984" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "71.15", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000112984", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000112984" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "66.58", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000112984", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000112984" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000112984", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000112984" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "59.3", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000112984", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000112984" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "79.42", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000112984", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000112984" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "64.45", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000112984", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000112984" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "52.71", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000112984", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000112984" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "53.74", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000112984", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000112984" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000112984", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000112984" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "49", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000112984", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000112984" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "59.88", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000112984", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000112984" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "61.83", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000112984", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000112984" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O95235", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95235" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O95235", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95235" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O95235", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95235" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O95235", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95235" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O95235", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95235" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O95235", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95235" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O95235", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95235" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O95235", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95235" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O95235", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95235" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O95235", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95235" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O95235", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95235" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O95235", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95235" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" } ], "common_name": "Human" } ], "gene": [ { "name": "KIF20A", "url": "https://www.uniprot.org/uniprot/O95235", "locus": { "chromosome": "5", "start_pos": 138187723, "end_pos": 138178719, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000112984", "url": "https://www.ensembl.org/id/ENSG00000112984" } ] } } ], "crossref": [ { "id": "ENSG00000112984", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000112984", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "5.6.1.3", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=5.6.1.3&UniProtAcc=O95235", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd01368", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01368", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd21787", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd21787", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL2021753", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2021753", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "KIF20A", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=KIF20A", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "10112", "url": "https://www.ncbi.nlm.nih.gov/gene/10112", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "9787", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=9787", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O95235", "url": "https://www.ebi.ac.uk/intact/interactors/id:O95235*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001752", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001752", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019821", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019821", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027640", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027640", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036961", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036961", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047149", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047149", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:10112", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10112", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "605664", "url": "http://www.omim.org/entry/605664", "database": "MIM", "categories": [ "Other" ] }, { "id": "619433", "url": "http://www.omim.org/entry/619433", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O95235", "url": "https://www.nextprot.org/entry/NX_O95235", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "NRHPQKA", "url": "https://omabrowser.org/oma/group/NRHPQKA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5403873at2759", "url": "http://www.orthodb.org/?query=5403873at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24115", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24115", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24115:SF352", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24115:SF352", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR47970", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47970", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR47970:SF20", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47970:SF20", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "6YIP", "url": "https://www.rcsb.org/structure/6YIP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00225", "url": "http://pfam.xfam.org/family/PF00225", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O95235", "url": "https://pharos.nih.gov/targets/O95235", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O95235", "url": "http://purl.obolibrary.org/obo/PR_O95235", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-68884", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68884", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-983189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983189", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_005724", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005724", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "D6R9E4", "url": "https://www.uniprot.org/uniprot/D6R9E4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6R9E4-1", "url": "https://www.uniprot.org/uniprot/D6R9E4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RBN1", "url": "https://www.uniprot.org/uniprot/D6RBN1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RBN1-1", "url": "https://www.uniprot.org/uniprot/D6RBN1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YAC9", "url": "https://www.uniprot.org/uniprot/H0YAC9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YAC9-1", "url": "https://www.uniprot.org/uniprot/H0YAC9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95235-1", "url": "https://www.uniprot.org/uniprot/O95235-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95235-2", "url": "https://www.uniprot.org/uniprot/O95235-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSQGILSPPAGLLSDDDVVVSPMFESTAADLGSVVRKNLLSDCSVVSTSLEDKQQVPSEDSMEKVKVYLRVRPLLPSELERQEDQGCVRIENVETLVLQAPKDSFALKSNERGIGQATHRFTFSQIFGPEVGQASFFNLTVKEMVKDVLKGQNWLIYTYGVTNSGKTHTIQGTIKDGGILPRSLALIFNSLQGQLHPTPDLKPLLSNEVIWLDSKQIRQEEMKKLSLLNGGLQEEELSTSLKRSVYIESRIGTSTSFDSGIAGLSSISQCTSSSQLDETSHRWAQPDTAPLPVPANIRFSIWISFFEIYNELLYDLLEPPSQQRKRQTLRLCEDQNGNPYVKDLNWIHVQDAEEAWKLLKVGRKNQSFASTHLNQNSSRSHSIFSIRILHLQGEGDIVPKISELSLCDLAGSERCKDQKSGERLKEAGNINTSLHTLGRCIAALRQNQQNRSKQNLVPFRDSKLTRVFQGFFTGRGRSCMIVNVNPCASTYDETLHVAKFSAIASQLVHAPPMQLGFPSLHSFIKEHSLQVSPSLEKGAKADTGLDDDIENEADISMYGKEELLQVVEAMKTLLLKERQEKLQLEMHLRDEICNEMVEQMQQREQWCSEHLDTQKELLEEMYEEKLNILKESLTSFYQEEIQERDEKIEELEALLQEARQQSVAHQQSGSELALRRSQRLAASASTQQLQEVKAKLQQCKAELNSTTEELHKYQKMLEPPPSAKPFTIDVDKKLEEGQKNIRLLRTELQKLGESLQSAERACCHSTGAGKLRQALTTCDDILIKQDQTLAELQNNMVLVKLDLRKKAACIAEQYHTVLKLQGQVSAKKRLGTNQENQQPNQQPPGKKPFLRNLLPRTPTCQSSTDCSPYARILRSRRSPLLKSGPFGKKY", "length": 890, "header": "sp|O95235-1|KI20A_HUMAN Isoform 1 of Kinesin-like protein KIF20A OS=Homo sapiens OX=9606 GN=KIF20A PE=1 SV=1 CANONICAL=O95235-1" }, "isoforms": [ { "isoform_ac": "D6R9E4-1", "url": "", "sequence": { "sequence": "MSQGILSPPAGLLSDDDVVVSPMFESTAADLGSVVRKNLLSDCSVVSTSLEDKQQVPSEDSMEKVKVYLRVRPLLPSELERQEDQGCVRIENVETLVLQAPKDSFALKSNERGIGQATHRFTFSQIFGPEVGQASFFNLTVKEMVKDVLKGQNWLIYTY", "length": 159, "header": "tr|D6R9E4-1|D6R9E4_HUMAN Computationally mapped isoform of Kinesin family member 20A OS=Homo sapiens OX=9606 GN=KIF20A PE=1 SV=1 CANONICAL=O95235-1" }, "locus": { "chromosome": "5", "start_pos": 138182424, "end_pos": 138179681, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000513276.5", "url": "https://www.ensembl.org/id/ENST00000513276.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000422928.1", "url": "https://www.ensembl.org/id/ENSP00000422928.1" } ] } }, { "isoform_ac": "D6RBN1-1", "url": "", "sequence": { "sequence": "MSQGILSPPAGLLSDDDVVVSPMFESTAADLGSVVRKNLLSDCSVVSTSLEDKQQVPSEDSMEKVKVYLRVRPLLPSELERQEDQGCVRIENVETLVLQAPKDSFALKSNERGIGQATHRFTFSQIFGPEVGQASFFNLTVKEMVKDVLKGQNWLIYTYGVTNSGKTHTIQGTIKDGGILPRSLALIFNSLQGQLHPTPDLKPLLSNEVIWLDSKQIRQEEMKKL", "length": 225, "header": "tr|D6RBN1-1|KI20A_HUMAN Computationally mapped isoform of Kinesin-like protein KIF20A OS=Homo sapiens OX=9606 GN=KIF20A PE=1 SV=1 CANONICAL=O95235-1" }, "locus": { "chromosome": "5", "start_pos": 138182746, "end_pos": 138179681, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000504621.1", "url": "https://www.ensembl.org/id/ENST00000504621.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000424056.1", "url": "https://www.ensembl.org/id/ENSP00000424056.1" } ] } }, { "isoform_ac": "H0YAC9-1", "url": "", "sequence": { "sequence": "AMKTLLLKERQEKLQLEMHLRDEICNEMVEQMQQREQWCSEHLDTQKELLEEMYEEKLNILKESLTSFYQEEIQSCISIRKC", "length": 82, "header": "tr|H0YAC9-1|KI20A_HUMAN Computationally mapped isoform of Kinesin-like protein KIF20A OS=Homo sapiens OX=9606 GN=KIF20A PE=1 SV=1 CANONICAL=O95235-1" }, "locus": { "chromosome": "5", "start_pos": 138185984, "end_pos": 138184828, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000502338.1", "url": "https://www.ensembl.org/id/ENST00000502338.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000426704.1", "url": "https://www.ensembl.org/id/ENSP00000426704.1" } ] } }, { "isoform_ac": "O95235-1", "url": "", "sequence": { "sequence": "MSQGILSPPAGLLSDDDVVVSPMFESTAADLGSVVRKNLLSDCSVVSTSLEDKQQVPSEDSMEKVKVYLRVRPLLPSELERQEDQGCVRIENVETLVLQAPKDSFALKSNERGIGQATHRFTFSQIFGPEVGQASFFNLTVKEMVKDVLKGQNWLIYTYGVTNSGKTHTIQGTIKDGGILPRSLALIFNSLQGQLHPTPDLKPLLSNEVIWLDSKQIRQEEMKKLSLLNGGLQEEELSTSLKRSVYIESRIGTSTSFDSGIAGLSSISQCTSSSQLDETSHRWAQPDTAPLPVPANIRFSIWISFFEIYNELLYDLLEPPSQQRKRQTLRLCEDQNGNPYVKDLNWIHVQDAEEAWKLLKVGRKNQSFASTHLNQNSSRSHSIFSIRILHLQGEGDIVPKISELSLCDLAGSERCKDQKSGERLKEAGNINTSLHTLGRCIAALRQNQQNRSKQNLVPFRDSKLTRVFQGFFTGRGRSCMIVNVNPCASTYDETLHVAKFSAIASQLVHAPPMQLGFPSLHSFIKEHSLQVSPSLEKGAKADTGLDDDIENEADISMYGKEELLQVVEAMKTLLLKERQEKLQLEMHLRDEICNEMVEQMQQREQWCSEHLDTQKELLEEMYEEKLNILKESLTSFYQEEIQERDEKIEELEALLQEARQQSVAHQQSGSELALRRSQRLAASASTQQLQEVKAKLQQCKAELNSTTEELHKYQKMLEPPPSAKPFTIDVDKKLEEGQKNIRLLRTELQKLGESLQSAERACCHSTGAGKLRQALTTCDDILIKQDQTLAELQNNMVLVKLDLRKKAACIAEQYHTVLKLQGQVSAKKRLGTNQENQQPNQQPPGKKPFLRNLLPRTPTCQSSTDCSPYARILRSRRSPLLKSGPFGKKY", "length": 890, "header": "sp|O95235-1|KI20A_HUMAN Isoform 1 of Kinesin-like protein KIF20A OS=Homo sapiens OX=9606 GN=KIF20A PE=1 SV=1 CANONICAL=O95235-1" }, "locus": { "chromosome": "5", "start_pos": 138187410, "end_pos": 138179681, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000394894.8", "url": "https://www.ensembl.org/id/ENST00000394894.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000378356.3", "url": "https://www.ensembl.org/id/ENSP00000378356.3" } ] } }, { "isoform_ac": "O95235-2", "url": "", "sequence": { "sequence": "MSQGILSPPAGLLSDDDVVVSPMFESTAADLGSVVRKNLLSDCSVVSTSLEDKQQVPSEDSMEKEDQGCVRIENVETLVLQAPKDSFALKSNERGIGQATHRFTFSQIFGPEVGQASFFNLTVKEMVKDVLKGQNWLIYTYGVTNSGKTHTIQGTIKDGGILPRSLALIFNSLQGQLHPTPDLKPLLSNEVIWLDSKQIRQEEMKKLSLLNGGLQEEELSTSLKRSVYIESRIGTSTSFDSGIAGLSSISQCTSSSQLDETSHRWAQPDTAPLPVPANIRFSIWISFFEIYNELLYDLLEPPSQQRKRQTLRLCEDQNGNPYVKDLNWIHVQDAEEAWKLLKVGRKNQSFASTHLNQNSSRSHSIFSIRILHLQGEGDIVPKISELSLCDLAGSERCKDQKSGERLKEAGNINTSLHTLGRCIAALRQNQQNRSKQNLVPFRDSKLTRVFQGFFTGRGRSCMIVNVNPCASTYDETLHVAKFSAIASQLVHAPPMQLGFPSLHSFIKEHSLQVSPSLEKGAKADTGLDDDIENEADISMYGKEELLQVVEAMKTLLLKERQEKLQLEMHLRDEICNEMVEQMQQREQWCSEHLDTQKELLEEMYEEKLNILKESLTSFYQEEIQERDEKIEELEALLQEARQQSVAHQQSGSELALRRSQRLAASASTQQLQEVKAKLQQCKAELNSTTEELHKYQKMLEPPPSAKPFTIDVDKKLEEGQKNIRLLRTELQKLGESLQSAERACCHSTGAGKLRQALTTCDDILIKQDQTLAELQNNMVLVKLDLRKKAACIAEQYHTVLKLQGQVSAKKRLGTNQENQQPNQQPPGKKPFLRNLLPRTPTCQSSTDCSPYARILRSRRSPLLKSGPFGKKY", "length": 872, "header": "sp|O95235-2|KI20A_HUMAN Isoform 2 of Kinesin-like protein KIF20A OS=Homo sapiens OX=9606 GN=KIF20A PE=1 SV=1 CANONICAL=O95235-1" }, "locus": { "chromosome": "5", "start_pos": 138187410, "end_pos": 138179681, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000508792.5", "url": "https://www.ensembl.org/id/ENST00000508792.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000420880.1", "url": "https://www.ensembl.org/id/ENSP00000420880.1" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 14, "end_pos": 14, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" } ], "site_lbl": "Ser14" }, { "start_pos": 21, "end_pos": 21, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" } ], "site_lbl": "Ser21" }, { "start_pos": 238, "end_pos": 238, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" } ], "site_lbl": "Ser238" }, { "start_pos": 244, "end_pos": 244, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "phospho.ELM", "id": "O95235", "url": "http://phospho.elm.eu.org/byAccession/O95235.html" } ], "site_lbl": "Ser244" }, { "start_pos": 246, "end_pos": 246, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" } ], "site_lbl": "Tyr246" }, { "start_pos": 249, "end_pos": 249, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" } ], "site_lbl": "Ser249" }, { "start_pos": 256, "end_pos": 256, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "O95235", "url": "http://phospho.elm.eu.org/byAccession/O95235.html" } ], "site_lbl": "Ser256" }, { "start_pos": 26, "end_pos": 26, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser26" }, { "start_pos": 27, "end_pos": 27, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr27" }, { "start_pos": 33, "end_pos": 33, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser33" }, { "start_pos": 405, "end_pos": 405, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" }, { "database": "PubMed", "id": "20068230", "url": "https://glygen.org/publication/PubMed/20068230" } ], "site_lbl": "Ser405" }, { "start_pos": 491, "end_pos": 491, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Tyr491" }, { "start_pos": 49, "end_pos": 49, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "O95235", "url": "http://phospho.elm.eu.org/byAccession/O95235.html" } ], "site_lbl": "Ser49" }, { "start_pos": 528, "end_pos": 528, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PLK1", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" }, { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "27920218", "url": "" }, { "database": "phospho.ELM", "id": "O95235", "url": "http://phospho.elm.eu.org/byAccession/O95235.html" }, { "database": "PRO", "id": "O95235", "url": "http://purl.obolibrary.org/obo/O95235" }, { "database": "PubMed", "id": "12939256", "url": "https://glygen.org/publication/PubMed/12939256" } ], "site_lbl": "Ser528" }, { "start_pos": 532, "end_pos": 532, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "phospho.ELM", "id": "O95235", "url": "http://phospho.elm.eu.org/byAccession/O95235.html" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Ser532" }, { "start_pos": 534, "end_pos": 534, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser534" }, { "start_pos": 556, "end_pos": 556, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "phospho.ELM", "id": "O95235", "url": "http://phospho.elm.eu.org/byAccession/O95235.html" } ], "site_lbl": "Ser556" }, { "start_pos": 572, "end_pos": 572, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" }, { "database": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" } ], "site_lbl": "Thr572" }, { "start_pos": 58, "end_pos": 58, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" } ], "site_lbl": "Ser58" }, { "start_pos": 635, "end_pos": 635, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser635" }, { "start_pos": 662, "end_pos": 662, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" }, { "database": "PubMed", "id": "12939256", "url": "https://glygen.org/publication/PubMed/12939256" }, { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "O95235", "url": "http://phospho.elm.eu.org/byAccession/O95235.html" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" } ], "site_lbl": "Ser662" }, { "start_pos": 668, "end_pos": 668, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" }, { "database": "PubMed", "id": "12939256", "url": "https://glygen.org/publication/PubMed/12939256" }, { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" } ], "site_lbl": "Ser668" }, { "start_pos": 670, "end_pos": 670, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "O95235", "url": "http://phospho.elm.eu.org/byAccession/O95235.html" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" } ], "site_lbl": "Ser670" }, { "start_pos": 683, "end_pos": 683, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" } ], "site_lbl": "Ser683" }, { "start_pos": 685, "end_pos": 685, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" } ], "site_lbl": "Ser685" }, { "start_pos": 7, "end_pos": 7, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" } ], "site_lbl": "Ser7" }, { "start_pos": 825, "end_pos": 825, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" } ], "site_lbl": "Ser825" }, { "start_pos": 857, "end_pos": 857, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" }, { "database": "phospho.ELM", "id": "O95235", "url": "http://phospho.elm.eu.org/byAccession/O95235.html" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" } ], "site_lbl": "Thr857" }, { "start_pos": 859, "end_pos": 859, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "O95235", "url": "http://phospho.elm.eu.org/byAccession/O95235.html" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" } ], "site_lbl": "Thr859" }, { "start_pos": 864, "end_pos": 864, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "O95235", "url": "http://phospho.elm.eu.org/byAccession/O95235.html" } ], "site_lbl": "Thr864" }, { "start_pos": 867, "end_pos": 867, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "phospho.ELM", "id": "O95235", "url": "http://phospho.elm.eu.org/byAccession/O95235.html" } ], "site_lbl": "Ser867" }, { "start_pos": 869, "end_pos": 869, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" } ], "site_lbl": "Tyr869" }, { "start_pos": 878, "end_pos": 878, "kinase_uniprot_canonical_ac": "Q96GD4-1", "kinase_gene_name": "AURKB", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" }, { "database": "PubMed", "id": "27939310", "url": "https://glygen.org/publication/PubMed/27939310" } ], "site_lbl": "Ser878" }, { "start_pos": 878, "end_pos": 878, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" } ], "site_lbl": "Ser878" }, { "start_pos": 883, "end_pos": 883, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" } ], "site_lbl": "Ser883" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Opposing motor activities of dynein and kinesin determine retention and transport of MHC class II-containing compartments.", "journal": "Journal of cell science", "date": "1999", "authors": "Wubbolts R, Fernandez-Borja M, Jordens I, Reits E, Dusseljee S, Echeverri C, Vallee RB, Neefjes J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "10036229", "url": "https://glygen.org/publication/PubMed/10036229" } ] }, { "title": "Coupling of coat assembly and vesicle budding to packaging of putative cargo receptors.", "journal": "Cell", "date": "1999", "authors": "Bremser M, Nickel W, Schweikert M, Ravazzola M, Amherdt M, Hughes CA, Sollner TH, Rothman JE, Wieland FT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "10052452", "url": "https://glygen.org/publication/PubMed/10052452" } ] }, { "title": "Identification of destabilizing residues in HLA class II-selected bacteriophage display libraries edited by HLA-DM.", "journal": "European journal of immunology", "date": "1999", "authors": "Raddrizzani L, Bono E, Vogt AB, Kropshofer H, Gallazzi F, Sturniolo T, Hammerling GJ, Sinigaglia F, Hammer J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "10064083", "url": "https://glygen.org/publication/PubMed/10064083" } ] }, { "title": "Cathepsin S required for normal MHC class II peptide loading and germinal center development.", "journal": "Immunity", "date": "1999", "authors": "Shi GP, Villadangos JA, Dranoff G, Small C, Gu L, Haley KJ, Riese R, Ploegh HL, Chapman HA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "10072072", "url": "https://glygen.org/publication/PubMed/10072072" } ] }, { "title": "Vascular endothelial genes that are responsive to tumor necrosis factor-alpha in vitro are expressed in atherosclerotic lesions, including inhibitor of apoptosis protein-1, stannin, and two novel genes.", "journal": "Blood", "date": "1999", "authors": "Horrevoets A J, Fontijn R D, van Zonneveld A J, de Vries C J, ten Cate J W, Pannekoek H", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" } ], "reference": [ { "type": "PubMed", "id": "10233894", "url": "https://glygen.org/publication/PubMed/10233894" } ] }, { "title": "GTP-dependent binding of ADP-ribosylation factor to coatomer in close proximity to the binding site for dilysine retrieval motifs and p23.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Zhao L, Helms JB, Brunner J, Wieland FT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "10318838", "url": "https://glygen.org/publication/PubMed/10318838" } ] }, { "title": "NSF N-terminal domain crystal structure: models of NSF function.", "journal": "Molecular cell", "date": "1999", "authors": "Yu RC, Jahn R, Brunger AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "10445031", "url": "https://glygen.org/publication/PubMed/10445031" } ] }, { "title": "Direct transport of newly synthesized HLA-DR from the trans-Golgi network to major histocompatibility complex class II containing compartments (MIICS) demonstrated using a novel tyrosine-sulfated chimera.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Davidson HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "10480952", "url": "https://glygen.org/publication/PubMed/10480952" } ] }, { "title": "Cell surface expression and metabolism of major histocompatibility complex class II invariant chain (CD74) by diverse cell lines.", "journal": "Immunology", "date": "1999", "authors": "Ong GL, Goldenberg DM, Hansen HJ, Mattes MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "10540230", "url": "https://glygen.org/publication/PubMed/10540230" } ] }, { "title": "An NSF function distinct from ATPase-dependent SNARE disassembly is essential for Golgi membrane fusion.", "journal": "Nature cell biology", "date": "1999", "authors": "Muller JM, Rabouille C, Newman R, Shorter J, Freemont P, Schiavo G, Warren G, Shima DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "10559959", "url": "https://glygen.org/publication/PubMed/10559959" } ] }, { "title": "The leucine-based sorting motifs in the cytoplasmic domain of the invariant chain are recognized by the clathrin adaptors AP1 and AP2 and their medium chains.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Hofmann MW, Honing S, Rodionov D, Dobberstein B, von Figura K, Bakke O", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "10593899", "url": "https://glygen.org/publication/PubMed/10593899" } ] }, { "title": "Proteases involved in MHC class II antigen presentation.", "journal": "Immunological reviews", "date": "1999", "authors": "Villadangos JA, Bryant RA, Deussing J, Driessen C, Lennon-Dumenil AM, Riese RJ, Roth W, Saftig P, Shi GP, Chapman HA, Peters C, Ploegh HL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "10631941", "url": "https://glygen.org/publication/PubMed/10631941" } ] }, { "title": "The impact of the non-classical MHC proteins HLA-DM and HLA-DO on loading of MHC class II molecules.", "journal": "Immunological reviews", "date": "1999", "authors": "Kropshofer H, Hammerling GJ, Vogt AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "10631952", "url": "https://glygen.org/publication/PubMed/10631952" } ] }, { "title": "Enzymatic reduction of disulfide bonds in lysosomes: characterization of a gamma-interferon-inducible lysosomal thiol reductase (GILT).", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Arunachalam B, Phan UT, Geuze HJ, Cresswell P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "10639150", "url": "https://glygen.org/publication/PubMed/10639150" } ] }, { "title": "Role for cathepsin F in invariant chain processing and major histocompatibility complex class II peptide loading by macrophages.", "journal": "The Journal of experimental medicine", "date": "2000", "authors": "Shi GP, Bryant RA, Riese R, Verhelst S, Driessen C, Li Z, Bromme D, Ploegh HL, Chapman HA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "10748235", "url": "https://glygen.org/publication/PubMed/10748235" } ] }, { "title": "Decoding of sorting signals by coatomer through a GTPase switch in the COPI coat complex.", "journal": "Cell", "date": "2000", "authors": "Goldberg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "10761932", "url": "https://glygen.org/publication/PubMed/10761932" } ] }, { "title": "cDNA cloning, expression pattern, genomic structure and chromosomal location of RAB6KIFL, a human kinesin-like gene.", "journal": "Gene", "date": "2000", "authors": "Lai F, Fernald A A, Zhao N, Le Beau M M", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" } ], "reference": [ { "type": "PubMed", "id": "10806357", "url": "https://glygen.org/publication/PubMed/10806357" } ] }, { "title": "Lysosomal cathepsin B plays an important role in antigen processing, while cathepsin D is involved in degradation of the invariant chain inovalbumin-immunized mice.", "journal": "Immunology", "date": "2000", "authors": "Zhang T, Maekawa Y, Hanba J, Dainichi T, Nashed BF, Hisaeda H, Sakai T, Asao T, Himeno K, Good RA, Katunuma N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "10809954", "url": "https://glygen.org/publication/PubMed/10809954" } ] }, { "title": "COP I domains required for coatomer integrity, and novel interactions with ARF and ARF-GAP.", "journal": "The EMBO journal", "date": "2000", "authors": "Eugster A, Frigerio G, Dale M, Duden R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "10921873", "url": "https://glygen.org/publication/PubMed/10921873" } ] }, { "title": "The Rab6-binding kinesin, Rab6-KIFL, is required for cytokinesis.", "journal": "The EMBO journal", "date": "2000", "authors": "Hill E, Clarke M, Barr FA", "evidence": [ { "database": "RefSeq", "id": "NP_005724", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005724" } ], "reference": [ { "type": "PubMed", "id": "11060022", "url": "https://glygen.org/publication/PubMed/11060022" } ] }, { "title": "Functional characterization of novel human ARFGAP3.", "journal": "FEBS letters", "date": "2001", "authors": "Liu X, Zhang C, Xing G, Chen Q, He F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "11172815", "url": "https://glygen.org/publication/PubMed/11172815" } ] }, { "title": "The coatomer-interacting protein Dsl1p is required for Golgi-to-endoplasmic reticulum retrieval in yeast.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Andag U, Neumann T, Schmitt HD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "11493604", "url": "https://glygen.org/publication/PubMed/11493604" } ] }, { "title": "Trans-Golgi network sorting.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2001", "authors": "Gu F, Crump CM, Thomas G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "11529500", "url": "https://glygen.org/publication/PubMed/11529500" } ] }, { "title": "Presentation of antigens by MHC class II molecules: getting the most out of them.", "journal": "Molecular immunology", "date": "2001", "authors": "Villadangos JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "11684289", "url": "https://glygen.org/publication/PubMed/11684289" } ] }, { "title": "Chimaerins, novel non-protein kinase C phorbol ester receptors, associate with Tmp21-I (p23): evidence for a novel anchoring mechanism involving the chimaerin C1 domain.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Wang H, Kazanietz MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "11689559", "url": "https://glygen.org/publication/PubMed/11689559" } ] }, { "title": "KDEL-cargo regulates interactions between proteins involved in COPI vesicle traffic: measurements in living cells using FRET.", "journal": "Developmental cell", "date": "2001", "authors": "Majoul I, Straub M, Hell SW, Duden R, Soling HD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "11703931", "url": "https://glygen.org/publication/PubMed/11703931" } ] }, { "title": "Recruitment to Golgi membranes of ADP-ribosylation factor 1 is mediated by the cytoplasmic domain of p23.", "journal": "The EMBO journal", "date": "2001", "authors": "Gommel DU, Memon AR, Heiss A, Lottspeich F, Pfannstiel J, Lechner J, Reinhard C, Helms JB, Nickel W, Wieland FT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "11726511", "url": "https://glygen.org/publication/PubMed/11726511" } ] }, { "title": "Golgi-to-endoplasmic reticulum (ER) retrograde traffic in yeast requires Dsl1p, a component of the ER target site that interacts with a COPI coat subunit.", "journal": "Molecular biology of the cell", "date": "2001", "authors": "Reilly BA, Kraynack BA, VanRheenen SM, Waters MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "11739780", "url": "https://glygen.org/publication/PubMed/11739780" } ] }, { "title": "Sorting of Golgi resident proteins into different subpopulations of COPI vesicles: a role for ArfGAP1.", "journal": "The Journal of cell biology", "date": "2001", "authors": "Lanoix J, Ouwendijk J, Stark A, Szafer E, Cassel D, Dejgaard K, Weiss M, Nilsson T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "11748249", "url": "https://glygen.org/publication/PubMed/11748249" } ] }, { "title": "Central spindle assembly and cytokinesis require a kinesin-like protein/RhoGAP complex with microtubule bundling activity.", "journal": "Developmental cell", "date": "2002", "authors": "Mishima M, Kaitna S, Glotzer M", "evidence": [ { "database": "Reactome", "id": "R-HSA-983189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983189" } ], "reference": [ { "type": "PubMed", "id": "11782313", "url": "https://glygen.org/publication/PubMed/11782313" } ] }, { "title": "Trafficking of MHC class II molecules in the late secretory pathway.", "journal": "Current opinion in immunology", "date": "2002", "authors": "Hiltbold EM, Roche PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "11790530", "url": "https://glygen.org/publication/PubMed/11790530" } ] }, { "title": "Specific role for cathepsin S in the generation of antigenic peptides in vivo.", "journal": "European journal of immunology", "date": "2002", "authors": "Pluger EB, Boes M, Alfonso C, Schroter CJ, Kalbacher H, Ploegh HL, Driessen C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "11813165", "url": "https://glygen.org/publication/PubMed/11813165" } ] }, { "title": "Multiple roles of the invariant chain in MHC class II function.", "journal": "Biochimica et biophysica acta", "date": "2002", "authors": "Stumptner-Cuvelette P, Benaroch P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "11853874", "url": "https://glygen.org/publication/PubMed/11853874" } ] }, { "title": "GBF1, a guanine nucleotide exchange factor for ADP-ribosylation factors, is localized to the cis-Golgi and involved in membrane association of the COPI coat.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2002", "authors": "Kawamoto K, Yoshida Y, Tamaki H, Torii S, Shinotsuka C, Yamashina S, Nakayama K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "12047556", "url": "https://glygen.org/publication/PubMed/12047556" } ] }, { "title": "Sequential SNARE disassembly and GATE-16-GOS-28 complex assembly mediated by distinct NSF activities drives Golgi membrane fusion.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Muller JM, Shorter J, Newman R, Deinhardt K, Sagiv Y, Elazar Z, Warren G, Shima DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "12070132", "url": "https://glygen.org/publication/PubMed/12070132" } ] }, { "title": "Proteolysis and antigen presentation by MHC class II molecules.", "journal": "Advances in immunology", "date": "2002", "authors": "Bryant PW, Lennon-Dumenil AM, Fiebiger E, Lagaudriere-Gesbert C, Ploegh HL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "12078484", "url": "https://glygen.org/publication/PubMed/12078484" } ] }, { "title": "Dendritic cell maturation triggers retrograde MHC class II transport from lysosomes to the plasma membrane.", "journal": "Nature", "date": "2002", "authors": "Chow A, Toomre D, Garrett W, Mellman I", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "12198549", "url": "https://glygen.org/publication/PubMed/12198549" } ] }, { "title": "Two conformations in the human kinesin power stroke defined by X-ray crystallography and EPR spectroscopy.", "journal": "Nature structural biology", "date": "2002", "authors": "Sindelar CV, Budny MJ, Rice S, Naber N, Fletterick R, Cooke R", "evidence": [ { "database": "Reactome", "id": "R-HSA-983189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983189" } ], "reference": [ { "type": "PubMed", "id": "12368902", "url": "https://glygen.org/publication/PubMed/12368902" } ] }, { "title": "Antigen processing and presentation in human muscle: cathepsin S is critical for MHC class II expression and upregulated in inflammatory myopathies.", "journal": "Journal of neuroimmunology", "date": "2003", "authors": "Wiendl H, Lautwein A, Mitsdorffer M, Krause S, Erfurth S, Wienhold W, Morgalla M, Weber E, Overkleeft HS, Lochmuller H, Melms A, Tolosa E, Driessen C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "12742663", "url": "https://glygen.org/publication/PubMed/12742663" } ] }, { "title": "Human cathepsin S, but not cathepsin L, degrades efficiently MHC class II-associated invariant chain in nonprofessional APCs.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Bania J, Gatti E, Lelouard H, David A, Cappello F, Weber E, Camosseto V, Pierre P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "12748383", "url": "https://glygen.org/publication/PubMed/12748383" } ] }, { "title": "Phosphorylation of mitotic kinesin-like protein 2 by polo-like kinase 1 is required for cytokinesis.", "journal": "The Journal of cell biology", "date": "2003", "authors": "Neef R, Preisinger C, Sutcliffe J, Kopajtich R, Nigg EA, Mayer TU, Barr FA", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" }, { "database": "Reactome", "id": "R-HSA-68884", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68884" }, { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" } ], "reference": [ { "type": "PubMed", "id": "12939256", "url": "https://glygen.org/publication/PubMed/12939256" } ] }, { "title": "A plus-end-directed motor enzyme that moves antiparallel microtubules in vitro localizes to the interzone of mitotic spindles.", "journal": "Nature", "date": "1992", "authors": "Nislow C, Lombillo VA, Kuriyama R, McIntosh JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-983189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983189" } ], "reference": [ { "type": "PubMed", "id": "1406973", "url": "https://glygen.org/publication/PubMed/1406973" } ] }, { "title": "Dsl1p, an essential component of the Golgi-endoplasmic reticulum retrieval system in yeast, uses the same sequence motif to interact with different subunits of the COPI vesicle coat.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Andag U, Schmitt HD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "14504276", "url": "https://glygen.org/publication/PubMed/14504276" } ] }, { "title": "Lipid packing sensed by ArfGAP1 couples COPI coat disassembly to membrane bilayer curvature.", "journal": "Nature", "date": "2003", "authors": "Bigay J, Gounon P, Robineau S, Antonny B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "14654841", "url": "https://glygen.org/publication/PubMed/14654841" } ] }, { "title": "Targeting of membrane proteins to endosomes and lysosomes.", "journal": "Trends in cell biology", "date": "1994", "authors": "Sandoval IV, Bakke O", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "14731593", "url": "https://glygen.org/publication/PubMed/14731593" } ] }, { "title": "Implication of ZW10 in membrane trafficking between the endoplasmic reticulum and Golgi.", "journal": "The EMBO journal", "date": "2004", "authors": "Hirose H, Arasaki K, Dohmae N, Takio K, Hatsuzawa K, Nagahama M, Tani K, Yamamoto A, Tohyama M, Tagaya M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "15029241", "url": "https://glygen.org/publication/PubMed/15029241" } ] }, { "title": "Multiple binding proteins suggest diverse functions for the N-ethylmaleimide sensitive factor.", "journal": "Journal of structural biology", "date": "2004", "authors": "Whiteheart SW, Matveeva EA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "15037235", "url": "https://glygen.org/publication/PubMed/15037235" } ] }, { "title": "Molecular interactions of Polo-like-kinase 1 with the mitotic kinesin-like protein CHO1/MKLP-1.", "journal": "Journal of cell science", "date": "2004", "authors": "Liu X, Zhou T, Kuriyama R, Erikson RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-68884", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68884" } ], "reference": [ { "type": "PubMed", "id": "15199097", "url": "https://glygen.org/publication/PubMed/15199097" } ] }, { "title": "Involvement of BNIP1 in apoptosis and endoplasmic reticulum membrane fusion.", "journal": "The EMBO journal", "date": "2004", "authors": "Nakajima K, Hirose H, Taniguchi M, Kurashina H, Arasaki K, Nagahama M, Tani K, Yamamoto A, Tagaya M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "15272311", "url": "https://glygen.org/publication/PubMed/15272311" } ] }, { "title": "Human chromokinesin KIF4A functions in chromosome condensation and segregation.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Mazumdar M, Sundareshan S, Misteli T", "evidence": [ { "database": "Reactome", "id": "R-HSA-983189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983189" } ], "reference": [ { "type": "PubMed", "id": "15326200", "url": "https://glygen.org/publication/PubMed/15326200" } ] }, { "title": "Dynamics of GBF1, a Brefeldin A-sensitive Arf1 exchange factor at the Golgi.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Niu TK, Pfeifer AC, Lippincott-Schwartz J, Jackson CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "15616190", "url": "https://glygen.org/publication/PubMed/15616190" } ] }, { "title": "Live imaging of bidirectional traffic from the ERGIC.", "journal": "Journal of cell science", "date": "2005", "authors": "Ben-Tekaya H, Miura K, Pepperkok R, Hauri HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "15632110", "url": "https://glygen.org/publication/PubMed/15632110" } ] }, { "title": "AP2 clathrin adaptor complex, but not AP1, controls the access of the major histocompatibility complex (MHC) class II to endosomes.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Dugast M, Toussaint H, Dousset C, Benaroch P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "15749704", "url": "https://glygen.org/publication/PubMed/15749704" } ] }, { "title": "Dissection of membrane dynamics of the ARF-guanine nucleotide exchange factor GBF1.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2005", "authors": "Szul T, Garcia-Mata R, Brandon E, Shestopal S, Alvarez C, Sztul E", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "15813748", "url": "https://glygen.org/publication/PubMed/15813748" } ] }, { "title": "Involvement of clathrin and AP-2 in the trafficking of MHC class II molecules to antigen-processing compartments.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "McCormick PJ, Martina JA, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "15911768", "url": "https://glygen.org/publication/PubMed/15911768" } ] }, { "title": "Isoform-selective effects of the depletion of ADP-ribosylation factors 1-5 on membrane traffic.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Volpicelli-Daley LA, Li Y, Zhang CJ, Kahn RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "16030262", "url": "https://glygen.org/publication/PubMed/16030262" } ] }, { "title": "Cloning and expression of a human kinesin heavy chain gene: interaction of the COOH-terminal domain with cytoplasmic microtubules in transfected CV-1 cells.", "journal": "The Journal of cell biology", "date": "1992", "authors": "Navone F, Niclas J, Hom-Booher N, Sparks L, Bernstein HD, McCaffrey G, Vale RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-983189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983189" } ], "reference": [ { "type": "PubMed", "id": "1607388", "url": "https://glygen.org/publication/PubMed/1607388" } ] }, { "title": "Asparaginyl endopeptidase: case history of a class II MHC compartment protease.", "journal": "Immunological reviews", "date": "2005", "authors": "Watts C, Matthews SP, Mazzeo D, Manoury B, Moss CX", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "16181339", "url": "https://glygen.org/publication/PubMed/16181339" } ] }, { "title": "Assembly of major histocompatibility complex class II subunits with invariant chain.", "journal": "FEBS letters", "date": "2005", "authors": "Neumann J, Koch N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "16242130", "url": "https://glygen.org/publication/PubMed/16242130" } ] }, { "title": "Kinesin-2 is a motor for late endosomes and lysosomes.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2005", "authors": "Brown CL, Maier KC, Stauber T, Ginkel LM, Wordeman L, Vernos I, Schroer TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-983189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983189" } ], "reference": [ { "type": "PubMed", "id": "16262723", "url": "https://glygen.org/publication/PubMed/16262723" } ] }, { "title": "ADP-ribosylation factor, a small GTP-binding protein, is required for binding of the coatomer protein beta-COP to Golgi membranes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1992", "authors": "Donaldson JG, Cassel D, Kahn RA, Klausner RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "1631136", "url": "https://glygen.org/publication/PubMed/1631136" } ] }, { "title": "Phosphoproteome analysis of the human mitotic spindle.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Nousiainen M, Sillje HH, Sauer G, Nigg EA, Korner R", "evidence": [ { "database": "iPTMnet", "id": "O95235-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235-1" } ], "reference": [ { "type": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" } ] }, { "title": "RINT-1 regulates the localization and entry of ZW10 to the syntaxin 18 complex.", "journal": "Molecular biology of the cell", "date": "2006", "authors": "Arasaki K, Taniguchi M, Tani K, Tagaya M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "16571679", "url": "https://glygen.org/publication/PubMed/16571679" } ] }, { "title": "Invariant chain transmembrane domain trimerization: a step in MHC class II assembly.", "journal": "Biochemistry", "date": "2006", "authors": "Dixon AM, Stanley BJ, Matthews EE, Dawson JP, Engelman DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "16618111", "url": "https://glygen.org/publication/PubMed/16618111" } ] }, { "title": "ARF proteins: roles in membrane traffic and beyond.", "journal": "Nature reviews. Molecular cell biology", "date": "2006", "authors": "D'Souza-Schorey C, Chavrier P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "16633337", "url": "https://glygen.org/publication/PubMed/16633337" } ] }, { "title": "ADP-ribosylation factor is a subunit of the coat of Golgi-derived COP-coated vesicles: a novel role for a GTP-binding protein.", "journal": "Cell", "date": "1991", "authors": "Serafini T, Orci L, Amherdt M, Brunner M, Kahn RA, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "1680566", "url": "https://glygen.org/publication/PubMed/1680566" } ] }, { "title": "The formation of TGN-to-plasma-membrane transport carriers.", "journal": "Annual review of cell and developmental biology", "date": "2006", "authors": "Bard F, Malhotra V", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "16824007", "url": "https://glygen.org/publication/PubMed/16824007" } ] }, { "title": "SNAREs--engines for membrane fusion.", "journal": "Nature reviews. Molecular cell biology", "date": "2006", "authors": "Jahn R, Scheller RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "16912714", "url": "https://glygen.org/publication/PubMed/16912714" } ] }, { "title": "GBF1, a cis-Golgi and VTCs-localized ARF-GEF, is implicated in ER-to-Golgi protein traffic.", "journal": "Journal of cell science", "date": "2006", "authors": "Zhao X, Claude A, Chun J, Shields DJ, Presley JF, Melancon P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "16926190", "url": "https://glygen.org/publication/PubMed/16926190" } ] }, { "title": "Coatomer, the coat protein of COPI transport vesicles, discriminates endoplasmic reticulum residents from p24 proteins.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Bethune J, Kol M, Hoffmann J, Reckmann I, Brugger B, Wieland F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "16940185", "url": "https://glygen.org/publication/PubMed/16940185" } ] }, { "title": "A probability-based approach for high-throughput protein phosphorylation analysis and site localization.", "journal": "Nat. Biotechnol.", "date": "2006", "authors": "Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" } ], "reference": [ { "type": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" } ] }, { "title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.", "journal": "Cell", "date": "2006", "authors": "Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" }, { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" } ], "reference": [ { "type": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ] }, { "title": "A role for kinesin-2 in COPI-dependent recycling between the ER and the Golgi complex.", "journal": "Current biology : CB", "date": "2006", "authors": "Stauber T, Simpson JC, Pepperkok R, Vernos I", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "17113389", "url": "https://glygen.org/publication/PubMed/17113389" } ] }, { "title": "Functional requirements for the lysosomal thiol reductase GILT in MHC class II-restricted antigen processing.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2006", "authors": "Hastings KT, Lackman RL, Cresswell P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "17142755", "url": "https://glygen.org/publication/PubMed/17142755" } ] }, { "title": "Two lipid-packing sensor motifs contribute to the sensitivity of ArfGAP1 to membrane curvature.", "journal": "Biochemistry", "date": "2007", "authors": "Mesmin B, Drin G, Levi S, Rawet M, Cassel D, Bigay J, Antonny B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "17253781", "url": "https://glygen.org/publication/PubMed/17253781" } ] }, { "title": "Activation of endosomal dynein motors by stepwise assembly of Rab7-RILP-p150Glued, ORP1L, and the receptor betalll spectrin.", "journal": "The Journal of cell biology", "date": "2007", "authors": "Johansson M, Rocha N, Zwart W, Jordens I, Janssen L, Kuijl C, Olkkonen VM, Neefjes J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "17283181", "url": "https://glygen.org/publication/PubMed/17283181" } ] }, { "title": "The human kinesin Kif18A is a motile microtubule depolymerase essential for chromosome congression.", "journal": "Current biology : CB", "date": "2007", "authors": "Mayr MI, Hummer S, Bormann J, Gruner T, Adio S, Woehlke G, Mayer TU", "evidence": [ { "database": "Reactome", "id": "R-HSA-983189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983189" } ], "reference": [ { "type": "PubMed", "id": "17346968", "url": "https://glygen.org/publication/PubMed/17346968" } ] }, { "title": "Differential localization of coatomer complex isoforms within the Golgi apparatus.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Moelleken J, Malsam J, Betts MJ, Movafeghi A, Reckmann I, Meissner I, Hellwig A, Russell RB, Sollner T, Brugger B, Wieland FT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "17360540", "url": "https://glygen.org/publication/PubMed/17360540" } ] }, { "title": "Rab1b interacts with GBF1 and modulates both ARF1 dynamics and COPI association.", "journal": "Molecular biology of the cell", "date": "2007", "authors": "Monetta P, Slavin I, Romero N, Alvarez C", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "17429068", "url": "https://glygen.org/publication/PubMed/17429068" } ] }, { "title": "Multiple and stepwise interactions between coatomer and ADP-ribosylation factor-1 (Arf1)-GTP.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2007", "authors": "Sun Z, Anderl F, Frohlich K, Zhao L, Hanke S, Brugger B, Wieland F, Bethune J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "17451557", "url": "https://glygen.org/publication/PubMed/17451557" } ] }, { "title": "The kinesin-13 proteins Kif2a, Kif2b, and Kif2c/MCAK have distinct roles during mitosis in human cells.", "journal": "Molecular biology of the cell", "date": "2007", "authors": "Manning AL, Ganem NJ, Bakhoum SF, Wagenbach M, Wordeman L, Compton DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-983189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983189" } ], "reference": [ { "type": "PubMed", "id": "17538014", "url": "https://glygen.org/publication/PubMed/17538014" } ] }, { "title": "Two human ARFGAPs associated with COP-I-coated vesicles.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2007", "authors": "Frigerio G, Grimsey N, Dale M, Majoul I, Duden R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "17760859", "url": "https://glygen.org/publication/PubMed/17760859" } ] }, { "title": "Mammalian GPI-anchored proteins require p24 proteins for their efficient transport from the ER to the plasma membrane.", "journal": "The Biochemical journal", "date": "2008", "authors": "Takida S, Maeda Y, Kinoshita T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "17927562", "url": "https://glygen.org/publication/PubMed/17927562" } ] }, { "title": "Dissecting the role of the ARF guanine nucleotide exchange factor GBF1 in Golgi biogenesis and protein trafficking.", "journal": "Journal of cell science", "date": "2007", "authors": "Szul T, Grabski R, Lyons S, Morohashi Y, Shestopal S, Lowe M, Sztul E", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "17956946", "url": "https://glygen.org/publication/PubMed/17956946" } ] }, { "title": "MHC class II molecules on the move for successful antigen presentation.", "journal": "The EMBO journal", "date": "2008", "authors": "Rocha N, Neefjes J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "18046453", "url": "https://glygen.org/publication/PubMed/18046453" } ] }, { "title": "A conformational change in the alpha-subunit of coatomer induced by ligand binding to gamma-COP revealed by single-pair FRET.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2008", "authors": "Langer JD, Roth CM, Bethune J, Stoops EH, Brugger B, Herten DP, Wieland FT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "18182008", "url": "https://glygen.org/publication/PubMed/18182008" } ] }, { "title": "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.", "journal": "J. Proteome Res.", "date": "2008", "authors": "Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" }, { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" } ], "reference": [ { "type": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" } ] }, { "title": "The cargo receptors Surf4, endoplasmic reticulum-Golgi intermediate compartment (ERGIC)-53, and p25 are required to maintain the architecture of ERGIC and Golgi.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "Mitrovic S, Ben-Tekaya H, Koegler E, Gruenberg J, Hauri HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "18287528", "url": "https://glygen.org/publication/PubMed/18287528" } ] }, { "title": "Lysosomal cysteine and aspartic proteases are heterogeneously expressed and act redundantly to initiate human invariant chain degradation.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2008", "authors": "Costantino CM, Hang HC, Kent SC, Hafler DA, Ploegh HL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "18292509", "url": "https://glygen.org/publication/PubMed/18292509" } ] }, { "title": "Phosphorylation relieves autoinhibition of the kinetochore motor Cenp-E.", "journal": "Molecular cell", "date": "2008", "authors": "Espeut J, Gaussen A, Bieling P, Morin V, Prieto S, Fesquet D, Surrey T, Abrieu A", "evidence": [ { "database": "Reactome", "id": "R-HSA-983189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983189" } ], "reference": [ { "type": "PubMed", "id": "18342609", "url": "https://glygen.org/publication/PubMed/18342609" } ] }, { "title": "Characterization of class I and II ADP-ribosylation factors (Arfs) in live cells: GDP-bound class II Arfs associate with the ER-Golgi intermediate compartment independently of GBF1.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "Chun J, Shapovalova Z, Dejgaard SY, Presley JF, Melancon P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "18524849", "url": "https://glygen.org/publication/PubMed/18524849" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" }, { "database": "iPTMnet", "id": "O95235-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235-1" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.", "journal": "Mol. Cell", "date": "2008", "authors": "Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" }, { "database": "iPTMnet", "id": "O95235-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235-1" } ], "reference": [ { "type": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ] }, { "title": "Consensus nomenclature for the human ArfGAP domain-containing proteins.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Kahn RA, Bruford E, Inoue H, Logsdon JM Jr, Nie Z, Premont RT, Randazzo PA, Satake M, Theibert AB, Zapp ML, Cassel D", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "18809720", "url": "https://glygen.org/publication/PubMed/18809720" } ] }, { "title": "'Coatomer': a cytosolic protein complex containing subunits of non-clathrin-coated Golgi transport vesicles.", "journal": "Nature", "date": "1991", "authors": "Waters MG, Serafini T, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "1898986", "url": "https://glygen.org/publication/PubMed/1898986" } ] }, { "title": "Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis.", "journal": "Analytical chemistry", "date": "2008", "authors": "Wang B, Malik R, Nigg EA, Korner R", "evidence": [ { "database": "iPTMnet", "id": "O95235-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235-1" } ], "reference": [ { "type": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" } ] }, { "title": "Differential roles of ArfGAP1, ArfGAP2, and ArfGAP3 in COPI trafficking.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Weimer C, Beck R, Eckert P, Reckmann I, Moelleken J, Brugger B, Wieland F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "19015319", "url": "https://glygen.org/publication/PubMed/19015319" } ] }, { "title": "Discrete determinants in ArfGAP2/3 conferring Golgi localization and regulation by the COPI coat.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Kliouchnikov L, Bigay J, Mesmin B, Parnis A, Rawet M, Goldfeder N, Antonny B, Cassel D", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "19109418", "url": "https://glygen.org/publication/PubMed/19109418" } ] }, { "title": "Kinesin-14 family proteins HSET/XCTK2 control spindle length by cross-linking and sliding microtubules.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Cai S, Weaver LN, Ems-McClung SC, Walczak CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-983189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983189" } ], "reference": [ { "type": "PubMed", "id": "19116309", "url": "https://glygen.org/publication/PubMed/19116309" } ] }, { "title": "Structural characterization of Tip20p and Dsl1p, subunits of the Dsl1p vesicle tethering complex.", "journal": "Nature structural & molecular biology", "date": "2009", "authors": "Tripathi A, Ren Y, Jeffrey PD, Hughson FM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "19151722", "url": "https://glygen.org/publication/PubMed/19151722" } ] }, { "title": "Membrane fusion: grappling with SNARE and SM proteins.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Sudhof TC, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "19164740", "url": "https://glygen.org/publication/PubMed/19164740" } ] }, { "title": "Mammalian Kinesin-3 motors are dimeric in vivo and move by processive motility upon release of autoinhibition.", "journal": "PLoS biology", "date": "2009", "authors": "Hammond JW, Cai D, Blasius TL, Li Z, Jiang Y, Jih GT, Meyhofer E, Verhey KJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-983189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983189" } ], "reference": [ { "type": "PubMed", "id": "19338388", "url": "https://glygen.org/publication/PubMed/19338388" } ] }, { "title": "Identification of the neuroblastoma-amplified gene product as a component of the syntaxin 18 complex implicated in Golgi-to-endoplasmic reticulum retrograde transport.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Aoki T, Ichimura S, Itoh A, Kuramoto M, Shinkawa T, Isobe T, Tagaya M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "19369418", "url": "https://glygen.org/publication/PubMed/19369418" } ] }, { "title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.", "journal": "Analytical chemistry", "date": "2009", "authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S", "evidence": [ { "database": "iPTMnet", "id": "O95235-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235-1" } ], "reference": [ { "type": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ] }, { "title": "Phosphoproteomic analysis of distinct tumor cell lines in response to nocodazole treatment.", "journal": "Proteomics", "date": "2009", "authors": "Nagano K, Shinkawa T, Mutoh H, Kondoh O, Morimoto S, Inomata N, Ashihara M, Ishii N, Aoki Y, Haramura M", "evidence": [ { "database": "iPTMnet", "id": "O95235-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235-1" } ], "reference": [ { "type": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" } ] }, { "title": "Formation of a nine-subunit complex by HLA class II glycoproteins and the invariant chain.", "journal": "Nature", "date": "1991", "authors": "Roche PA, Marks MS, Cresswell P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "1956401", "url": "https://glygen.org/publication/PubMed/1956401" } ] }, { "title": "Cholesterol sensor ORP1L contacts the ER protein VAP to control Rab7-RILP-p150 Glued and late endosome positioning.", "journal": "The Journal of cell biology", "date": "2009", "authors": "Rocha N, Kuijl C, van der Kant R, Janssen L, Houben D, Janssen H, Zwart W, Neefjes J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "19564404", "url": "https://glygen.org/publication/PubMed/19564404" } ] }, { "title": "Binding of ARF and beta-COP to Golgi membranes: possible regulation by a trimeric G protein.", "journal": "Science (New York, N.Y.)", "date": "1991", "authors": "Donaldson JG, Kahn RA, Lippincott-Schwartz J, Klausner RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "1957170", "url": "https://glygen.org/publication/PubMed/1957170" } ] }, { "title": "The COPI system: molecular mechanisms and function.", "journal": "FEBS letters", "date": "2009", "authors": "Beck R, Rawet M, Wieland FT, Cassel D", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "19631211", "url": "https://glygen.org/publication/PubMed/19631211" } ] }, { "title": "Phosphoproteomic analysis of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Brill LM, Xiong W, Lee KB, Ficarro SB, Crain A, Xu Y, Terskikh A, Snyder EY, Ding S", "evidence": [ { "database": "iPTMnet", "id": "O95235-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235-1" } ], "reference": [ { "type": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" } ] }, { "title": "Quantitative analysis of the human spindle phosphoproteome at distinct mitotic stages.", "journal": "Journal of proteome research", "date": "2009", "authors": "Malik R, Lenobel R, Santamaria A, Ries A, Nigg EA, Korner R", "evidence": [ { "database": "iPTMnet", "id": "O95235-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235-1" } ], "reference": [ { "type": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" } ] }, { "title": "A link between ER tethering and COP-I vesicle uncoating.", "journal": "Developmental cell", "date": "2009", "authors": "Zink S, Wenzel D, Wurm CA, Schmitt HD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "19758564", "url": "https://glygen.org/publication/PubMed/19758564" } ] }, { "title": "A structure-based mechanism for vesicle capture by the multisubunit tethering complex Dsl1.", "journal": "Cell", "date": "2009", "authors": "Ren Y, Yip CK, Tripathi A, Huie D, Jeffrey PD, Walz T, Hughson FM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "20005805", "url": "https://glygen.org/publication/PubMed/20005805" } ] }, { "title": "Extensive crosstalk between O-GlcNAcylation and phosphorylation regulates cytokinesis.", "journal": "Science signaling", "date": "2010", "authors": "Wang Z, Udeshi ND, Slawson C, Compton PD, Sakabe K, Cheung WD, Shabanowitz J, Hunt DF, Hart GW", "evidence": [ { "database": "iPTMnet", "id": "O95235-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235-1" } ], "reference": [ { "type": "PubMed", "id": "20068230", "url": "https://glygen.org/publication/PubMed/20068230" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" }, { "database": "iPTMnet", "id": "O95235-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Regulation of ER-Golgi intermediate compartment tubulation and mobility by COPI coats, motor proteins and microtubules.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2010", "authors": "Tomas M, Martinez-Alonso E, Ballesta J, Martinez-Menarguez JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "20136777", "url": "https://glygen.org/publication/PubMed/20136777" } ] }, { "title": "Arf3 is activated uniquely at the trans-Golgi network by brefeldin A-inhibited guanine nucleotide exchange factors.", "journal": "Molecular biology of the cell", "date": "2010", "authors": "Manolea F, Chun J, Chen DW, Clarke I, Summerfeldt N, Dacks JB, Melancon P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "20357002", "url": "https://glygen.org/publication/PubMed/20357002" } ] }, { "title": "Selective export of human GPI-anchored proteins from the endoplasmic reticulum.", "journal": "Journal of cell science", "date": "2010", "authors": "Bonnon C, Wendeler MW, Paccaud JP, Hauri HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "20427317", "url": "https://glygen.org/publication/PubMed/20427317" } ] }, { "title": "Structural analysis of the RZZ complex reveals common ancestry with multisubunit vesicle tethering machinery.", "journal": "Structure (London, England : 1993)", "date": "2010", "authors": "Civril F, Wehenkel A, Giorgi FM, Santaguida S, Di Fonzo A, Grigorean G, Ciccarelli FD, Musacchio A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "20462495", "url": "https://glygen.org/publication/PubMed/20462495" } ] }, { "title": "Crystal structure of alpha-COP in complex with epsilon-COP provides insight into the architecture of the COPI vesicular coat.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Hsia KC, Hoelz A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "20534429", "url": "https://glygen.org/publication/PubMed/20534429" } ] }, { "title": "Models for the functions of Arf GAPs.", "journal": "Seminars in cell & developmental biology", "date": "2011", "authors": "East MP, Kahn RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "20637885", "url": "https://glygen.org/publication/PubMed/20637885" } ] }, { "title": "Invariant chain increases the half-life of MHC II by delaying endosomal maturation.", "journal": "Immunology and cell biology", "date": "2011", "authors": "Landsverk OJ, Barois N, Gregers TF, Bakke O", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "21116285", "url": "https://glygen.org/publication/PubMed/21116285" } ] }, { "title": "MHC class II-associated invariant chain contains a sorting signal for endosomal compartments.", "journal": "Cell", "date": "1990", "authors": "Bakke O, Dobberstein B", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "2121367", "url": "https://glygen.org/publication/PubMed/2121367" } ] }, { "title": "Proteinase-activated receptors, nucleotide P2Y receptors, and mu-opioid receptor-1B are under the control of the type I transmembrane proteins p23 and p24A in post-Golgi trafficking.", "journal": "Journal of neurochemistry", "date": "2011", "authors": "Luo W, Wang Y, Reiser G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "21219331", "url": "https://glygen.org/publication/PubMed/21219331" } ] }, { "title": "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.", "journal": "Science signaling", "date": "2011", "authors": "Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" }, { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" } ], "reference": [ { "type": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" } ] }, { "title": "Evidence that the head of kinesin is sufficient for force generation and motility in vitro.", "journal": "Science (New York, N.Y.)", "date": "1990", "authors": "Yang JT, Saxton WM, Stewart RJ, Raff EC, Goldstein LS", "evidence": [ { "database": "Reactome", "id": "R-HSA-983189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983189" } ], "reference": [ { "type": "PubMed", "id": "2142332", "url": "https://glygen.org/publication/PubMed/2142332" } ] }, { "title": "MHC class II engagement by its ligand LAG-3 (CD223) contributes to melanoma resistance to apoptosis.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2011", "authors": "Hemon P, Jean-Louis F, Ramgolam K, Brignone C, Viguier M, Bachelez H, Triebel F, Charron D, Aoudjit F, Al-Daccak R, Michel L", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "21441454", "url": "https://glygen.org/publication/PubMed/21441454" } ] }, { "title": "The Dsl1 protein tethering complex is a resident endoplasmic reticulum complex, which interacts with five soluble NSF (N-ethylmaleimide-sensitive factor) attachment protein receptors (SNAREs): implications for fusion and fusion regulation.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Meiringer CT, Rethmeier R, Auffarth K, Wilson J, Perz A, Barlowe C, Schmitt HD, Ungermann C", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "21550981", "url": "https://glygen.org/publication/PubMed/21550981" } ] }, { "title": "Requirements for the catalytic cycle of the N-ethylmaleimide-Sensitive Factor (NSF).", "journal": "Biochimica et biophysica acta", "date": "2012", "authors": "Zhao C, Smith EC, Whiteheart SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "21689688", "url": "https://glygen.org/publication/PubMed/21689688" } ] }, { "title": "COPI budding within the Golgi stack.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2011", "authors": "Popoff V, Adolf F, Brugger B, Wieland F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "21844168", "url": "https://glygen.org/publication/PubMed/21844168" } ] }, { "title": "Invariant chain association with HLA-DR molecules inhibits immunogenic peptide binding.", "journal": "Nature", "date": "1990", "authors": "Roche PA, Cresswell P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "2190094", "url": "https://glygen.org/publication/PubMed/2190094" } ] }, { "title": "COPII and COPI traffic at the ER-Golgi interface.", "journal": "Physiology (Bethesda, Md.)", "date": "2011", "authors": "Szul T, Sztul E", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "22013193", "url": "https://glygen.org/publication/PubMed/22013193" } ] }, { "title": "p24 proteins are required for secretion of Wnt ligands.", "journal": "EMBO reports", "date": "2011", "authors": "Buechling T, Chaudhary V, Spirohn K, Weiss M, Boutros M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "22094269", "url": "https://glygen.org/publication/PubMed/22094269" } ] }, { "title": "A structure-based mechanism for Arf1-dependent recruitment of coatomer to membranes.", "journal": "Cell", "date": "2012", "authors": "Yu X, Breitman M, Goldberg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "22304919", "url": "https://glygen.org/publication/PubMed/22304919" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" }, { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Secretory protein biogenesis and traffic in the early secretory pathway.", "journal": "Genetics", "date": "2013", "authors": "Barlowe CK, Miller EA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "23396477", "url": "https://glygen.org/publication/PubMed/23396477" } ] }, { "title": "Invariant chain trimers are sequestered in the rough endoplasmic reticulum in the absence of association with HLA class II antigens.", "journal": "The Journal of cell biology", "date": "1990", "authors": "Marks MS, Blum JS, Cresswell P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "2391366", "url": "https://glygen.org/publication/PubMed/2391366" } ] }, { "title": "Isolation of a 45-kDa fragment from the kinesin heavy chain with enhanced ATPase and microtubule-binding activities.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Kuznetsov SA, Vaisberg YA, Rothwell SW, Murphy DB, Gelfand VI", "evidence": [ { "database": "Reactome", "id": "R-HSA-983189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983189" } ], "reference": [ { "type": "PubMed", "id": "2521221", "url": "https://glygen.org/publication/PubMed/2521221" } ] }, { "title": "A three-domain structure of kinesin heavy chain revealed by DNA sequence and microtubule binding analyses.", "journal": "Cell", "date": "1989", "authors": "Yang JT, Laymon RA, Goldstein LS", "evidence": [ { "database": "Reactome", "id": "R-HSA-983189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983189" } ], "reference": [ { "type": "PubMed", "id": "2522352", "url": "https://glygen.org/publication/PubMed/2522352" } ] }, { "title": "Moonlighting functions of the NRZ (mammalian Dsl1) complex.", "journal": "Frontiers in cell and developmental biology", "date": "2014", "authors": "Tagaya M, Arasaki K, Inoue H, Kimura H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "25364732", "url": "https://glygen.org/publication/PubMed/25364732" } ] }, { "title": "Diverse roles for the p24 family of proteins in eukaryotic cells.", "journal": "Biomolecular concepts", "date": "2012", "authors": "Schuiki I, Volchuk A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "25436559", "url": "https://glygen.org/publication/PubMed/25436559" } ] }, { "title": "Three alphaSNAP and 10 ATP molecules are used in SNARE complex disassembly by N-ethylmaleimide-sensitive factor (NSF).", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Shah N, Colbert KN, Enos MD, Herschlag D, Weis WI", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "25492864", "url": "https://glygen.org/publication/PubMed/25492864" } ] }, { "title": "Opposing Activities of Aurora B Kinase and B56-PP2A Phosphatase on MKlp2 Determine Abscission Timing.", "journal": "Current biology : CB", "date": "2017", "authors": "Fung SYS, Kitagawa M, Liao PJ, Wong J, Lee SH", "evidence": [ { "database": "iPTMnet", "id": "O95235", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95235" } ], "reference": [ { "type": "PubMed", "id": "27939310", "url": "https://glygen.org/publication/PubMed/27939310" } ] }, { "title": "Compound heterozygous loss-of-function mutations in KIF20A are associated with a novel lethal congenital cardiomyopathy in two siblings.", "journal": "PLoS genetics", "date": "2018", "authors": "Louw JJ, Nunes Bastos R, Chen X, Verdood C, Corveleyn A, Jia Y, Breckpot J, Gewillig M, Peeters H, Santoro MM, Barr F, Devriendt K", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" } ], "reference": [ { "type": "PubMed", "id": "29357359", "url": "https://glygen.org/publication/PubMed/29357359" } ] }, { "title": "The quaternary structure of bovine brain kinesin.", "journal": "The EMBO journal", "date": "1988", "authors": "Kuznetsov SA, Vaisberg EA, Shanina NA, Magretova NN, Chernyak VY, Gelfand VI", "evidence": [ { "database": "Reactome", "id": "R-HSA-983189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983189" } ], "reference": [ { "type": "PubMed", "id": "3130248", "url": "https://glygen.org/publication/PubMed/3130248" } ] }, { "title": "Native structure and physical properties of bovine brain kinesin and identification of the ATP-binding subunit polypeptide.", "journal": "Biochemistry", "date": "1988", "authors": "Bloom GS, Wagner MC, Pfister KK, Brady ST", "evidence": [ { "database": "Reactome", "id": "R-HSA-983189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983189" } ], "reference": [ { "type": "PubMed", "id": "3134048", "url": "https://glygen.org/publication/PubMed/3134048" } ] }, { "title": "Characterization of KIF20A as a prognostic biomarker and therapeutic target for different subtypes of breast cancer.", "journal": "International journal of oncology", "date": "2020", "authors": "Nakamura M, Takano A, Thang PM, Tsevegjav B, Zhu M, Yokose T, Yamashita T, Miyagi Y, Daigo Y", "evidence": [ { "database": "GlyGen", "id": "A0230", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "32467984", "url": "https://glygen.org/publication/PubMed/32467984" } ] }, { "title": "MKLP2 functions in early mitosis to ensure proper chromosome congression.", "journal": "Journal of cell science", "date": "2022", "authors": "Schrock MS, Scarberry L, Stromberg BR, Sears C, Torres AE, Tallman D, Krupinski L, Chakravarti A, Summers MK", "evidence": [ { "database": "RefSeq", "id": "NP_005724", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005724" } ], "reference": [ { "type": "PubMed", "id": "35638575", "url": "https://glygen.org/publication/PubMed/35638575" } ] }, { "title": "KIF20A promotes the development of fibrosarcoma via PI3K-Akt signaling pathway.", "journal": "Experimental cell research", "date": "2022", "authors": "Jin Z, Tao S, Zhang C, Xu D, Zhu Z", "evidence": [ { "database": "RefSeq", "id": "NP_005724", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005724" } ], "reference": [ { "type": "PubMed", "id": "36037925", "url": "https://glygen.org/publication/PubMed/36037925" } ] }, { "title": "High expression of KIF20A in bladder cancer as a potential prognostic target for poor survival of renal cell carcinoma.", "journal": "Medicine", "date": "2023-01-13", "authors": "Liu Bin, Su Jianzhi, Fan Bo, Ni Xiaochen, Jin Tingting", "evidence": [ { "database": "RefSeq", "id": "NP_005724", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005724" } ], "reference": [ { "type": "PubMed", "id": "36637953", "url": "https://glygen.org/publication/PubMed/36637953" } ] }, { "title": "Circ_0084188 Regulates the progression of colorectal cancer through the miR-769-5p/KIF20A axis.", "journal": "Biochemical genetics", "date": "2023-02-10", "authors": "Zhang Licheng, Song Weiliang, Shi Junzhong, Chen Yuzhuo", "evidence": [ { "database": "RefSeq", "id": "NP_005724", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005724" } ], "reference": [ { "type": "PubMed", "id": "36763221", "url": "https://glygen.org/publication/PubMed/36763221" } ] }, { "title": "Grade scoring system reveals distinct molecular subtypes and identifies KIF20A as a novel biomarker for predicting temozolomide treatment efficiency in gliomas.", "journal": "Journal of cancer research and clinical oncology", "date": "2023-09", "authors": "Ye Liguo, Tong Shi'ao, Wang Yaning, Wang Yu, Ma Wenbin", "evidence": [ { "database": "RefSeq", "id": "NP_005724", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005724" } ], "reference": [ { "type": "PubMed", "id": "37248320", "url": "https://glygen.org/publication/PubMed/37248320" } ] }, { "title": "Self-release of CLIP in peptide loading of HLA-DR molecules.", "journal": "Science (New York, N.Y.)", "date": "1995", "authors": "Kropshofer H, Vogt AB, Stern LJ, Hammerling GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "7481823", "url": "https://glygen.org/publication/PubMed/7481823" } ] }, { "title": "KIF1B, a novel microtubule plus end-directed monomeric motor protein for transport of mitochondria.", "journal": "Cell", "date": "1994", "authors": "Nangaku M, Sato-Yoshitake R, Okada Y, Noda Y, Takemura R, Yamazaki H, Hirokawa N", "evidence": [ { "database": "Reactome", "id": "R-HSA-983189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983189" } ], "reference": [ { "type": "PubMed", "id": "7528108", "url": "https://glygen.org/publication/PubMed/7528108" } ] }, { "title": "The neuron-specific kinesin superfamily protein KIF1A is a unique monomeric motor for anterograde axonal transport of synaptic vesicle precursors.", "journal": "Cell", "date": "1995", "authors": "Okada Y, Yamazaki H, Sekine-Aizawa Y, Hirokawa N", "evidence": [ { "database": "Reactome", "id": "R-HSA-983189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983189" } ], "reference": [ { "type": "PubMed", "id": "7539720", "url": "https://glygen.org/publication/PubMed/7539720" } ] }, { "title": "Structure-activity relationship of the leucine-based sorting motifs in the cytosolic tail of the major histocompatibility complex-associated invariant chain.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Motta A, Bremnes B, Morelli MA, Frank RW, Saviano G, Bakke O", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "7592972", "url": "https://glygen.org/publication/PubMed/7592972" } ] }, { "title": "A role for acidic residues in di-leucine motif-based targeting to the endocytic pathway.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Pond L, Kuhn LA, Teyton L, Schutze MP, Tainer JA, Jackson MR, Peterson PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "7650016", "url": "https://glygen.org/publication/PubMed/7650016" } ] }, { "title": "Structural features of the invariant chain fragment CLIP controlling rapid release from HLA-DR molecules and inhibition of peptide binding.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Kropshofer H, Vogt AB, Hammerling GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "7667286", "url": "https://glygen.org/publication/PubMed/7667286" } ] }, { "title": "Identification and partial characterization of mitotic centromere-associated kinesin, a kinesin-related protein that associates with centromeres during mitosis.", "journal": "The Journal of cell biology", "date": "1995", "authors": "Wordeman L, Mitchison TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-983189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983189" } ], "reference": [ { "type": "PubMed", "id": "7822426", "url": "https://glygen.org/publication/PubMed/7822426" } ] }, { "title": "Kinesin is the motor for microtubule-mediated Golgi-to-ER membrane traffic.", "journal": "The Journal of cell biology", "date": "1995", "authors": "Lippincott-Schwartz J, Cole NB, Marotta A, Conrad PA, Bloom GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "7844144", "url": "https://glygen.org/publication/PubMed/7844144" } ] }, { "title": "A novel microtubule-based motor protein (KIF4) for organelle transports, whose expression is regulated developmentally.", "journal": "The Journal of cell biology", "date": "1994", "authors": "Sekine Y, Okada Y, Noda Y, Kondo S, Aizawa H, Takemura R, Hirokawa N", "evidence": [ { "database": "Reactome", "id": "R-HSA-983189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983189" } ], "reference": [ { "type": "PubMed", "id": "7929562", "url": "https://glygen.org/publication/PubMed/7929562" } ] }, { "title": "Coatomer is essential for retrieval of dilysine-tagged proteins to the endoplasmic reticulum.", "journal": "Cell", "date": "1994", "authors": "Letourneur F, Gaynor EC, Hennecke S, Demolliere C, Duden R, Emr SD, Riezman H, Cosson P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "8001155", "url": "https://glygen.org/publication/PubMed/8001155" } ] }, { "title": "Selective release of some invariant chain-derived peptides from HLA-DR1 molecules at endosomal pH.", "journal": "The Journal of experimental medicine", "date": "1994", "authors": "Urban RG, Chicz RM, Strominger JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "8046351", "url": "https://glygen.org/publication/PubMed/8046351" } ] }, { "title": "Coatomer interaction with di-lysine endoplasmic reticulum retention motifs.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Cosson P, Letourneur F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "8128252", "url": "https://glygen.org/publication/PubMed/8128252" } ] }, { "title": "En bloc incorporation of coatomer subunits during the assembly of COP-coated vesicles.", "journal": "The Journal of cell biology", "date": "1994", "authors": "Hara-Kuge S, Kuge O, Orci L, Amherdt M, Ravazzola M, Wieland FT, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "8132710", "url": "https://glygen.org/publication/PubMed/8132710" } ] }, { "title": "Endosomal aspartic proteinases are required for invariant-chain processing.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Maric MA, Taylor MD, Blum JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "8134367", "url": "https://glygen.org/publication/PubMed/8134367" } ] }, { "title": "Crystal structure of the human class II MHC protein HLA-DR1 complexed with an influenza virus peptide.", "journal": "Nature", "date": "1994", "authors": "Stern LJ, Brown JH, Jardetzky TS, Gorga JC, Urban RG, Strominger JL, Wiley DC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "8145819", "url": "https://glygen.org/publication/PubMed/8145819" } ] }, { "title": "Class II histocompatibility molecules associate with calnexin during assembly in the endoplasmic reticulum.", "journal": "International immunology", "date": "1994", "authors": "Schreiber KL, Bell MP, Huntoon CJ, Rajagopalan S, Brenner MB, McKean DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "8148318", "url": "https://glygen.org/publication/PubMed/8148318" } ] }, { "title": "A protein assembly-disassembly pathway in vitro that may correspond to sequential steps of synaptic vesicle docking, activation, and fusion.", "journal": "Cell", "date": "1993", "authors": "Sollner T, Bennett MK, Whiteheart SW, Scheller RH, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "8221884", "url": "https://glygen.org/publication/PubMed/8221884" } ] }, { "title": "Hydrolysis of bound GTP by ARF protein triggers uncoating of Golgi-derived COP-coated vesicles.", "journal": "The Journal of cell biology", "date": "1993", "authors": "Tanigawa G, Orci L, Amherdt M, Ravazzola M, Helms JB, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "8253837", "url": "https://glygen.org/publication/PubMed/8253837" } ] }, { "title": "A role for calnexin (IP90) in the assembly of class II MHC molecules.", "journal": "The EMBO journal", "date": "1994", "authors": "Anderson KS, Cresswell P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "8313912", "url": "https://glygen.org/publication/PubMed/8313912" } ] }, { "title": "Cell surface HLA-DR-invariant chain complexes are targeted to endosomes by rapid internalization.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Roche PA, Teletski CL, Stang E, Bakke O, Long EO", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "8397411", "url": "https://glygen.org/publication/PubMed/8397411" } ] }, { "title": "The segment of invariant chain that is critical for association with major histocompatibility complex class II molecules contains the sequence of a peptide eluted from class II polypeptides.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Freisewinkel IM, Schenck K, Koch N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "8415765", "url": "https://glygen.org/publication/PubMed/8415765" } ] }, { "title": "Binding of coatomer to Golgi membranes requires ADP-ribosylation factor.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Palmer DJ, Helms JB, Beckers CJ, Orci L, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "8505331", "url": "https://glygen.org/publication/PubMed/8505331" } ] }, { "title": "Phosphorylation by p34cdc2 regulates spindle association of human Eg5, a kinesin-related motor essential for bipolar spindle formation in vivo.", "journal": "Cell", "date": "1995", "authors": "Blangy A, Lane HA, d'Herin P, Harper M, Kress M, Nigg EA", "evidence": [ { "database": "Reactome", "id": "R-HSA-983189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983189" } ], "reference": [ { "type": "PubMed", "id": "8548803", "url": "https://glygen.org/publication/PubMed/8548803" } ] }, { "title": "Kid, a novel kinesin-like DNA binding protein, is localized to chromosomes and the mitotic spindle.", "journal": "The EMBO journal", "date": "1996", "authors": "Tokai N, Fujimoto-Nishiyama A, Toyoshima Y, Yonemura S, Tsukita S, Inoue J, Yamamota T", "evidence": [ { "database": "Reactome", "id": "R-HSA-983189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983189" } ], "reference": [ { "type": "PubMed", "id": "8599929", "url": "https://glygen.org/publication/PubMed/8599929" } ] }, { "title": "Direct observation of single kinesin molecules moving along microtubules.", "journal": "Nature", "date": "1996", "authors": "Vale RD, Funatsu T, Pierce DW, Romberg L, Harada Y, Yanagida T", "evidence": [ { "database": "Reactome", "id": "R-HSA-983189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983189" } ], "reference": [ { "type": "PubMed", "id": "8602245", "url": "https://glygen.org/publication/PubMed/8602245" } ] }, { "title": "Sec18p (NSF)-driven release of Sec17p (alpha-SNAP) can precede docking and fusion of yeast vacuoles.", "journal": "Cell", "date": "1996", "authors": "Mayer A, Wickner W, Haas A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "8620540", "url": "https://glygen.org/publication/PubMed/8620540" } ] }, { "title": "B lymphocytes secrete antigen-presenting vesicles.", "journal": "The Journal of experimental medicine", "date": "1996", "authors": "Raposo G, Nijman HW, Stoorvogel W, Liejendekker R, Harding CV, Melief CJ, Geuze HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "8642258", "url": "https://glygen.org/publication/PubMed/8642258" } ] }, { "title": "Potential sites for processing of the human invariant chain by cathepsins D and E.", "journal": "Biochemical and biophysical research communications", "date": "1996", "authors": "Kageyama T, Yonezawa S, Ichinose M, Miki K, Moriyama A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "8687433", "url": "https://glygen.org/publication/PubMed/8687433" } ] }, { "title": "Enhanced dissociation of HLA-DR-bound peptides in the presence of HLA-DM.", "journal": "Science (New York, N.Y.)", "date": "1996", "authors": "Weber DA, Evavold BD, Jensen PE", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "8849454", "url": "https://glygen.org/publication/PubMed/8849454" } ] }, { "title": "Direct vesicular transport of MHC class II molecules from lysosomal structures to the cell surface.", "journal": "The Journal of cell biology", "date": "1996", "authors": "Wubbolts R, Fernandez-Borja M, Oomen L, Verwoerd D, Janssen H, Calafat J, Tulp A, Dusseljee S, Neefjes J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "8909537", "url": "https://glygen.org/publication/PubMed/8909537" } ] }, { "title": "Expression of major histocompatibility complex class II molecules in HeLa cells promotes the recruitment of AP-1 Golgi-specific assembly proteins on Golgi membranes.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Salamero J, Le Borgne R, Saudrais C, Goud B, Hoflack B", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "8939989", "url": "https://glygen.org/publication/PubMed/8939989" } ] }, { "title": "Editing of the HLA-DR-peptide repertoire by HLA-DM.", "journal": "The EMBO journal", "date": "1996", "authors": "Kropshofer H, Vogt AB, Moldenhauer G, Hammer J, Blum JS, Hammerling GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "8947036", "url": "https://glygen.org/publication/PubMed/8947036" } ] }, { "title": "HLA-DM acts as a molecular chaperone and rescues empty HLA-DR molecules at lysosomal pH.", "journal": "Immunity", "date": "1997", "authors": "Kropshofer H, Arndt SO, Moldenhauer G, Hammerling GJ, Vogt AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "9075930", "url": "https://glygen.org/publication/PubMed/9075930" } ] }, { "title": "Direct and GTP-dependent interaction of ADP ribosylation factor 1 with coatomer subunit beta.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Zhao L, Helms JB, Brugger B, Harter C, Martoglio B, Graf R, Brunner J, Wieland FT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "9114004", "url": "https://glygen.org/publication/PubMed/9114004" } ] }, { "title": "Assembly and disassembly of a ternary complex of synaptobrevin, syntaxin, and SNAP-25 in the membrane of synaptic vesicles.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Otto H, Hanson PI, Jahn R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "9177194", "url": "https://glygen.org/publication/PubMed/9177194" } ] }, { "title": "Decreased endosomal delivery of major histocompatibility complex class II-invariant chain complexes in dynamin-deficient cells.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Wang K, Peterson PA, Karlsson L", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "9202021", "url": "https://glygen.org/publication/PubMed/9202021" } ] }, { "title": "Bidirectional transport by distinct populations of COPI-coated vesicles.", "journal": "Cell", "date": "1997", "authors": "Orci L, Stamnes M, Ravazzola M, Amherdt M, Perrelet A, Sollner TH, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "9244307", "url": "https://glygen.org/publication/PubMed/9244307" } ] }, { "title": "ER-to-Golgi transport visualized in living cells.", "journal": "Nature", "date": "1997", "authors": "Presley JF, Cole NB, Schroer TA, Hirschberg K, Zaal KJ, Lippincott-Schwartz J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "9288971", "url": "https://glygen.org/publication/PubMed/9288971" } ] }, { "title": "Negative regulation by HLA-DO of MHC class II-restricted antigen processing.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Denzin LK, Sant'Angelo DB, Hammond C, Surman MJ, Cresswell P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "9311912", "url": "https://glygen.org/publication/PubMed/9311912" } ] }, { "title": "Interaction of MHC class II molecules with the invariant chain: role of the invariant chain (81-90) region.", "journal": "The EMBO journal", "date": "1997", "authors": "Stumptner P, Benaroch P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "9312039", "url": "https://glygen.org/publication/PubMed/9312039" } ] }, { "title": "The KDEL receptor, ERD2, regulates intracellular traffic by recruiting a GTPase-activating protein for ARF1.", "journal": "The EMBO journal", "date": "1997", "authors": "Aoe T, Cukierman E, Lee A, Cassel D, Peters PJ, Hsu VW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "9405360", "url": "https://glygen.org/publication/PubMed/9405360" } ] }, { "title": "Medium chains of adaptor complexes AP-1 and AP-2 recognize leucine-based sorting signals from the invariant chain.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Rodionov DG, Bakke O", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "9497313", "url": "https://glygen.org/publication/PubMed/9497313" } ] }, { "title": "Cathepsins B and D are dispensable for major histocompatibility complex class II-mediated antigen presentation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Deussing J, Roth W, Saftig P, Peters C, Ploegh HL, Villadangos JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "9539769", "url": "https://glygen.org/publication/PubMed/9539769" } ] }, { "title": "Cathepsin L: critical role in Ii degradation and CD4 T cell selection in the thymus.", "journal": "Science (New York, N.Y.)", "date": "1998", "authors": "Nakagawa T, Roth W, Wong P, Nelson A, Farr A, Deussing J, Villadangos JA, Ploegh H, Peters C, Rudensky AY", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "9545226", "url": "https://glygen.org/publication/PubMed/9545226" } ] }, { "title": "A role for HLA-DO as a co-chaperone of HLA-DM in peptide loading of MHC class II molecules.", "journal": "The EMBO journal", "date": "1998", "authors": "Kropshofer H, Vogt AB, Thery C, Armandola EA, Li BC, Moldenhauer G, Amigorena S, Hammerling GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "9606180", "url": "https://glygen.org/publication/PubMed/9606180" } ] }, { "title": "A single binding site for dilysine retrieval motifs and p23 within the gamma subunit of coatomer.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Harter C, Wieland FT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "9751720", "url": "https://glygen.org/publication/PubMed/9751720" } ] }, { "title": "Receptor-induced polymerization of coatomer.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Reinhard C, Harter C, Bremser M, Brugger B, Sohn K, Helms JB, Wieland F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811434", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434" } ], "reference": [ { "type": "PubMed", "id": "9990005", "url": "https://glygen.org/publication/PubMed/9990005" } ] } ], "pathway": [ { "id": "hsa:10112", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10112", "resource": "KEGG Pathway" }, { "id": "R-HSA-2132295", "name": "MHC class II antigen presentation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295", "resource": "Reactome", "description": "MHC class II antigen presentation" }, { "id": "R-HSA-6811434", "name": "COPI-dependent Golgi-to-ER retrograde traffic", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811434", "resource": "Reactome", "description": "COPI-dependent Golgi-to-ER retrograde traffic" }, { "id": "R-HSA-68884", "name": "Mitotic Telophase/Cytokinesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68884", "resource": "Reactome", "description": "Mitotic Telophase/Cytokinesis" }, { "id": "R-HSA-983189", "name": "Kinesins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983189", "resource": "Reactome", "description": "Kinesins" } ], "orthologs": [ { "uniprot_canonical_ac": "A6J2V3-1", "protein_name": "Kinesin-like protein", "gene_name": "Kif20a", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSHGILSPPVGLLSDEDVADSPVLESTAADLRSVVRKDLLSDCSVISASLEDKQAPMEDTAEKMKVYLRIRPFLTSELERQEDQGCVCIENTETLLLQAPKDSFALKSNERGIGQATHKFTFSQIFGPEVGQVSFFNLTMKEMVKDVLRGQNWLIYTYGVTNSGKTYTIQGTSKDVGILPQSLALIFNSLQGQLHPTPDLKPLLSNEVIWLDSKQIRQEEIKKLSLLIGGLQEEELSTSLKKRVHAESRIGASNSFDSGIAGLSSTSQFTSSSQLDETSQLWAQPDTVPVSVPADIRFSIWISFFEIYNELLYDLLEPPSHQHKRQTLRLCEDQNGNPYVKDLNWIHVRDVEEAWKLLKVGRKNQSFASTHMNQHSSRSHSIFSIRILHLQGEGDIVPKISELSLCDLAGSERCKHQKSGERLKEAGNINTSLHTLGRCIAALRQNQQNRSKQNLIPFRDSKLTRVFQGFFTGRGRSCMIVNVNPCASTYDETLHAAKFSALASQLVHAPPVHLGIPSLHSFIKEHSLQVSPGLKKEGKADSDLEDSPEDEADISMYGKEELLQVVEAMKALLLKERQEKLQLEIQLREEICNEMVEQMQQREQWCSERLDTQKDLLEELYEDKLKILKESLTTFYQEQIQERDEKIEELETLLQEAKQQPVAQQSGGCELSLRRSQRLAASASSQQLQEVKAELEQCKTELGSTTAELQKYQQMLKPPPTAKPFTIDVDKKLEEGQKNIRLLRTELQELGQSLQSAERACCHSTGAGKLRQALTNCDDILIKQNQTLAELQNNMMLVKLDLQKKAACIAEQYQTVLKLQGQASAKKRLGANQENQQPNHQPPGKKPFLRHLLPRTPTCQSSTDSSPYARILRSRHSPLLKSPFGKKY", "length": 888 }, "evidence": [ { "id": "45930848", "url": "http://www.informatics.jax.org/homology/45930848", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P97329-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "Kif20a", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSHRILSPPAGLLSDEDVVDSPILESTAADLRSVVRKDLLSDCSVISASLEDKQALLEDTSEKVKVYLRIRPFLTSELDRQEDQGCVCIENTETLVLQAPKDSFALKSNERGVGQATHKFTFSQIFGPEVGQVAFFNLTMKEMVKDVLKGQNWLIYTYGVTNSGKTYTIQGTSKDAGILPQSLALIFNSLQGQLHPTPDLKPLLSNEVIWLDSKQIRQEEMKKLSLLIGGLQEEELSTSVKKRVHTESRIGASNSFDSGVAGLSSTSQFTSSSQLDETSQLWAQPDTVPVSVPADIRFSVWISFFEIYNELLYDLLEPPSHQHKRQTLRLCEDQNGNPYVKDLNWIHVRDVEEAWKLLKVGRKNQSFASTHMNQQSSRSHSIFSIRILHLQGEGDIVPKISELSLCDLAGSERCKHQKSGERLKEAGNINTSLHTLGRCIAALRQNQQNRSKQNLIPFRDSKLTRVFQGFFTGRGRSCMIVNVNPCASTYDETLHAAKFSALASQLVHAPPVHLGIPSLHSFIKKHSPQVGPGLEKEDKADSDLEDSPEDEADVSVYGKEELLQVVEAMKALLLKERQEKLQLEIQLREEICNEMVEQMQQREQWCSERLDNQKELMEELYEEKLKILKESLTTFYQEQIQERDEKIEELETLLQEAKQQPAAQQSGGLSLLRRSQRLAASASTQQFQEVKAELEQCKTELSSTTAELHKYQQVLKPPPPAKPFTIDVDKKLEEGQKNIRLLRTELQKLGQSLQSAERACCHSTGAGKLRQALTNCDDILIKQNQTLAELQNNMVLVKLDLQKKAACIAEQYHTVLKLQGQASAKKRLGANQENQQPNHQPPGKKPFLRNLLPRTPTCQSSTDSSPYARILRSRHSPLLKSPFGKKY", "length": 887 }, "evidence": [ { "id": "45930848", "url": "http://www.informatics.jax.org/homology/45930848", "database": "MGI" }, { "id": "O95235", "url": "https://omabrowser.org/oma/group/O95235/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" } ], "pmid": "" }, { "name": "microtubule binding", "id": "GO:0008017", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008017", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" } ], "pmid": "" }, { "name": "microtubule motor activity", "id": "GO:0003777", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003777", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" } ], "pmid": "" }, { "name": "protein kinase binding", "id": "GO:0019901", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019901", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" } ], "pmid": "" }, { "name": "ATP hydrolysis activity", "id": "GO:0016887", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016887", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" } ], "pmid": "" }, { "name": "intercellular bridge", "id": "GO:0045171", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045171", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" } ], "pmid": "" }, { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" } ], "pmid": "" }, { "name": "spindle", "id": "GO:0005819", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005819", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" } ], "pmid": "" }, { "name": "microtubule", "id": "GO:0005874", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005874", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" } ], "pmid": "" }, { "name": "kinesin complex", "id": "GO:0005871", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005871", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" } ], "pmid": "" }, { "name": "midbody", "id": "GO:0030496", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030496", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "microtubule-based movement", "id": "GO:0007018", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007018", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" } ], "pmid": "" }, { "name": "protein transport", "id": "GO:0015031", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015031", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" } ], "pmid": "" }, { "name": "mitotic cytokinesis", "id": "GO:0000281", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000281", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" } ], "pmid": "" }, { "name": "regulation of cytokinesis", "id": "GO:0032465", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032465", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" } ], "pmid": "" }, { "name": "microtubule bundle formation", "id": "GO:0001578", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001578", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" } ], "pmid": "" }, { "name": "midbody abscission", "id": "GO:0061952", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061952", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 138, "end_pos": 140, "annotation": "n_glycosylation_sequon" }, { "start_pos": 365, "end_pos": 367, "annotation": "n_glycosylation_sequon" }, { "start_pos": 376, "end_pos": 378, "annotation": "n_glycosylation_sequon" }, { "start_pos": 431, "end_pos": 433, "annotation": "n_glycosylation_sequon" }, { "start_pos": 450, "end_pos": 452, "annotation": "n_glycosylation_sequon" }, { "start_pos": 704, "end_pos": 706, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylated by PLK1 at Ser-528 during mitosis, creating a docking site for PLK1 and recruiting PLK1 at central spindle.", "evidence": [ { "database": "UniProtKB", "id": "O95235", "url": "https://www.uniprot.org/uniprot/O95235" }, { "database": "PubMed", "id": "12939256", "url": "https://glygen.org/publication/PubMed/12939256" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [ { "assessed_biomarker_entity": "Kinesin family member 20A (KIF20A)", "biomarker_id": "A0230", "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "32467984", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32467984" } ], "instances": [ { "best_biomarker_type": "prognostic", "status": "increased KIF20A level", "disease": { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] }, "tissue": { "name": "breast", "namespace": "UBERON", "id": "0000310", "url": "http://purl.obolibrary.org/obo/UBERON_0000310" }, "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "32467984", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32467984" } ] } ] } ], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 7, 14, 21, 26, 27, 33, 49, 58, 238, 244, 246, 249, 256, 405, 491, 528, 532, 534, 556, 572, 635, 662, 668, 670, 683, 685, 825, 857, 859, 864, 867, 869, 878, 883 ], "sequon_annotation_sites": [ { "start_pos": 138, "end_pos": 140 }, { "start_pos": 365, "end_pos": 367 }, { "start_pos": 376, "end_pos": 378 }, { "start_pos": 431, "end_pos": 433 }, { "start_pos": 450, "end_pos": 452 }, { "start_pos": 704, "end_pos": 706 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 35 }, { "field": "total_sites", "count": 34 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 199 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }