{ "uniprot_canonical_ac": "O95197-1", "uniprot_ac": "O95197", "uniprot_id": "RTN3_HUMAN", "mass": { "chemical_mass": 112611.0, "monoisotopic_mass": 112611.0 }, "refseq": { "ac": "NP_001252518", "name": "reticulon-3 isoform e", "summary": "This gene belongs to the reticulon family of highly conserved genes that are preferentially expressed in neuroendocrine tissues. This family of proteins interact with, and modulate the activity of beta-amyloid converting enzyme 1 (BACE1), and the production of amyloid-beta. An increase in the expression of any reticulon protein substantially reduces the production of amyloid-beta, suggesting that reticulon proteins are negative modulators of BACE1 in cells. Alternatively spliced transcript variants encoding different isoforms have been found for this gene, and pseudogenes of this gene are located on chromosomes 4 and 12. [provided by RefSeq, May 2012].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001252518" }, "gene_names": [ { "name": "RTN3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O95197", "id": "O95197" }, { "name": "ASYIP; HAP; NSPL2; NSPLII; RTN3-A1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001252518", "id": "NP_001252518" }, { "name": "ASYIP", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O95197", "id": "O95197" }, { "name": "NSPL2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O95197", "id": "O95197" }, { "name": "RTN3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001252518", "id": "NP_001252518" }, { "name": "hCG_1775344", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O95197", "id": "O95197" } ], "protein_names": [ { "name": "Reticulon-3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O95197" }, { "name": "ASY interacting protein; homolog of ASY protein; neuroendocrine-specific protein-like 2; NSP-like protein II; NSP-like protein 2; neuroendocrine-specific protein-like II", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001252518", "id": "NP_001252518" }, { "name": "HAP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95197" }, { "name": "Homolog of ASY protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95197" }, { "name": "NSP-like protein 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95197" }, { "name": "NSP-like protein II", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95197" }, { "name": "NSPLII", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95197" }, { "name": "Neuroendocrine-specific protein-like 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95197" }, { "name": "Neuroendocrine-specific protein-like II", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O95197" }, { "name": "reticulon-3 isoform e", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001252518", "id": "NP_001252518" } ], "function": [ { "annotation": "(Microbial infection) Plays a positive role in viral replication and pathogenesis of enteroviruses.", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197#function" }, { "database": "PubMed", "id": "17182608", "url": "https://glygen.org/publication/PubMed/17182608" } ] }, { "annotation": "LINC02288 promotes chondrocyte apoptosis and inflammation through miR-374a-3p targeting RTN3.", "evidence": [ { "database": "RefSeq", "id": "NP_001252518", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001252518" }, { "database": "PubMed", "id": "33491257", "url": "https://glygen.org/publication/PubMed/33491257" } ] }, { "annotation": "Loss of RTN3 phenocopies chronic kidney disease and results in activation of the IGF2-JAK2 pathway in proximal tubular epithelial cells.", "evidence": [ { "database": "RefSeq", "id": "NP_001252518", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001252518" }, { "database": "PubMed", "id": "35596061", "url": "https://glygen.org/publication/PubMed/35596061" } ] }, { "annotation": "May be involved in membrane trafficking in the early secretory pathway. Inhibits BACE1 activity and amyloid precursor protein processing. May induce caspase-8 cascade and apoptosis. May favor BCL2 translocation to the mitochondria upon endoplasmic reticulum stress. Induces the formation of endoplasmic reticulum tubules (PubMed:25612671). Also acts as an inflammation-resolving regulator by interacting with both TRIM25 and RIGI, subsequently impairing RIGI 'Lys-63'-linked polyubiquitination leading to IRF3 and NF-kappa-B inhibition.", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197#function" }, { "database": "PubMed", "id": "17191123", "url": "https://glygen.org/publication/PubMed/17191123" }, { "database": "PubMed", "id": "15286784", "url": "https://glygen.org/publication/PubMed/15286784" }, { "database": "PubMed", "id": "16054885", "url": "https://glygen.org/publication/PubMed/16054885" }, { "database": "PubMed", "id": "25612671", "url": "https://glygen.org/publication/PubMed/25612671" }, { "database": "PubMed", "id": "17031492", "url": "https://glygen.org/publication/PubMed/17031492" } ] }, { "annotation": "RTN3 and RTN4: Architects of SARS-CoV-2 replication organelles.", "evidence": [ { "database": "RefSeq", "id": "NP_001252518", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001252518" }, { "database": "PubMed", "id": "37318453", "url": "https://glygen.org/publication/PubMed/37318453" } ] }, { "annotation": "RTN3 inhibits RIG-I-mediated antiviral responses by impairing TRIM25-mediated K63-linked polyubiquitination. Erratum:[Elife. 2021 Sep 09;10:. PMID: 34499032] Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001252518", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001252518" }, { "database": "PubMed", "id": "34313226", "url": "https://glygen.org/publication/PubMed/34313226" } ] }, { "annotation": "The ASYIP protein co-localizes with ASY in the endoplasmic reticulum. Characterization of the ASYIP gene helps to clarify ASY-induced apoptosis or Nogo-involved inhibition of neuronal regeneration in the central nervous system.", "evidence": [ { "database": "RefSeq", "id": "NP_001252518", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001252518" }, { "database": "PubMed", "id": "12811824", "url": "https://glygen.org/publication/PubMed/12811824" } ] }, { "annotation": "The Implication of Reticulons (RTNs) in Neurodegenerative Diseases: From Molecular Mechanisms to Potential Diagnostic and Therapeutic Approaches. Review article Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001252518", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001252518" }, { "database": "PubMed", "id": "33924890", "url": "https://glygen.org/publication/PubMed/33924890" } ] }, { "annotation": "This gene belongs to the reticulon family of highly conserved genes that are preferentially expressed in neuroendocrine tissues. This family of proteins interact with, and modulate the activity of beta-amyloid converting enzyme 1 (BACE1), and the production of amyloid-beta. An increase in the expression of any reticulon protein substantially reduces the production of amyloid-beta, suggesting that reticulon proteins are negative modulators of BACE1 in cells. Alternatively spliced transcript variants encoding different isoforms have been found for this gene, and pseudogenes of this gene are located on chromosomes 4 and 12. [provided by RefSeq, May 2012].", "evidence": [ { "database": "RefSeq", "id": "NP_001252518", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001252518" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs755612658", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755612658" }, { "id": "rs755612658", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755612658" }, { "id": "rs755612658", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755612658" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 234, "end_pos": 234, "sequence_org": "S", "sequence_mut": "*", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->*).", "chr_id": "11", "chr_pos": "63719203", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S234", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs955012279", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs955012279" }, { "id": "rs955012279", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs955012279" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 234, "end_pos": 234, "sequence_org": "S", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->A).", "chr_id": "11", "chr_pos": "63719202", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S234", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O95197", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95197" }, { "id": "rs755612658", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755612658" }, { "id": "rs755612658", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755612658" }, { "id": "rs755612658", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755612658" }, { "id": "rs755612658", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755612658" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 234, "end_pos": 234, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "L", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->L).", "chr_id": "11", "chr_pos": "63719203", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S234", "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi" ] }, { "evidence": [ { "id": "rs371391643", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371391643" }, { "id": "rs371391643", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371391643" }, { "id": "rs371391643", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371391643#frequency_tab" }, { "id": "rs371391643", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371391643" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 332, "end_pos": 332, "sequence_org": "M", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NDM->NDT).", "chr_id": "11", "chr_pos": "63719497", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "M332", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1331241032", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1331241032" }, { "id": "rs1331241032", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1331241032#frequency_tab" }, { "id": "rs1331241032", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1331241032" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 353, "end_pos": 353, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DKS->NKS).", "chr_id": "11", "chr_pos": "63719559", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D353", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs150901896", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs150901896" }, { "id": "rs150901896", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs150901896" }, { "id": "rs150901896", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs150901896#frequency_tab" }, { "id": "rs150901896", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs150901896" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 366, "end_pos": 366, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DMS->NMS).", "chr_id": "11", "chr_pos": "63719598", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D366", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O95197", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95197" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 391, "end_pos": 391, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->Y).", "chr_id": "11", "chr_pos": "63719674", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "S391", "disease": [ { "disease_id": "DOID:1319", "recommended_name": { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain." }, "synonyms": [ { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "BT - Brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult malignant brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm, adult", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of Brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of adult brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary malignant neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "tumor of the Brain", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1210458133", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1210458133" }, { "id": "rs1210458133", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1210458133" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 396, "end_pos": 396, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->P).", "chr_id": "11", "chr_pos": "63719688", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T396", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1323524050", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1323524050" }, { "id": "rs1323524050", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1323524050#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 416, "end_pos": 416, "sequence_org": "I", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NAI->NAT).", "chr_id": "11", "chr_pos": "63719749", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I416", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1347911885", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1347911885" }, { "id": "rs1347911885", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1347911885" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 511, "end_pos": 511, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DTS->NTS).", "chr_id": "11", "chr_pos": "63720033", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D511", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs540444457", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs540444457" }, { "id": "rs540444457", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs540444457#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 526, "end_pos": 526, "sequence_org": "S", "sequence_mut": "C", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->C).", "chr_id": "11", "chr_pos": "63720079", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S526", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1013173070", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1013173070" }, { "id": "rs1013173070", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1013173070" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 706, "end_pos": 706, "sequence_org": "I", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (IGS->NGS).", "chr_id": "11", "chr_pos": "63720619", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I706", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1198370030", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1198370030" }, { "id": "rs1198370030", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1198370030#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 758, "end_pos": 758, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KST->NST).", "chr_id": "11", "chr_pos": "63720776", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K758", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1450820876", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1450820876" }, { "id": "rs1450820876", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1450820876#frequency_tab" }, { "id": "rs1450820876", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1450820876" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 919, "end_pos": 919, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DIT->NIT).", "chr_id": "11", "chr_pos": "63752523", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D919", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1237447467", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1237447467" }, { "id": "rs1237447467", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1237447467" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 934, "end_pos": 934, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NAA->NAT).", "chr_id": "11", "chr_pos": "63752568", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A934", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1211971903", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1211971903" }, { "id": "rs1211971903", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1211971903#frequency_tab" }, { "id": "rs1211971903", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1211971903" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 941, "end_pos": 941, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NRA->NRT).", "chr_id": "11", "chr_pos": "63752589", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A941", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "93.59", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000133318", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000133318" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "96.81", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000133318", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000133318" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "97.77", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000133318", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000133318" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "97.64", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000133318", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000133318" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "96.31", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000133318", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000133318" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "97.14", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000133318", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000133318" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "95.03", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000133318", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000133318" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "92.9", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000133318", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000133318" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "97.22", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000133318", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000133318" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O95197", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95197" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O95197", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95197" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O95197", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95197" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O95197", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95197" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O95197", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95197" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O95197", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95197" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O95197", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95197" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O95197", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95197" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O95197", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95197" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O95197", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95197" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O95197", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95197" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O95197", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95197" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "common_name": "Human" } ], "gene": [ { "name": "RTN3", "url": "https://www.uniprot.org/uniprot/O95197", "locus": { "chromosome": "11", "start_pos": 63759891, "end_pos": 63681446, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000133318", "url": "https://www.ensembl.org/id/ENSG00000133318" } ] } } ], "crossref": [ { "id": "ENSG00000133318", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000133318", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O95197", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O95197", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "RTN3", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=RTN3", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "10313", "url": "https://www.ncbi.nlm.nih.gov/gene/10313", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "10469", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=10469", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O95197", "url": "https://www.ebi.ac.uk/intact/interactors/id:O95197*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR003388", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003388", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046964", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046964", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:10313", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10313", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "604249", "url": "http://www.omim.org/entry/604249", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O95197", "url": "https://www.nextprot.org/entry/NX_O95197", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O95197", "url": "https://oglcnac.org/atlas/detail/O95197", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "O95197", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95197", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "TLWYLFE", "url": "https://omabrowser.org/oma/group/TLWYLFE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "7284at2759", "url": "http://www.orthodb.org/?query=7284at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR45799", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45799", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR45799:SF4", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45799:SF4", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "7BRU", "url": "https://www.rcsb.org/structure/7BRU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF02453", "url": "http://pfam.xfam.org/family/PF02453", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O95197", "url": "https://pharos.nih.gov/targets/O95197", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O95197", "url": "http://purl.obolibrary.org/obo/PR_O95197", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-8849932", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8849932", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001252518", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001252518", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "B7Z4M1", "url": "https://www.uniprot.org/uniprot/B7Z4M1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B7Z4M1-1", "url": "https://www.uniprot.org/uniprot/B7Z4M1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5GWG7", "url": "https://www.uniprot.org/uniprot/F5GWG7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5GWG7-1", "url": "https://www.uniprot.org/uniprot/F5GWG7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H617", "url": "https://www.uniprot.org/uniprot/F5H617", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H617-1", "url": "https://www.uniprot.org/uniprot/F5H617-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H891", "url": "https://www.uniprot.org/uniprot/F5H891", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H891-1", "url": "https://www.uniprot.org/uniprot/F5H891-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95197-1", "url": "https://www.uniprot.org/uniprot/O95197-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95197-2", "url": "https://www.uniprot.org/uniprot/O95197-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95197-3", "url": "https://www.uniprot.org/uniprot/O95197-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95197-4", "url": "https://www.uniprot.org/uniprot/O95197-4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95197-5", "url": "https://www.uniprot.org/uniprot/O95197-5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95197-6", "url": "https://www.uniprot.org/uniprot/O95197-6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95197-7", "url": "https://www.uniprot.org/uniprot/O95197-7", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCADSFVSSSSSQPVSLFSTSQEGLSSLCSDEPSSEIMTSSFLSSSEIHNTGLTILHGEKSHVLGSQPILAKEGKDHLDLLDMKKMEKPQGTSNNVSDSSVSLAAGVHCDRPSIPASFPEHPAFLSKKIGQVEEQIDKETKNPNGVSSREAKTALDADDRFTLLTAQKPPTEYSKVEGIYTYSLSPSKVSGDDVIEKDSPESPFEVIIDKAAFDKEFKDSYKESTDDFGSWSVHTDKESSEDISETNDKLFPLRNKEAGRYPMSALLSRQFSHTNAALEEVSRCVNDMHNFTNEILTWDLVPQVKQQTDKSSDCITKTTGLDMSEYNSEIPVVNLKTSTHQKTPVCSIDGSTPITKSTGDWAEASLQQENAITGKPVPDSLNSTKEFSIKGVQGNMQKQDDTLAELPGSPPEKCDSLGSGVATVKVVLPDDHLKDEMDWQSSALGEITEADSSGESDDTVIEDITADTSFENNKIQAEKPVSIPSAVVKTGEREIKEIPSCEREEKTSKNFEELVSDSELHQDQPDILGRSPASEAACSKVPDTNVSLEDVSEVAPEKPITTENPKLPSTVSPNVFNETEFSLNVTTSAYLESLHGKNVKHIDDSSPEDLIAAFTETRDKGIVDSERNAFKAISEKMTDFKTTPPVEVLHENESGGSEIKDIGSKYSEQSKETNGSEPLGVFPTQGTPVASLDLEQEQLTIKALKELGERQVEKSTSAQRDAELPSEEVLKQTFTFAPESWPQRSYDILERNVKNGSDLGISQKPITIRETTRVDAVSSLSKTELVKKHVLARLLTDFSVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKLPGIAKKKAE", "length": 1032, "header": "sp|O95197-1|RTN3_HUMAN Isoform 1 of Reticulon-3 OS=Homo sapiens OX=9606 GN=RTN3 PE=1 SV=2 CANONICAL=O95197-1" }, "isoforms": [ { "isoform_ac": "B7Z4M1-1", "url": "", "sequence": { "sequence": "MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGHPFNWLSSCG", "length": 123, "header": "tr|B7Z4M1-1|B7Z4M1_HUMAN Computationally mapped isoform of Reticulon OS=Homo sapiens OX=9606 GN=RTN3 PE=1 SV=1 CANONICAL=O95197-1" }, "locus": { "chromosome": "11", "start_pos": 63753087, "end_pos": 63681637, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000536011.5", "url": "https://www.ensembl.org/id/ENST00000536011.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000440960.1", "url": "https://www.ensembl.org/id/ENSP00000440960.1" } ] } }, { "isoform_ac": "F5GWG7-1", "url": "", "sequence": { "sequence": "MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCADSFVSSSSSQPVSLFSTSQASFPEHPAFLSKKIGQVEEQIDKETKNPNGVSSREAKTALDADDRFTLLTAQKPPTEYSKVEGIYTYSLS", "length": 136, "header": "tr|F5GWG7-1|F5GWG7_HUMAN Computationally mapped isoform of Reticulon 3 OS=Homo sapiens OX=9606 GN=RTN3 PE=1 SV=1 CANONICAL=O95197-1" }, "locus": { "chromosome": "11", "start_pos": 63719189, "end_pos": 63681637, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000545432.5", "url": "https://www.ensembl.org/id/ENST00000545432.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000441614.1", "url": "https://www.ensembl.org/id/ENSP00000441614.1" } ] } }, { "isoform_ac": "F5H617-1", "url": "", "sequence": { "sequence": "MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAESSLGSHFVPHPVSLLSFNLRIKIKRMHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLV", "length": 185, "header": "tr|F5H617-1|RTN3_HUMAN Computationally mapped isoform of Reticulon-3 OS=Homo sapiens OX=9606 GN=RTN3 PE=1 SV=1 CANONICAL=O95197-1" }, "locus": { "chromosome": "11", "start_pos": 63752633, "end_pos": 63681637, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000542238.5", "url": "https://www.ensembl.org/id/ENST00000542238.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000437971.1", "url": "https://www.ensembl.org/id/ENSP00000437971.1" } ] } }, { "isoform_ac": "F5H891-1", "url": "", "sequence": { "sequence": "MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAGVHCDRPSIPASFPEHPAFLSKKIGQVEEQIDKETKNPNGVSSREAKTALDADDRFTLLTAQKPPTEYSKVEGIYTYSLSPS", "length": 130, "header": "tr|F5H891-1|RTN3_HUMAN Computationally mapped isoform of Reticulon-3 OS=Homo sapiens OX=9606 GN=RTN3 PE=1 SV=1 CANONICAL=O95197-1" }, "locus": { "chromosome": "11", "start_pos": 63719195, "end_pos": 63681637, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000543552.5", "url": "https://www.ensembl.org/id/ENST00000543552.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000442080.1", "url": "https://www.ensembl.org/id/ENSP00000442080.1" } ] } }, { "isoform_ac": "O95197-1", "url": "", "sequence": { "sequence": "MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCADSFVSSSSSQPVSLFSTSQEGLSSLCSDEPSSEIMTSSFLSSSEIHNTGLTILHGEKSHVLGSQPILAKEGKDHLDLLDMKKMEKPQGTSNNVSDSSVSLAAGVHCDRPSIPASFPEHPAFLSKKIGQVEEQIDKETKNPNGVSSREAKTALDADDRFTLLTAQKPPTEYSKVEGIYTYSLSPSKVSGDDVIEKDSPESPFEVIIDKAAFDKEFKDSYKESTDDFGSWSVHTDKESSEDISETNDKLFPLRNKEAGRYPMSALLSRQFSHTNAALEEVSRCVNDMHNFTNEILTWDLVPQVKQQTDKSSDCITKTTGLDMSEYNSEIPVVNLKTSTHQKTPVCSIDGSTPITKSTGDWAEASLQQENAITGKPVPDSLNSTKEFSIKGVQGNMQKQDDTLAELPGSPPEKCDSLGSGVATVKVVLPDDHLKDEMDWQSSALGEITEADSSGESDDTVIEDITADTSFENNKIQAEKPVSIPSAVVKTGEREIKEIPSCEREEKTSKNFEELVSDSELHQDQPDILGRSPASEAACSKVPDTNVSLEDVSEVAPEKPITTENPKLPSTVSPNVFNETEFSLNVTTSAYLESLHGKNVKHIDDSSPEDLIAAFTETRDKGIVDSERNAFKAISEKMTDFKTTPPVEVLHENESGGSEIKDIGSKYSEQSKETNGSEPLGVFPTQGTPVASLDLEQEQLTIKALKELGERQVEKSTSAQRDAELPSEEVLKQTFTFAPESWPQRSYDILERNVKNGSDLGISQKPITIRETTRVDAVSSLSKTELVKKHVLARLLTDFSVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKLPGIAKKKAE", "length": 1032, "header": "sp|O95197-1|RTN3_HUMAN Isoform 1 of Reticulon-3 OS=Homo sapiens OX=9606 GN=RTN3 PE=1 SV=2 CANONICAL=O95197-1" }, "locus": { "chromosome": "11", "start_pos": 63758198, "end_pos": 63681637, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000377819.10", "url": "https://www.ensembl.org/id/ENST00000377819.10" }, { "database": "Ensembl Peptide", "id": "ENSP00000367050.5", "url": "https://www.ensembl.org/id/ENSP00000367050.5" } ] } }, { "isoform_ac": "O95197-2", "url": "", "sequence": { "sequence": "MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAEGLSSLCSDEPSSEIMTSSFLSSSEIHNTGLTILHGEKSHVLGSQPILAKEGKDHLDLLDMKKMEKPQGTSNNVSDSSVSLAAGVHCDRPSIPASFPEHPAFLSKKIGQVEEQIDKETKNPNGVSSREAKTALDADDRFTLLTAQKPPTEYSKVEGIYTYSLSPSKVSGDDVIEKDSPESPFEVIIDKAAFDKEFKDSYKESTDDFGSWSVHTDKESSEDISETNDKLFPLRNKEAGRYPMSALLSRQFSHTNAALEEVSRCVNDMHNFTNEILTWDLVPQVKQQTDKSSDCITKTTGLDMSEYNSEIPVVNLKTSTHQKTPVCSIDGSTPITKSTGDWAEASLQQENAITGKPVPDSLNSTKEFSIKGVQGNMQKQDDTLAELPGSPPEKCDSLGSGVATVKVVLPDDHLKDEMDWQSSALGEITEADSSGESDDTVIEDITADTSFENNKIQAEKPVSIPSAVVKTGEREIKEIPSCEREEKTSKNFEELVSDSELHQDQPDILGRSPASEAACSKVPDTNVSLEDVSEVAPEKPITTENPKLPSTVSPNVFNETEFSLNVTTSAYLESLHGKNVKHIDDSSPEDLIAAFTETRDKGIVDSERNAFKAISEKMTDFKTTPPVEVLHENESGGSEIKDIGSKYSEQSKETNGSEPLGVFPTQGTPVASLDLEQEQLTIKALKELGERQVEKSTSAQRDAELPSEEVLKQTFTFAPESWPQRSYDILERNVKNGSDLGISQKPITIRETTRVDAVSSLSKTELVKKHVLARLLTDFSVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKLPGIAKKKAE", "length": 1013, "header": "sp|O95197-2|RTN3_HUMAN Isoform 2 of Reticulon-3 OS=Homo sapiens OX=9606 GN=RTN3 PE=1 SV=2 CANONICAL=O95197-1" }, "locus": { "chromosome": "11", "start_pos": 63758198, "end_pos": 63681637, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000339997.8", "url": "https://www.ensembl.org/id/ENST00000339997.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000344106.4", "url": "https://www.ensembl.org/id/ENSP00000344106.4" } ] } }, { "isoform_ac": "O95197-3", "url": "", "sequence": { "sequence": "MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKLPGIAKKKAE", "length": 236, "header": "sp|O95197-3|RTN3_HUMAN Isoform 3 of Reticulon-3 OS=Homo sapiens OX=9606 GN=RTN3 PE=1 SV=2 CANONICAL=O95197-1" }, "locus": { "chromosome": "11", "start_pos": 63758198, "end_pos": 63681637, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000537981.5", "url": "https://www.ensembl.org/id/ENST00000537981.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000440874.1", "url": "https://www.ensembl.org/id/ENSP00000440874.1" } ] } }, { "isoform_ac": "O95197-4", "url": "", "sequence": { "sequence": "MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCADSFVSSSSSQPVSLFSTSQVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKLPGIAKKKAE", "length": 255, "header": "sp|O95197-4|RTN3_HUMAN Isoform 4 of Reticulon-3 OS=Homo sapiens OX=9606 GN=RTN3 PE=1 SV=2 CANONICAL=O95197-1" }, "locus": { "chromosome": "11", "start_pos": 63758198, "end_pos": 63681637, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000356000.7", "url": "https://www.ensembl.org/id/ENST00000356000.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000348279.3", "url": "https://www.ensembl.org/id/ENSP00000348279.3" } ] } }, { "isoform_ac": "O95197-5", "url": "", "sequence": { "sequence": "MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKDPSKTPWNRQKKGRISTWKPEMQQLLKHHLIVITSLLVL", "length": 241, "header": "sp|O95197-5|RTN3_HUMAN Isoform 5 of Reticulon-3 OS=Homo sapiens OX=9606 GN=RTN3 PE=1 SV=2 CANONICAL=O95197-1" }, "locus": { "chromosome": "11", "start_pos": 63758272, "end_pos": 63681637, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000341307.6", "url": "https://www.ensembl.org/id/ENST00000341307.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000340903.2", "url": "https://www.ensembl.org/id/ENSP00000340903.2" } ] } }, { "isoform_ac": "O95197-6", "url": "", "sequence": { "sequence": "MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKPRLITMLASPEIRPSQLLKRSKQNSLESPKKRQNKYMETRNATVTKTPFNSYNVVTCTMKENTQCQLEPAFQAFFLIWCFLPSFPFNPQYQAQKLMD", "length": 214, "header": "sp|O95197-6|RTN3_HUMAN Isoform 6 of Reticulon-3 OS=Homo sapiens OX=9606 GN=RTN3 PE=1 SV=2 CANONICAL=O95197-1" }, "locus": { "chromosome": "11", "start_pos": 63758388, "end_pos": 63681637, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000354497.4", "url": "https://www.ensembl.org/id/ENST00000354497.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000346492.4", "url": "https://www.ensembl.org/id/ENSP00000346492.4" } ] } }, { "isoform_ac": "O95197-7", "url": "", "sequence": { "sequence": "MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAASFPEHPAFLSKKIGQVEEQIDKETKNPNGVSSREAKTALDADDRFTLLTAQKPPTEYSKVEGIYTYSLSPSKVSGDDVIEKDSPESPFEVIIDKAAFDKEFKDSYKESTDDFGSWSVHTDKESSEDISETNDKLFPLRNKEAGRYPMSALLSRQFSHTNAALEEVSRCVNDMHNFTNEILTWDLVPQVKQQTDKSSDCITKTTGLDMSEYNSEIPVVNLKTSTHQKTPVCSIDGSTPITKSTGDWAEASLQQENAITGKPVPDSLNSTKEFSIKGVQGNMQKQDDTLAELPGSPPEKCDSLGSGVATVKVVLPDDHLKDEMDWQSSALGEITEADSSGESDDTVIEDITADTSFENNKIQAEKPVSIPSAVVKTGEREIKEIPSCEREEKTSKNFEELVSDSELHQDQPDILGRSPASEAACSKVPDTNVSLEDVSEVAPEKPITTENPKLPSTVSPNVFNETEFSLNVTTSAYLESLHGKNVKHIDDSSPEDLIAAFTETRDKGIVDSERNAFKAISEKMTDFKTTPPVEVLHENESGGSEIKDIGSKYSEQSKETNGSEPLGVFPTQGTPVASLDLEQEQLTIKALKELGERQVEKSTSAQRDAELPSEEVLKQTFTFAPESWPQRSYDILERNVKNGSDLGISQKPITIRETTRVDAVSSLSKTELVKKHVLARLLTDFSVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKLPGIAKKKAE", "length": 920, "header": "sp|O95197-7|RTN3_HUMAN Isoform 7 of Reticulon-3 OS=Homo sapiens OX=9606 GN=RTN3 PE=1 SV=2 CANONICAL=O95197-1" }, "locus": { "chromosome": "11", "start_pos": 63758198, "end_pos": 63681637, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000540798.5", "url": "https://www.ensembl.org/id/ENST00000540798.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000442733.1", "url": "https://www.ensembl.org/id/ENSP00000442733.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 234, "start_aa": "Ser", "end_pos": 234, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser234", "evidence": [ { "id": "O95197", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95197" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 391, "start_aa": "Ser", "end_pos": 391, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser391", "evidence": [ { "id": "O95197", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95197" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "O95197", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O95197" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 396, "start_aa": "Thr", "end_pos": 396, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr396", "evidence": [ { "id": "O95197", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95197" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 399, "start_aa": "Thr", "end_pos": 399, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr399", "evidence": [ { "id": "O95197", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95197" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "O95197", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O95197" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 526, "start_aa": "Ser", "end_pos": 526, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser526", "evidence": [ { "id": "O95197", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95197" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "O95197", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O95197" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 678, "start_aa": "Ser", "end_pos": 678, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser678", "evidence": [ { "id": "O95197", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95197" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "O95197", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O95197" } ] } ], "phosphorylation": [ { "start_pos": 229, "end_pos": 229, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O95197", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95197" } ], "site_lbl": "Ser229" }, { "start_pos": 243, "end_pos": 243, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "site_lbl": "Ser243" }, { "start_pos": 246, "end_pos": 246, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O95197", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95197" } ], "site_lbl": "Ser246" }, { "start_pos": 283, "end_pos": 283, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "site_lbl": "Ser283" }, { "start_pos": 30, "end_pos": 30, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "phospho.ELM", "id": "O95197", "url": "http://phospho.elm.eu.org/byAccession/O95197.html" }, { "database": "iPTMnet", "id": "O95197", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95197" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Ser30" }, { "start_pos": 316, "end_pos": 316, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O95197", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95197" } ], "site_lbl": "Ser316" }, { "start_pos": 453, "end_pos": 453, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O95197", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95197" } ], "site_lbl": "Ser453" }, { "start_pos": 649, "end_pos": 649, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "O95197", "url": "http://phospho.elm.eu.org/byAccession/O95197.html" }, { "database": "iPTMnet", "id": "O95197", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95197" } ], "site_lbl": "Ser649" }, { "start_pos": 650, "end_pos": 650, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "O95197", "url": "http://phospho.elm.eu.org/byAccession/O95197.html" }, { "database": "iPTMnet", "id": "O95197", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95197" } ], "site_lbl": "Ser650" }, { "start_pos": 735, "end_pos": 735, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "site_lbl": "Ser735" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Cloning of a novel member of the reticulon gene family (RTN3): gene structure and chromosomal localization to 11q13.", "journal": "Genomics", "date": "1999", "authors": "Moreira E F, Jaworski C J, Rodriguez I R", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "reference": [ { "type": "PubMed", "id": "10331947", "url": "https://glygen.org/publication/PubMed/10331947" } ] }, { "title": "Pro-apoptotic ASY/Nogo-B protein associates with ASYIP.", "journal": "J. Cell. Physiol.", "date": "2003", "authors": "Qi B, Qi Y, Watari A, Yoshioka N, Inoue H, Minemoto Y, Yamashita K, Sasagawa T, Yutsudo M", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" }, { "database": "RefSeq", "id": "NP_001252518", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001252518" } ], "reference": [ { "type": "PubMed", "id": "12811824", "url": "https://glygen.org/publication/PubMed/12811824" } ] }, { "title": "A reticular rhapsody: phylogenic evolution and nomenclature of the RTN/Nogo gene family.", "journal": "FASEB J.", "date": "2003", "authors": "Oertle T, Klinger M, Stuermer CA, Schwab ME", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "reference": [ { "type": "PubMed", "id": "12832288", "url": "https://glygen.org/publication/PubMed/12832288" } ] }, { "title": "Overexpression of human reticulon 3 (hRTN3) in astrocytoma.", "journal": "Clin. Neuropathol.", "date": "2004", "authors": "Huang X, Yang H, Zhou Y, Liu J, Yin B, Peng X, Qiang B, Yuan J", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "reference": [ { "type": "PubMed", "id": "14986927", "url": "https://glygen.org/publication/PubMed/14986927" } ] }, { "title": "Reticulon family members modulate BACE1 activity and amyloid-beta peptide generation.", "journal": "Nature medicine", "date": "2004-09", "authors": "He Wanxia, Lu Yifeng, Qahwash Isam, Hu Xiang-You, Chang Ansi, Yan Riqiang", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "reference": [ { "type": "PubMed", "id": "15286784", "url": "https://glygen.org/publication/PubMed/15286784" } ] }, { "title": "Tissue specificity and regulation of the N-terminal diversity of reticulon 3.", "journal": "Biochem. J.", "date": "2005", "authors": "Di Scala F, Dupuis L, Gaiddon C, De Tapia M, Jokic N, Gonzalez de Aguilar JL, Raul JS, Ludes B, Loeffler JP", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "reference": [ { "type": "PubMed", "id": "15350194", "url": "https://glygen.org/publication/PubMed/15350194" } ] }, { "title": "Identification of a new RTN3 transcript, RTN3-A1, and its distribution in adult mouse brain.", "journal": "Brain Res. Mol. Brain Res.", "date": "2005", "authors": "Cai Y, Saiyin H, Lin Q, Zhang P, Tang L, Pan X, Yu L", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "reference": [ { "type": "PubMed", "id": "15946766", "url": "https://glygen.org/publication/PubMed/15946766" } ] }, { "title": "Reticulon 3 is involved in membrane trafficking between the endoplasmic reticulum and Golgi.", "journal": "Biochemical and biophysical research communications", "date": "2005-09-09", "authors": "Wakana Yuichi, Koyama Satoshi, Nakajima Ken-ichi, Hatsuzawa Kiyotaka, Nagahama Masami, Tani Katsuko, Hauri Hans-Peter, Melan\u00e7on Paul, Tagaya Mitsuo", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "reference": [ { "type": "PubMed", "id": "16054885", "url": "https://glygen.org/publication/PubMed/16054885" } ] }, { "title": "Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.", "journal": "DNA Res.", "date": "2005", "authors": "Otsuki T, Ota T, Nishikawa T, Hayashi K, Suzuki Y, Yamamoto J, Wakamatsu A, Kimura K, Sakamoto K, Hatano N, Kawai Y, Ishii S, Saito K, Kojima S, Sugiyama T, Ono T, Okano K, Yoshikawa Y, Aotsuka S, Sasaki N, Hattori A, Okumura K, Nagai K, Sugano S, Isogai T", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "reference": [ { "type": "PubMed", "id": "16303743", "url": "https://glygen.org/publication/PubMed/16303743" } ] }, { "title": "A novel family of adhesion-like molecules that interacts with the NMDA receptor.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2006", "authors": "Wang CY, Chang K, Petralia RS, Wang YX, Seabold GK, Wenthold RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8849932", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8849932" } ], "reference": [ { "type": "PubMed", "id": "16495444", "url": "https://glygen.org/publication/PubMed/16495444" } ] }, { "title": "SALM synaptic cell adhesion-like molecules regulate the differentiation of excitatory synapses.", "journal": "Neuron", "date": "2006", "authors": "Ko J, Kim S, Chung HS, Kim K, Han K, Kim H, Jun H, Kaang BK, Kim E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8849932", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8849932" } ], "reference": [ { "type": "PubMed", "id": "16630835", "url": "https://glygen.org/publication/PubMed/16630835" } ] }, { "title": "Reticulons RTN3 and RTN4-B/C interact with BACE1 and inhibit its ability to produce amyloid beta-protein.", "journal": "Eur. J. Neurosci.", "date": "2006", "authors": "Murayama Kiyoko S, Kametani Fuyuki, Saito Shinya, Kume Hideaki, Akiyama Haruhiko, Araki Wataru", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "reference": [ { "type": "PubMed", "id": "16965550", "url": "https://glygen.org/publication/PubMed/16965550" } ] }, { "title": "Mapping of interaction domains mediating binding between BACE1 and RTN/Nogo proteins.", "journal": "J. Mol. Biol.", "date": "2006", "authors": "He Wanxia, Hu Xiangyou, Shi Qi, Zhou Xiangdong, Lu Yifeng, Fisher Christopher, Yan Riqiang", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "reference": [ { "type": "PubMed", "id": "16979658", "url": "https://glygen.org/publication/PubMed/16979658" } ] }, { "title": "Adaptor FADD is recruited by RTN3/HAP in ER-bound signaling complexes.", "journal": "Apoptosis : an international journal on programmed cell death", "date": "2006-11", "authors": "Xiang Rong, Liu Yingle, Zhu Lei, Dong Wei, Qi Yipeng", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "reference": [ { "type": "PubMed", "id": "17031492", "url": "https://glygen.org/publication/PubMed/17031492" } ] }, { "title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.", "journal": "Cell", "date": "2006", "authors": "Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" }, { "database": "iPTMnet", "id": "O95197", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95197" } ], "reference": [ { "type": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ] }, { "title": "Reticulon 3 binds the 2C protein of enterovirus 71 and is required for viral replication.", "journal": "The Journal of biological chemistry", "date": "2007-02-23", "authors": "Tang Wen-Fang, Yang Shing-Ying, Wu Bin-Wen, Jheng Jia-Rong, Chen Yin-Li, Shih Chung-Hsuan, Lin Kwang-Huei, Lai Hsin-Chi, Tang Petrus, Horng Jim-Tong", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "reference": [ { "type": "PubMed", "id": "17182608", "url": "https://glygen.org/publication/PubMed/17182608" } ] }, { "title": "Reticulon 3 mediates Bcl-2 accumulation in mitochondria in response to endoplasmic reticulum stress.", "journal": "Apoptosis : an international journal on programmed cell death", "date": "2007-02", "authors": "Wan Qingwen, Kuang Ersheng, Dong Wei, Zhou Shumin, Xu Hua, Qi Yipeng, Liu Yingle", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "reference": [ { "type": "PubMed", "id": "17191123", "url": "https://glygen.org/publication/PubMed/17191123" } ] }, { "title": "The membrane topology of RTN3 and its effect on binding of RTN3 to BACE1.", "journal": "J. Biol. Chem.", "date": "2007", "authors": "He Wanxia, Shi Qi, Hu Xiangyou, Yan Riqiang", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "reference": [ { "type": "PubMed", "id": "17699523", "url": "https://glygen.org/publication/PubMed/17699523" } ] }, { "title": "The SALM family of adhesion-like molecules forms heteromeric and homomeric complexes.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Seabold GK, Wang PY, Chang K, Wang CY, Wang YX, Petralia RS, Wenthold RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8849932", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8849932" } ], "reference": [ { "type": "PubMed", "id": "18227064", "url": "https://glygen.org/publication/PubMed/18227064" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" }, { "database": "iPTMnet", "id": "O95197", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95197" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "A class of dynamin-like GTPases involved in the generation of the tubular ER network.", "journal": "Cell", "date": "2009", "authors": "Hu J, Shibata Y, Zhu PP, Voss C, Rismanchi N, Prinz WA, Rapoport TA, Blackstone C", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "reference": [ { "type": "PubMed", "id": "19665976", "url": "https://glygen.org/publication/PubMed/19665976" } ] }, { "title": "Reticulon 3 is an interacting partner of the SALM family of adhesion molecules.", "journal": "Journal of neuroscience research", "date": "2010", "authors": "Chang K, Seabold GK, Wang CY, Wenthold RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8849932", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8849932" } ], "reference": [ { "type": "PubMed", "id": "19681166", "url": "https://glygen.org/publication/PubMed/19681166" } ] }, { "title": "Flotillin-1 mediates neurite branching induced by synaptic adhesion-like molecule 4 in hippocampal neurons.", "journal": "Molecular and cellular neurosciences", "date": "2010", "authors": "Swanwick CC, Shapiro ME, Vicini S, Wenthold RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8849932", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8849932" } ], "reference": [ { "type": "PubMed", "id": "20600927", "url": "https://glygen.org/publication/PubMed/20600927" } ] }, { "title": "Protrudin serves as an adaptor molecule that connects KIF5 and its cargoes in vesicular transport during process formation.", "journal": "Mol. Biol. Cell", "date": "2011", "authors": "Matsuzaki F, Shirane M, Matsumoto M, Nakayama KI", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "reference": [ { "type": "PubMed", "id": "21976701", "url": "https://glygen.org/publication/PubMed/21976701" } ] }, { "title": "Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-alpha-acetylation features.", "journal": "Molecular & cellular proteomics : MCP", "date": "2012", "authors": "Bienvenut WV, Sumpton D, Martinez A, Lilla S, Espagne C, Meinnel T, Giglione C", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "reference": [ { "type": "PubMed", "id": "22223895", "url": "https://glygen.org/publication/PubMed/22223895" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" }, { "database": "iPTMnet", "id": "O95197", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95197" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Arl6IP1 has the ability to shape the mammalian ER membrane in a reticulon-like fashion.", "journal": "Biochem. J.", "date": "2014", "authors": "Yamamoto Yasunori, Yoshida Asuka, Miyazaki Naoyuki, Iwasaki Kenji, Sakisaka Toshiaki", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "reference": [ { "type": "PubMed", "id": "24262037", "url": "https://glygen.org/publication/PubMed/24262037" } ] }, { "title": "Identification and characterization of TMEM33 as a reticulon-binding protein.", "journal": "The Kobe journal of medical sciences", "date": "2014-11-06", "authors": "Urade Takeshi, Yamamoto Yasunori, Zhang Xia, Ku Yonson, Sakisaka Toshiaki", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "reference": [ { "type": "PubMed", "id": "25612671", "url": "https://glygen.org/publication/PubMed/25612671" } ] }, { "title": "Splicing-Dependent Trans-synaptic SALM3-LAR-RPTP Interactions Regulate Excitatory Synapse Development and Locomotion.", "journal": "Cell reports", "date": "2015", "authors": "Li Y, Zhang P, Choi TY, Park SK, Park H, Lee EJ, Lee D, Roh JD, Mah W, Kim R, Kim Y, Kwon H, Bae YC, Choi SY, Craig AM, Kim E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8849932", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8849932" } ], "reference": [ { "type": "PubMed", "id": "26321637", "url": "https://glygen.org/publication/PubMed/26321637" } ] }, { "title": "Quantitative proteomics identifies altered O-GlcNAcylation of structural, synaptic and memory-associated proteins in Alzheimer's disease.", "journal": "The Journal of pathology", "date": "2017", "authors": "Wang S, Yang F, Petyuk VA, Shukla AK, Monroe ME, Gritsenko MA, Rodland KD, Smith RD, Qian WJ, Gong CX, Liu T", "evidence": [ { "database": "O-GlcNAc Database", "id": "O95197", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95197" }, { "database": "O-GlcNAc Atlas", "id": "O95197", "url": "https://oglcnac.org/atlas/detail/O95197" } ], "reference": [ { "type": "PubMed", "id": "28657654", "url": "https://glygen.org/publication/PubMed/28657654" } ] }, { "title": "The host protein reticulon 3.1A is utilized by flaviviruses to facilitate membrane remodelling.", "journal": "Cell Rep.", "date": "2017", "authors": "Aktepe Turgut E, Liebscher Susann, Prier Julia E, Simmons Cameron P, Mackenzie Jason M", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "reference": [ { "type": "PubMed", "id": "29117567", "url": "https://glygen.org/publication/PubMed/29117567" } ] }, { "title": "Mapping and Quantification of Over 2000 O-linked Glycopeptides in Activated Human T Cells with Isotope-Targeted Glycoproteomics (Isotag).", "journal": "Molecular & cellular proteomics : MCP", "date": "2018", "authors": "Woo CM, Lund PJ, Huang AC, Davis MM, Bertozzi CR, Pitteri SJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "O95197", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95197" }, { "database": "O-GlcNAc Atlas", "id": "O95197", "url": "https://oglcnac.org/atlas/detail/O95197" } ], "reference": [ { "type": "PubMed", "id": "29351928", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "title": "Super-assembly of ER-phagy receptor Atg40 induces local ER remodeling at contacts with forming autophagosomal membranes.", "journal": "Nat. Commun.", "date": "2020", "authors": "Mochida Keisuke, Yamasaki Akinori, Matoba Kazuaki, Kirisako Hiromi, Noda Nobuo N, Nakatogawa Hitoshi", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "reference": [ { "type": "PubMed", "id": "32620754", "url": "https://glygen.org/publication/PubMed/32620754" } ] }, { "title": "A new tandem enrichment strategy for the simultaneous profiling of O-GlcNAcylation and phosphorylation in RNA-binding proteome.", "journal": "The Analyst", "date": "2021", "authors": "Fan Z, Li J, Liu T, Zhang Z, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "O95197", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95197" }, { "database": "O-GlcNAc Atlas", "id": "O95197", "url": "https://oglcnac.org/atlas/detail/O95197" } ], "reference": [ { "type": "PubMed", "id": "33465208", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "title": "LINC02288 promotes chondrocyte apoptosis and inflammation through miR-374a-3p targeting RTN3.", "journal": "The journal of gene medicine", "date": "2021", "authors": "Fu Q, Zhu J, Wang B, Wu J, Li H, Han Y, Xiang D, Chen Y, Li L", "evidence": [ { "database": "RefSeq", "id": "NP_001252518", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001252518" } ], "reference": [ { "type": "PubMed", "id": "33491257", "url": "https://glygen.org/publication/PubMed/33491257" } ] }, { "title": "The Implication of Reticulons (RTNs) in Neurodegenerative Diseases: From Molecular Mechanisms to Potential Diagnostic and Therapeutic Approaches.", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Kulczynska-Przybik A, Mroczko P, Dulewicz M, Mroczko B", "evidence": [ { "database": "RefSeq", "id": "NP_001252518", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001252518" } ], "reference": [ { "type": "PubMed", "id": "33924890", "url": "https://glygen.org/publication/PubMed/33924890" } ] }, { "title": "RTN3 inhibits RIG-I-mediated antiviral responses by impairing TRIM25-mediated K63-linked polyubiquitination.", "journal": "eLife", "date": "2021", "authors": "Yang Z, Wang J, He B, Zhang X, Li X, Kuang E", "evidence": [ { "database": "RefSeq", "id": "NP_001252518", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001252518" } ], "reference": [ { "type": "PubMed", "id": "34313226", "url": "https://glygen.org/publication/PubMed/34313226" } ] }, { "title": "O-GlcNAcylation promotes fatty acid synthase activity under nutritional stress as a pro-survival mechanism in cancer cells.", "journal": "Proteomics", "date": "2022", "authors": "Wong YK, Wang J, Lim TK, Lin Q, Yap CT, Shen HM", "evidence": [ { "database": "O-GlcNAc Database", "id": "O95197", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95197" } ], "reference": [ { "type": "PubMed", "id": "35083852", "url": "https://glygen.org/publication/PubMed/35083852" } ] }, { "title": "Loss of RTN3 phenocopies chronic kidney disease and results in activation of the IGF2-JAK2 pathway in proximal tubular epithelial cells.", "journal": "Experimental & molecular medicine", "date": "2022", "authors": "Fan LL, Du R, Liu JS, Jin JY, Wang CY, Dong Y, He WX, Yan RQ, Xiang R", "evidence": [ { "database": "RefSeq", "id": "NP_001252518", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001252518" } ], "reference": [ { "type": "PubMed", "id": "35596061", "url": "https://glygen.org/publication/PubMed/35596061" } ] }, { "title": "RTN3 and RTN4: Architects of SARS-CoV-2 replication organelles.", "journal": "The Journal of cell biology", "date": "2023-07-03", "authors": "Kratzel Annika, Thiel Volker", "evidence": [ { "database": "RefSeq", "id": "NP_001252518", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001252518" } ], "reference": [ { "type": "PubMed", "id": "37318453", "url": "https://glygen.org/publication/PubMed/37318453" } ] }, { "title": "Studying the O-GlcNAcome of human placentas using banked tissue samples.", "journal": "Glycobiology", "date": "2024-01-22", "authors": "Luna Sarai, Malard Florian, Pereckas Michaela, Aoki Mayumi, Aoki Kazahiro, Olivier-Van Stichelen Stephanie", "evidence": [ { "database": "O-GlcNAc Database", "id": "O95197", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95197" } ], "reference": [ { "type": "PubMed", "id": "38253038", "url": "https://glygen.org/publication/PubMed/38253038" } ] }, { "title": "Domain interaction between NMDA receptor subunits and the postsynaptic density protein PSD-95.", "journal": "Science (New York, N.Y.)", "date": "1995", "authors": "Kornau HC, Schenker LT, Kennedy MB, Seeburg PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8849932", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8849932" } ], "reference": [ { "type": "PubMed", "id": "7569905", "url": "https://glygen.org/publication/PubMed/7569905" } ] }, { "title": "Interaction between the C terminus of NMDA receptor subunits and multiple members of the PSD-95 family of membrane-associated guanylate kinases.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "1996", "authors": "Niethammer M, Kim E, Sheng M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8849932", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8849932" } ], "reference": [ { "type": "PubMed", "id": "8601796", "url": "https://glygen.org/publication/PubMed/8601796" } ] } ], "pathway": [ { "id": "hsa:10313", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10313", "resource": "KEGG Pathway" }, { "id": "R-HSA-8849932", "name": "Synaptic adhesion-like molecules", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8849932", "resource": "Reactome", "description": "Synaptic adhesion-like molecules" } ], "orthologs": [ { "uniprot_canonical_ac": "Q6RJR6-1", "protein_name": "Reticulon-3", "gene_name": "Rtn3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAESSAATQSPSVSSSSSGAEPSTLGGGGGSPGACPALGAKSCGSSCAVGLSSLCSDEPPSKIMTSSFLSSSEIYNPDPTTPLGSETLGSHLVAKDGKDPLVLLDKKTLDSPQGTNKDRVDTPVSLAADIPCSHPSIPDSFPEQPTFLSKETDPTEEWVVKNQEPKNPSEVPSGEDRSALDLGQRKAEHICTHSLSPSEPAVASVEKDSPESPFEVIIDKATFDREFKDLYKESTDDLGGWAAHGDRESPADLLEMNDKVFPLRNKEAGRYPSSALLGRQFSHTTAALEEVSRCVNDMHNFTNEILTWDLDPQAKQQADKSPCTTESTGLDRSEHRSEIPVINLKTSPQQKMPVCSFNGSTPITRSTGDWTETFTEGKPVKGYLSSTKEAGGKGVPDSSQPISGSGAATVEVTLPDLRGTWPNSVLGEVTEVDSSGESDDTVIEDTTENPSVKNNKVLPEKSDSLPSAAVKTSERENKETTSHETVRSEMYENSEQQQAHAETPTQRSLEGQMSPQVPNMLNEVIPENLAMTDTTRVCSAAPPSVLSETGFSLTVPASAKSESLLGKNVEDTDGSSPEDLMAALTGTEEKGTVDKEKGDVLEAVLEKIANVKNTLPVELLHENKLSSSETKNTKSKYSEHSRETNGGAPKVSSDLEQEQLTIRAIKELGAKQVQAERMSPGGKLKRTFDPQSGPQNSSDILEHTDITTGSDLGIPKKPTIIKDTRIDSISSLTKTETVNKHVLARLLSDFPVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRVYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHSYMNAAMVHVNKALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLVFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKLPGIAKKKAE", "length": 940 }, "evidence": [ { "id": "45920593", "url": "http://www.informatics.jax.org/homology/45920593", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9ES97-1", "protein_name": "Reticulon-3", "gene_name": "Rtn3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAESSAATQSPSVSSSSSGAEPSALGGGGGSPGACPALGAKSCGSSCADSFVSSSSSQPVSIFSTSQAGLSSLCSDEPPSKSMTSSFLSSSEIHNPDPTTPLGEKSETLGSQFVLAKGKDPLVLLDKKKLDSPQGTNKDRVDAPVSLATGIPCSHPSIPDSFPEQPAFLSKEIGPAEEWVVKDQEPKNPNKVPDGEDRSALDFGQSKAEHICTYSLSPSELPVASVEKDSPESPFEVIIDKATFDREFKDLYKENPNDLGGWAAHGDRESPADLLEMNDKLFPLRNKEAGRYPSSVLLGRQFSHTTAALEEVSRCVNDMHNFTNEILTWDLDPQAKQQANKTSCTTESTGLDRSELRSEIPVINLKTNPQQKMPVCSFNGSTPITKSTGDWTEAFTEGKPVRDYLSSTKEAGGNGVPGSSQLHSELPGSMPEKWVSGSGAATVEVTLPNLRGAWPNSVMGEVTEVDSSGESDDTVIEDITEKPDSLPSAAAKTSEREIKETPSRETVRSEMCENSEQPQAQPETPTQKSLEGEVASQVPNTLNEVTPEKLDMTNNPKVCSAAPPSVLNETGFSLTVPASAKLESLLGKYVEDTDGSSPEDLMAVLTGAEEKGIVDKEEGDVLEAVLEKIADFKNTLPVELLHESELSGSETKNIKSKYSEDSRETTGGAPTMSPDLEQEQLTIRAIKELGERQAEKVQDEGISSGGKLKQTFAPQSGPQSSSDILEHTDVKTGSDLGIPKNPTIIKNTRIDSISSLTKTEMVNKNVLARLLSDFPVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRVYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHVNKALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLVFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKLPGIAKKKAE", "length": 964 }, "evidence": [ { "id": "45920593", "url": "http://www.informatics.jax.org/homology/45920593", "database": "MGI" }, { "id": "O95197", "url": "https://omabrowser.org/oma/group/O95197/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 8, "go_terms": [ { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "pmid": "" }, { "name": "Golgi membrane", "id": "GO:0000139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000139", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "pmid": "" }, { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "pmid": "" }, { "name": "postsynaptic density", "id": "GO:0014069", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014069", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "pmid": "" }, { "name": "neuron projection", "id": "GO:0043005", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043005", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "endoplasmic reticulum tubular network organization", "id": "GO:0071786", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071786", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "pmid": "" }, { "name": "apoptotic process", "id": "GO:0006915", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006915", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "pmid": "" }, { "name": "negative regulation of amyloid-beta formation", "id": "GO:1902430", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902430", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "pmid": "" }, { "name": "brain development", "id": "GO:0007420", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007420", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "pmid": "" }, { "name": "neuron differentiation", "id": "GO:0030182", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030182", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "pmid": "" }, { "name": "vesicle-mediated transport", "id": "GO:0016192", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016192", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "pmid": "" }, { "name": "endoplasmic reticulum tubular network formation", "id": "GO:0071787", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071787", "evidence": [ { "database": "UniProtKB", "id": "O95197", "url": "https://www.uniprot.org/uniprot/O95197" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 139, "end_pos": 141, "annotation": "n_glycosylation_sequon" }, { "start_pos": 334, "end_pos": 336, "annotation": "n_glycosylation_sequon" }, { "start_pos": 426, "end_pos": 428, "annotation": "n_glycosylation_sequon" }, { "start_pos": 589, "end_pos": 591, "annotation": "n_glycosylation_sequon" }, { "start_pos": 621, "end_pos": 623, "annotation": "n_glycosylation_sequon" }, { "start_pos": 628, "end_pos": 630, "annotation": "n_glycosylation_sequon" }, { "start_pos": 696, "end_pos": 698, "annotation": "n_glycosylation_sequon" }, { "start_pos": 718, "end_pos": 720, "annotation": "n_glycosylation_sequon" }, { "start_pos": 799, "end_pos": 801, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 234, 391, 396, 399, 526, 678 ], "snv_sites": [ 234, 332, 353, 366, 391, 396, 416, 511, 526, 706, 758, 919, 934, 941 ], "glycation_sites": [], "phosphorylation_sites": [ 30, 229, 243, 246, 283, 316, 453, 649, 650, 735 ], "sequon_annotation_sites": [ { "start_pos": 139, "end_pos": 141 }, { "start_pos": 334, "end_pos": 336 }, { "start_pos": 426, "end_pos": 428 }, { "start_pos": 589, "end_pos": 591 }, { "start_pos": 621, "end_pos": 623 }, { "start_pos": 628, "end_pos": 630 }, { "start_pos": 696, "end_pos": 698 }, { "start_pos": 718, "end_pos": 720 }, { "start_pos": 799, "end_pos": 801 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 6 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 6 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 10 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 16 }, { "field": "total_sites", "count": 14 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 14 }, { "field": "total_sites", "count": 13 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 43 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }