{ "uniprot_canonical_ac": "O95067-1", "uniprot_ac": "O95067", "uniprot_id": "CCNB2_HUMAN", "mass": { "chemical_mass": 45282.0, "monoisotopic_mass": 45282.0 }, "refseq": { "ac": "NP_004692", "name": "G2/mitotic-specific cyclin-B2", "summary": "Cyclin B2 is a member of the cyclin family, specifically the B-type cyclins. The B-type cyclins, B1 and B2, associate with p34cdc2 and are essential components of the cell cycle regulatory machinery. B1 and B2 differ in their subcellular localization. Cyclin B1 co-localizes with microtubules, whereas cyclin B2 is primarily associated with the Golgi region. Cyclin B2 also binds to transforming growth factor beta RII and thus cyclin B2/cdc2 may play a key role in transforming growth factor beta-mediated cell cycle control. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004692" }, "gene_names": [ { "name": "CCNB2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O95067", "id": "O95067" }, { "name": "CCNB2V", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O95067", "id": "O95067" }, { "name": "CCNB2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004692", "id": "NP_004692" }, { "name": "HsT17299", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004692", "id": "NP_004692" } ], "protein_names": [ { "name": "G2/mitotic-specific cyclin-B2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O95067" }, { "name": "G2/mitotic-specific cyclin-B2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004692", "id": "NP_004692" } ], "function": [ { "annotation": "CRHBP is degraded via autophagy and exerts anti-hepatocellular carcinoma effects by reducing cyclin B2 expression and dissociating cyclin B2-CDK1 complex.", "evidence": [ { "database": "RefSeq", "id": "NP_004692", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004692" }, { "database": "PubMed", "id": "35082401", "url": "https://glygen.org/publication/PubMed/35082401" } ] }, { "annotation": "Cyclin B2 impairs the p53 signaling in nasopharyngeal carcinoma. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_004692", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004692" }, { "database": "PubMed", "id": "38166895", "url": "https://glygen.org/publication/PubMed/38166895" } ] }, { "annotation": "Cyclin B2 is a member of the cyclin family, specifically the B-type cyclins. The B-type cyclins, B1 and B2, associate with p34cdc2 and are essential components of the cell cycle regulatory machinery. B1 and B2 differ in their subcellular localization. Cyclin B1 co-localizes with microtubules, whereas cyclin B2 is primarily associated with the Golgi region. Cyclin B2 also binds to transforming growth factor beta RII and thus cyclin B2/cdc2 may play a key role in transforming growth factor beta-mediated cell cycle control. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_004692", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004692" } ] }, { "annotation": "Essential for the control of the cell cycle at the G2/M (mitosis) transition.", "evidence": [ { "database": "UniProtKB", "id": "O95067", "url": "https://www.uniprot.org/uniprot/O95067#function" }, { "database": "UniProtKB", "id": "H1UBN3", "url": "https://www.uniprot.org/uniprot/H1UBN3#function" }, { "database": "UniProtKB", "id": "ARBA00003222", "url": "https://www.uniprot.org/uniprot/ARBA00003222#function" }, { "database": "UniProtKB", "id": "H0YMP3", "url": "https://www.uniprot.org/uniprot/H0YMP3#function" } ] }, { "annotation": "Hsa_circ_0000285 knockdown inhibits the progression of hepatocellular carcinoma by sponging miR-582-3p to regulate CCNB2 expression.", "evidence": [ { "database": "RefSeq", "id": "NP_004692", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004692" }, { "database": "PubMed", "id": "35839486", "url": "https://glygen.org/publication/PubMed/35839486" } ] }, { "annotation": "Mad2 promotes Cyclin B2 recruitment to the kinetochore for guiding accurate mitotic checkpoint.", "evidence": [ { "database": "RefSeq", "id": "NP_004692", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004692" }, { "database": "PubMed", "id": "35384228", "url": "https://glygen.org/publication/PubMed/35384228" } ] }, { "annotation": "Prognostic value of cyclin B1 and cyclin B2 expression in breast cancer: A systematic review and updated meta-analysis.", "evidence": [ { "database": "RefSeq", "id": "NP_004692", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004692" }, { "database": "PubMed", "id": "38241547", "url": "https://glygen.org/publication/PubMed/38241547" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "61.74", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000157456", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000157456" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "84.43", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000157456", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000157456" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "76.33", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000157456", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000157456" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "80.45", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000157456", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000157456" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "63.97", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000157456", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000157456" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "87.93", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000157456", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000157456" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "89.21", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000157456", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000157456" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "61.43", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000157456", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000157456" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "62.42", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000157456", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000157456" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "68.37", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000157456", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000157456" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "58.45", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000157456", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000157456" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "72.96", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000157456", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000157456" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "69.71", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000157456", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000157456" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O95067", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95067" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O95067", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95067" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O95067", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95067" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O95067", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95067" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O95067", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95067" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O95067", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95067" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O95067", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95067" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O95067", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95067" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O95067", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95067" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O95067", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95067" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O95067", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95067" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O95067", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O95067" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95067", "url": "https://www.uniprot.org/uniprot/O95067" } ], "common_name": "Human" } ], "gene": [ { "name": "CCNB2", "url": "https://www.uniprot.org/uniprot/O95067", "locus": { "chromosome": "15", "start_pos": 59125045, "end_pos": 59105126, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000157456", "url": "https://www.ensembl.org/id/ENSG00000157456" } ] } } ], "crossref": [ { "id": "ENSG00000157456", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000157456", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd20566", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd20566", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd20570", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd20570", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL2094127", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2094127", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "CCNB2", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CCNB2", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "9133", "url": "https://www.ncbi.nlm.nih.gov/gene/9133", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "1580", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=1580", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O95067", "url": "https://www.ebi.ac.uk/intact/interactors/id:O95067*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR004367", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004367", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006671", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006671", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013763", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013763", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036915", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036915", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039361", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039361", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046965", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046965", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR048258", "url": "https://www.ebi.ac.uk/interpro/entry/IPR048258", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:9133", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9133", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "602755", "url": "http://www.omim.org/entry/602755", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O95067", "url": "https://www.nextprot.org/entry/NX_O95067", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "QPTKTNV", "url": "https://omabrowser.org/oma/group/QPTKTNV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5474295at2759", "url": "http://www.orthodb.org/?query=5474295at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10177", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10177", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10177:SF184", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10177:SF184", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00134", "url": "http://pfam.xfam.org/family/PF00134", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02984", "url": "http://pfam.xfam.org/family/PF02984", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O95067", "url": "https://pharos.nih.gov/targets/O95067", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O95067", "url": "http://purl.obolibrary.org/obo/PR_O95067", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-156711", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156711", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-162658", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162658", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2514853", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514853", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2565942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2565942", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2980767", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2980767", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2995383", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2995383", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3301854", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3301854", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-69478", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69478", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8852276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8852276", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_004692", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004692", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "H0YMP3", "url": "https://www.uniprot.org/uniprot/H0YMP3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YMP3-1", "url": "https://www.uniprot.org/uniprot/H0YMP3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H1UBN3", "url": "https://www.uniprot.org/uniprot/H1UBN3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H1UBN3-1", "url": "https://www.uniprot.org/uniprot/H1UBN3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95067", "url": "https://www.uniprot.org/uniprot/O95067", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O95067-1", "url": "https://www.uniprot.org/uniprot/O95067-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MALLRRPTVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDNEDWENPQLCSDYVKDIYQYLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKFRLLQETLYMCVGIMDRFLQVQPVSRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLIDYDMVHYHPSKVAAAASCLSQKVLGQGKWNLKQQYYTGYTENEVLEVMQHMAKNVVKVNENLTKFIAIKNKYASSKLLKISMIPQLNSKAVKDLASPLIGRS", "length": 398, "header": "sp|O95067-1|CCNB2_HUMAN Isoform 1 of G2/mitotic-specific cyclin-B2 OS=Homo sapiens OX=9606 GN=CCNB2 PE=1 SV=1 CANONICAL=O95067-1" }, "isoforms": [ { "isoform_ac": "H0YMP3-1", "url": "", "sequence": { "sequence": "MALLRRPTGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDNEDWENPQLCSDYVKDIYQYLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKFRLLQETLYMCVGIMDRFLQVQPVSRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGENLKQQYYTGYTENEVLEVMQHMAKNVVKVNENLTKFIAIKNKYASSKLLKISMIPQLNSKAVKDLASPLIGRS", "length": 270, "header": "tr|H0YMP3-1|CCNB2_HUMAN Computationally mapped isoform of G2/mitotic-specific cyclin-B2 OS=Homo sapiens OX=9606 GN=CCNB2 PE=1 SV=1 CANONICAL=O95067-1" }, "locus": { "chromosome": "15", "start_pos": 59124874, "end_pos": 59105269, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000559622.5", "url": "https://www.ensembl.org/id/ENST00000559622.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000453685.1", "url": "https://www.ensembl.org/id/ENSP00000453685.1" } ] } }, { "isoform_ac": "H1UBN3-1", "url": "", "sequence": { "sequence": "MALLRRPTVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDNEDWENPQLCSDYVKDIYQYLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKFRLLQETLYMCVGIMDRFLQVQPVSRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLIDYDMVHYHPSKVAAAASCLSQKVLGQGKWNLKQQYYTGYTENEVLEVMQHMAKNVVKVNENLTKFIVSTTVFLSCGKL", "length": 374, "header": "tr|H1UBN3-1|H1UBN3_HUMAN Computationally mapped isoform of G2/mitotic-specific cyclin-B2 OS=Homo sapiens OX=9606 GN=CCNB2 PE=1 SV=1 CANONICAL=O95067-1" }, "locus": { "chromosome": "15", "start_pos": 59123663, "end_pos": 59105269, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000621385.1", "url": "https://www.ensembl.org/id/ENST00000621385.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000480809.1", "url": "https://www.ensembl.org/id/ENSP00000480809.1" } ] } }, { "isoform_ac": "O95067-1", "url": "", "sequence": { "sequence": "MALLRRPTVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDNEDWENPQLCSDYVKDIYQYLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKFRLLQETLYMCVGIMDRFLQVQPVSRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLIDYDMVHYHPSKVAAAASCLSQKVLGQGKWNLKQQYYTGYTENEVLEVMQHMAKNVVKVNENLTKFIAIKNKYASSKLLKISMIPQLNSKAVKDLASPLIGRS", "length": 398, "header": "sp|O95067-1|CCNB2_HUMAN Isoform 1 of G2/mitotic-specific cyclin-B2 OS=Homo sapiens OX=9606 GN=CCNB2 PE=1 SV=1 CANONICAL=O95067-1" }, "locus": { "chromosome": "15", "start_pos": 59124874, "end_pos": 59105269, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000288207.7", "url": "https://www.ensembl.org/id/ENST00000288207.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000288207.2", "url": "https://www.ensembl.org/id/ENSP00000288207.2" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 11, "end_pos": 11, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95067", "url": "https://www.uniprot.org/uniprot/O95067" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O95067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95067" } ], "site_lbl": "Ser11" }, { "start_pos": 204, "end_pos": 204, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95067" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ], "site_lbl": "Ser204" }, { "start_pos": 392, "end_pos": 392, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95067", "url": "https://www.uniprot.org/uniprot/O95067" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O95067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95067" } ], "site_lbl": "Ser392" }, { "start_pos": 398, "end_pos": 398, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95067", "url": "https://www.uniprot.org/uniprot/O95067" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19369195", "url": "https://glygen.org/publication/PubMed/19369195" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O95067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95067" }, { "database": "phospho.ELM", "id": "O95067", "url": "http://phospho.elm.eu.org/byAccession/O95067.html" } ], "site_lbl": "Ser398" }, { "start_pos": 77, "end_pos": 77, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95067", "url": "https://www.uniprot.org/uniprot/O95067" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O95067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95067" } ], "site_lbl": "Ser77" }, { "start_pos": 8, "end_pos": 8, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O95067", "url": "https://www.uniprot.org/uniprot/O95067" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O95067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95067" } ], "site_lbl": "Thr8" }, { "start_pos": 92, "end_pos": 92, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95067", "url": "https://www.uniprot.org/uniprot/O95067" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O95067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95067" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" }, { "database": "phospho.ELM", "id": "O95067", "url": "http://phospho.elm.eu.org/byAccession/O95067.html" } ], "site_lbl": "Ser92" }, { "start_pos": 94, "end_pos": 94, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O95067", "url": "https://www.uniprot.org/uniprot/O95067" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "iPTMnet", "id": "O95067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95067" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "phospho.ELM", "id": "O95067", "url": "http://phospho.elm.eu.org/byAccession/O95067.html" } ], "site_lbl": "Thr94" }, { "start_pos": 99, "end_pos": 99, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O95067", "url": "https://www.uniprot.org/uniprot/O95067" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "iPTMnet", "id": "O95067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95067" }, { "database": "phospho.ELM", "id": "O95067", "url": "http://phospho.elm.eu.org/byAccession/O95067.html" } ], "site_lbl": "Ser99" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Ran-independent nuclear import of cyclin B1-Cdc2 by importin beta.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Takizawa CG, Weis K, Morgan DO", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "10393926", "url": "https://glygen.org/publication/PubMed/10393926" } ] }, { "title": "Translocation of cyclin B1 to the nucleus at prophase requires a phosphorylation-dependent nuclear import signal.", "journal": "Current biology : CB", "date": "1999", "authors": "Hagting A, Jackman M, Simpson K, Pines J", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "10395539", "url": "https://glygen.org/publication/PubMed/10395539" } ] }, { "title": "Purification of porcine brain protein phosphatase 2A leucine carboxyl methyltransferase and cloning of the human homologue.", "journal": "Biochemistry", "date": "1999", "authors": "De Baere I, Derua R, Janssens V, Van Hoof C, Waelkens E, Merlevede W, Goris J", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "10600115", "url": "https://glygen.org/publication/PubMed/10600115" } ] }, { "title": "The role of the tethering proteins p115 and GM130 in transport through the Golgi apparatus in vivo.", "journal": "Molecular biology of the cell", "date": "2000", "authors": "Seemann J, Jokitalo EJ, Warren G", "evidence": [ { "database": "Reactome", "id": "R-HSA-162658", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162658" } ], "reference": [ { "type": "PubMed", "id": "10679020", "url": "https://glygen.org/publication/PubMed/10679020" } ] }, { "title": "Rapid destruction of human Cdc25A in response to DNA damage.", "journal": "Science (New York, N.Y.)", "date": "2000", "authors": "Mailand N, Falck J, Lukas C, Syljuasen RG, Welcker M, Bartek J, Lukas J", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "10827953", "url": "https://glygen.org/publication/PubMed/10827953" } ] }, { "title": "Control of mitosis by changes in the subcellular location of cyclin-B1-Cdk1 and Cdc25C.", "journal": "Current opinion in cell biology", "date": "2000", "authors": "Takizawa CG, Morgan DO", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "11063929", "url": "https://glygen.org/publication/PubMed/11063929" } ] }, { "title": "Chromosome condensation by a human condensin complex in Xenopus egg extracts.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Kimura K, Cuvier O, Hirano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514853", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514853" } ], "reference": [ { "type": "PubMed", "id": "11136719", "url": "https://glygen.org/publication/PubMed/11136719" } ] }, { "title": "Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.", "journal": "Genome Res.", "date": "2001", "authors": "Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Bocher M, Blocker H, Bauersachs S, Blum H, Lauber J, Dusterhoft A, Beyer A, Kohrer K, Strack N, Mewes HW, Ottenwalder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A", "evidence": [ { "database": "UniProtKB", "id": "O95067", "url": "https://www.uniprot.org/uniprot/O95067" } ], "reference": [ { "type": "PubMed", "id": "11230166", "url": "https://glygen.org/publication/PubMed/11230166" } ] }, { "title": "The localization of human cyclins B1 and B2 determines CDK1 substrate specificity and neither enzyme requires MEK to disassemble the Golgi apparatus.", "journal": "The Journal of cell biology", "date": "2001", "authors": "Draviam VM, Orrechia S, Lowe M, Pardi R, Pines J", "evidence": [ { "database": "Reactome", "id": "R-HSA-162658", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162658" } ], "reference": [ { "type": "PubMed", "id": "11238451", "url": "https://glygen.org/publication/PubMed/11238451" } ] }, { "title": "Rab1 interaction with a GM130 effector complex regulates COPII vesicle cis--Golgi tethering.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2001", "authors": "Moyer BD, Allan BB, Balch WE", "evidence": [ { "database": "Reactome", "id": "R-HSA-162658", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162658" } ], "reference": [ { "type": "PubMed", "id": "11285137", "url": "https://glygen.org/publication/PubMed/11285137" } ] }, { "title": "The Golgi matrix protein GM130: a specific interacting partner of the small GTPase rab1b.", "journal": "EMBO reports", "date": "2001", "authors": "Weide T, Bayer M, Koster M, Siebrasse JP, Peters R, Barnekow A", "evidence": [ { "database": "Reactome", "id": "R-HSA-162658", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162658" } ], "reference": [ { "type": "PubMed", "id": "11306556", "url": "https://glygen.org/publication/PubMed/11306556" } ] }, { "title": "Localization of human Cdc25C is regulated both by nuclear export and 14-3-3 protein binding.", "journal": "Oncogene", "date": "2001", "authors": "Graves PR, Lovly CM, Uy GL, Piwnica-Worms H", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "11313932", "url": "https://glygen.org/publication/PubMed/11313932" } ] }, { "title": "Mitotic phosphorylation of Golgi reassembly stacking protein 55 by mitogen-activated protein kinase ERK2.", "journal": "Molecular biology of the cell", "date": "2001", "authors": "Jesch SA, Lewis TS, Ahn NG, Linstedt AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-162658", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162658" } ], "reference": [ { "type": "PubMed", "id": "11408587", "url": "https://glygen.org/publication/PubMed/11408587" } ] }, { "title": "Polo-like kinase is required for the fragmentation of pericentriolar Golgi stacks during mitosis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Sutterlin C, Lin CY, Feng Y, Ferris DK, Erikson RL, Malhotra V", "evidence": [ { "database": "Reactome", "id": "R-HSA-162658", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162658" } ], "reference": [ { "type": "PubMed", "id": "11447294", "url": "https://glygen.org/publication/PubMed/11447294" } ] }, { "title": "Cohesin cleavage by separase required for anaphase and cytokinesis in human cells.", "journal": "Science (New York, N.Y.)", "date": "2001", "authors": "Hauf S, Waizenegger IC, Peters JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "11509732", "url": "https://glygen.org/publication/PubMed/11509732" } ] }, { "title": "A GRASP55-rab2 effector complex linking Golgi structure to membrane traffic.", "journal": "The Journal of cell biology", "date": "2001", "authors": "Short B, Preisinger C, Korner R, Kopajtich R, Byron O, Barr FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-162658", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162658" } ], "reference": [ { "type": "PubMed", "id": "11739401", "url": "https://glygen.org/publication/PubMed/11739401" } ] }, { "title": "Plk1 promotes nuclear translocation of human Cdc25C during prophase.", "journal": "EMBO reports", "date": "2002", "authors": "Toyoshima-Morimoto F, Taniguchi E, Nishida E", "evidence": [ { "database": "Reactome", "id": "R-HSA-156711", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156711" } ], "reference": [ { "type": "PubMed", "id": "11897663", "url": "https://glygen.org/publication/PubMed/11897663" } ] }, { "title": "Nercc1, a mammalian NIMA-family kinase, binds the Ran GTPase and regulates mitotic progression.", "journal": "Genes & development", "date": "2002", "authors": "Roig J, Mikhailov A, Belham C, Avruch J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2980767", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2980767" } ], "reference": [ { "type": "PubMed", "id": "12101123", "url": "https://glygen.org/publication/PubMed/12101123" } ] }, { "title": "Phosphorylation of threonine 210 and the role of serine 137 in the regulation of mammalian polo-like kinase.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Jang YJ, Ma S, Terada Y, Erikson RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2565942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2565942" } ], "reference": [ { "type": "PubMed", "id": "12207013", "url": "https://glygen.org/publication/PubMed/12207013" } ] }, { "title": "Nuclear translocation of plk1 mediated by its bipartite nuclear localization signal.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Taniguchi E, Toyoshima-Morimoto F, Nishida E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2565942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2565942" } ], "reference": [ { "type": "PubMed", "id": "12364337", "url": "https://glygen.org/publication/PubMed/12364337" } ] }, { "title": "Regulation of G(2)/M events by Cdc25A through phosphorylation-dependent modulation of its stability.", "journal": "The EMBO journal", "date": "2002", "authors": "Mailand N, Podtelejnikov AV, Groth A, Mann M, Bartek J, Lukas J", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "12411508", "url": "https://glygen.org/publication/PubMed/12411508" } ] }, { "title": "Nup98 localizes to both nuclear and cytoplasmic sides of the nuclear pore and binds to two distinct nucleoporin subcomplexes.", "journal": "Molecular biology of the cell", "date": "2003", "authors": "Griffis ER, Xu S, Powers MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3301854", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3301854" } ], "reference": [ { "type": "PubMed", "id": "12589057", "url": "https://glygen.org/publication/PubMed/12589057" } ] }, { "title": "RAF1-activated MEK1 is found on the Golgi apparatus in late prophase and is required for Golgi complex fragmentation in mitosis.", "journal": "The Journal of cell biology", "date": "2003", "authors": "Colanzi A, Sutterlin C, Malhotra V", "evidence": [ { "database": "Reactome", "id": "R-HSA-162658", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162658" } ], "reference": [ { "type": "PubMed", "id": "12695496", "url": "https://glygen.org/publication/PubMed/12695496" } ] }, { "title": "Identification of a consensus motif for Plk (Polo-like kinase) phosphorylation reveals Myt1 as a Plk1 substrate.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Nakajima H, Toyoshima-Morimoto F, Taniguchi E, Nishida E", "evidence": [ { "database": "Reactome", "id": "R-HSA-156711", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156711" } ], "reference": [ { "type": "PubMed", "id": "12738781", "url": "https://glygen.org/publication/PubMed/12738781" } ] }, { "title": "The RRASK motif in Xenopus cyclin B2 is required for the substrate recognition of Cdc25C by the cyclin B-Cdc2 complex.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Goda T, Ishii T, Nakajo N, Sagata N, Kobayashi H", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "12754270", "url": "https://glygen.org/publication/PubMed/12754270" } ] }, { "title": "A direct role for GRASP65 as a mitotically regulated Golgi stacking factor.", "journal": "The EMBO journal", "date": "2003", "authors": "Wang Y, Seemann J, Pypaert M, Shorter J, Warren G", "evidence": [ { "database": "Reactome", "id": "R-HSA-162658", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162658" } ], "reference": [ { "type": "PubMed", "id": "12839990", "url": "https://glygen.org/publication/PubMed/12839990" } ] }, { "title": "A mitotic cascade of NIMA family kinases. Nercc1/Nek9 activates the Nek6 and Nek7 kinases.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Belham C, Roig J, Caldwell JA, Aoyama Y, Kemp BE, Comb M, Avruch J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2980767", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2980767" } ], "reference": [ { "type": "PubMed", "id": "12840024", "url": "https://glygen.org/publication/PubMed/12840024" } ] }, { "title": "Aurora-A and an interacting activator, the LIM protein Ajuba, are required for mitotic commitment in human cells.", "journal": "Cell", "date": "2003", "authors": "Hirota T, Kunitoku N, Sasayama T, Marumoto T, Zhang D, Nitta M, Hatakeyama K, Saya H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2565942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2565942" } ], "reference": [ { "type": "PubMed", "id": "13678582", "url": "https://glygen.org/publication/PubMed/13678582" } ] }, { "title": "Inactivation of the p34cdc2-cyclin B complex by the human WEE1 tyrosine kinase.", "journal": "Science (New York, N.Y.)", "date": "1992", "authors": "Parker LL, Piwnica-Worms H", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "1384126", "url": "https://glygen.org/publication/PubMed/1384126" } ] }, { "title": "Cell cycle-dependent phosphorylation, nuclear localization, and activation of human condensin.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Takemoto A, Kimura K, Yokoyama S, Hanaoka F", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514853", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514853" } ], "reference": [ { "type": "PubMed", "id": "14607834", "url": "https://glygen.org/publication/PubMed/14607834" } ] }, { "title": "The conserved kinetochore protein shugoshin protects centromeric cohesion during meiosis.", "journal": "Nature", "date": "2004", "authors": "Kitajima TS, Kawashima SA, Watanabe Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "14730319", "url": "https://glygen.org/publication/PubMed/14730319" } ] }, { "title": "Forkhead box M1B transcriptional activity requires binding of Cdk-cyclin complexes for phosphorylation-dependent recruitment of p300/CBP coactivators.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Major ML, Lepe R, Costa RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "15024056", "url": "https://glygen.org/publication/PubMed/15024056" } ] }, { "title": "Coupling morphogenesis to mitotic entry.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Sakchaisri K, Asano S, Yu LR, Shulewitz MJ, Park CJ, Park JE, Cho YW, Veenstra TD, Thorner J, Lee KS", "evidence": [ { "database": "Reactome", "id": "R-HSA-156711", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156711" } ], "reference": [ { "type": "PubMed", "id": "15037762", "url": "https://glygen.org/publication/PubMed/15037762" } ] }, { "title": "M-phase kinases induce phospho-dependent ubiquitination of somatic Wee1 by SCFbeta-TrCP.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Watanabe N, Arai H, Nishihara Y, Taniguchi M, Watanabe N, Hunter T, Osada H", "evidence": [ { "database": "Reactome", "id": "R-HSA-156711", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156711" } ], "reference": [ { "type": "PubMed", "id": "15070733", "url": "https://glygen.org/publication/PubMed/15070733" } ] }, { "title": "Spatial and temporal regulation of Condensins I and II in mitotic chromosome assembly in human cells.", "journal": "Molecular biology of the cell", "date": "2004", "authors": "Ono T, Fang Y, Spector DL, Hirano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514853", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514853" } ], "reference": [ { "type": "PubMed", "id": "15146063", "url": "https://glygen.org/publication/PubMed/15146063" } ] }, { "title": "Vertebrate shugoshin links sister centromere cohesion and kinetochore microtubule stability in mitosis.", "journal": "Cell", "date": "2004", "authors": "Salic A, Waters JC, Mitchison TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "15339662", "url": "https://glygen.org/publication/PubMed/15339662" } ] }, { "title": "Characterisation of Cdc25B localisation and nuclear export during the cell cycle and in response to stress.", "journal": "Journal of cell science", "date": "2004", "authors": "Lindqvist A, Kallstrom H, Karlsson Rosenthal C", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "15456846", "url": "https://glygen.org/publication/PubMed/15456846" } ] }, { "title": "Cdc25A localisation and shuttling: characterisation of sequences mediating nuclear export and import.", "journal": "Experimental cell research", "date": "2005", "authors": "Kallstrom H, Lindqvist A, Pospisil V, Lundgren A, Rosenthal CK", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "15572030", "url": "https://glygen.org/publication/PubMed/15572030" } ] }, { "title": "Distinct functions of condensin I and II in mitotic chromosome assembly.", "journal": "Journal of cell science", "date": "2004", "authors": "Hirota T, Gerlich D, Koch B, Ellenberg J, Peters JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514853", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514853" } ], "reference": [ { "type": "PubMed", "id": "15572404", "url": "https://glygen.org/publication/PubMed/15572404" } ] }, { "title": "FoxM1 is required for execution of the mitotic programme and chromosome stability.", "journal": "Nature cell biology", "date": "2005", "authors": "Laoukili J, Kooistra MR, Bras A, Kauw J, Kerkhoven RM, Morrison A, Clevers H, Medema RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-156711", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156711" } ], "reference": [ { "type": "PubMed", "id": "15654331", "url": "https://glygen.org/publication/PubMed/15654331" } ] }, { "title": "Regulation of p21(WAF1/CIP1) stability by WISp39, a Hsp90 binding TPR protein.", "journal": "Molecular cell", "date": "2005", "authors": "Jascur T, Brickner H, Salles-Passador I, Barbier V, El Khissiin A, Smith B, Fotedar R, Fotedar A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8852276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8852276" } ], "reference": [ { "type": "PubMed", "id": "15664193", "url": "https://glygen.org/publication/PubMed/15664193" } ] }, { "title": "Plk1 docking to GRASP65 phosphorylated by Cdk1 suggests a mechanism for Golgi checkpoint signalling.", "journal": "The EMBO journal", "date": "2005", "authors": "Preisinger C, Korner R, Wind M, Lehmann WD, Kopajtich R, Barr FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-162658", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162658" } ], "reference": [ { "type": "PubMed", "id": "15678101", "url": "https://glygen.org/publication/PubMed/15678101" } ] }, { "title": "Human Bub1 defines the persistent cohesion site along the mitotic chromosome by affecting Shugoshin localization.", "journal": "Current biology : CB", "date": "2005", "authors": "Kitajima TS, Hauf S, Ohsugi M, Yamamoto T, Watanabe Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "15723797", "url": "https://glygen.org/publication/PubMed/15723797" } ] }, { "title": "Dissociation of cohesin from chromosome arms and loss of arm cohesion during early mitosis depends on phosphorylation of SA2.", "journal": "PLoS biology", "date": "2005", "authors": "Hauf S, Roitinger E, Koch B, Dittrich CM, Mechtler K, Peters JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "15737063", "url": "https://glygen.org/publication/PubMed/15737063" } ] }, { "title": "Active Nercc1 protein kinase concentrates at centrosomes early in mitosis and is necessary for proper spindle assembly.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Roig J, Groen A, Caldwell J, Avruch J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2980767", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2980767" } ], "reference": [ { "type": "PubMed", "id": "16079175", "url": "https://glygen.org/publication/PubMed/16079175" } ] }, { "title": "ERK1c regulates Golgi fragmentation during mitosis.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Shaul YD, Seger R", "evidence": [ { "database": "Reactome", "id": "R-HSA-162658", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162658" } ], "reference": [ { "type": "PubMed", "id": "16533948", "url": "https://glygen.org/publication/PubMed/16533948" } ] }, { "title": "Shugoshin collaborates with protein phosphatase 2A to protect cohesin.", "journal": "Nature", "date": "2006", "authors": "Kitajima TS, Sakuno T, Ishiguro K, Iemura S, Natsume T, Kawashima SA, Watanabe Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "16541025", "url": "https://glygen.org/publication/PubMed/16541025" } ] }, { "title": "Human Scc4 is required for cohesin binding to chromatin, sister-chromatid cohesion, and mitotic progression.", "journal": "Current biology : CB", "date": "2006", "authors": "Watrin E, Schleiffer A, Tanaka K, Eisenhaber F, Nasmyth K, Peters JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "16682347", "url": "https://glygen.org/publication/PubMed/16682347" } ] }, { "title": "Mitotic activation of the kinase Aurora-A requires its binding partner Bora.", "journal": "Developmental cell", "date": "2006", "authors": "Hutterer A, Berdnik D, Wirtz-Peitz F, Zigman M, Schleiffer A, Knoblich JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2565942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2565942" } ], "reference": [ { "type": "PubMed", "id": "16890155", "url": "https://glygen.org/publication/PubMed/16890155" } ] }, { "title": "Negative regulation of condensin I by CK2-mediated phosphorylation.", "journal": "The EMBO journal", "date": "2006", "authors": "Takemoto A, Kimura K, Yanagisawa J, Yokoyama S, Hanaoka F", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514853", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514853" } ], "reference": [ { "type": "PubMed", "id": "17066080", "url": "https://glygen.org/publication/PubMed/17066080" } ] }, { "title": "Human Wapl is a cohesin-binding protein that promotes sister-chromatid resolution in mitotic prophase.", "journal": "Current biology : CB", "date": "2006", "authors": "Gandhi R, Gillespie PJ, Hirano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "17112726", "url": "https://glygen.org/publication/PubMed/17112726" } ] }, { "title": "Wapl controls the dynamic association of cohesin with chromatin.", "journal": "Cell", "date": "2006", "authors": "Kueng S, Hegemann B, Peters BH, Lipp JJ, Schleiffer A, Mechtler K, Peters JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "17113138", "url": "https://glygen.org/publication/PubMed/17113138" } ] }, { "title": "Human cyclins A and B1 are differentially located in the cell and undergo cell cycle-dependent nuclear transport.", "journal": "The Journal of cell biology", "date": "1991", "authors": "Pines J, Hunter T", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "1717476", "url": "https://glygen.org/publication/PubMed/1717476" } ] }, { "title": "Mitogen-activated protein kinase kinase 1-dependent Golgi unlinking occurs in G2 phase and promotes the G2/M cell cycle transition.", "journal": "Molecular biology of the cell", "date": "2007", "authors": "Feinstein TN, Linstedt AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-162658", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162658" } ], "reference": [ { "type": "PubMed", "id": "17182854", "url": "https://glygen.org/publication/PubMed/17182854" } ] }, { "title": "Aurora B controls the association of condensin I but not condensin II with mitotic chromosomes.", "journal": "Journal of cell science", "date": "2007", "authors": "Lipp JJ, Hirota T, Poser I, Peters JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514853", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514853" } ], "reference": [ { "type": "PubMed", "id": "17356064", "url": "https://glygen.org/publication/PubMed/17356064" } ] }, { "title": "Cyclin B2 suppresses mitotic failure and DNA re-replication in human somatic cells knocked down for both cyclins B1 and B2.", "journal": "Oncogene", "date": "2007", "authors": "Bellanger S, de Gramont A, Sobczak-Thepot J", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "17533373", "url": "https://glygen.org/publication/PubMed/17533373" } ] }, { "title": "An in vitro nuclear disassembly system reveals a role for the RanGTPase system and microtubule-dependent steps in nuclear envelope breakdown.", "journal": "The Journal of cell biology", "date": "2007", "authors": "Muhlhausser P, Kutay U", "evidence": [ { "database": "Reactome", "id": "R-HSA-3301854", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3301854" } ], "reference": [ { "type": "PubMed", "id": "17698605", "url": "https://glygen.org/publication/PubMed/17698605" } ] }, { "title": "Molecular architecture of the kinetochore-microtubule interface.", "journal": "Nature reviews. Molecular cell biology", "date": "2008", "authors": "Cheeseman IM, Desai A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "18097444", "url": "https://glygen.org/publication/PubMed/18097444" } ] }, { "title": "Coordination of golgin tethering and SNARE assembly: GM130 binds syntaxin 5 in a p115-regulated manner.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Diao A, Frost L, Morohashi Y, Lowe M", "evidence": [ { "database": "Reactome", "id": "R-HSA-162658", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162658" } ], "reference": [ { "type": "PubMed", "id": "18167358", "url": "https://glygen.org/publication/PubMed/18167358" } ] }, { "title": "Dephosphorylation and activation of a p34cdc2/cyclin B complex in vitro by human CDC25 protein.", "journal": "Nature", "date": "1991", "authors": "Strausfeld U, Labbe JC, Fesquet D, Cavadore JC, Picard A, Sadhu K, Russell P, Doree M", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "1828290", "url": "https://glygen.org/publication/PubMed/1828290" } ] }, { "title": "Activation of FoxM1 during G2 requires cyclin A/Cdk-dependent relief of autorepression by the FoxM1 N-terminal domain.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Laoukili J, Alvarez M, Meijer LA, Stahl M, Mohammed S, Kleij L, Heck AJ, Medema RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "18285455", "url": "https://glygen.org/publication/PubMed/18285455" } ] }, { "title": "Specific activation of cdc25 tyrosine phosphatases by B-type cyclins: evidence for multiple roles of mitotic cyclins.", "journal": "Cell", "date": "1991", "authors": "Galaktionov K, Beach D", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "1836978", "url": "https://glygen.org/publication/PubMed/1836978" } ] }, { "title": "Plk1- and beta-TrCP-dependent degradation of Bora controls mitotic progression.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Seki A, Coppinger JA, Du H, Jang CY, Yates JR 3rd, Fang G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2565942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2565942" } ], "reference": [ { "type": "PubMed", "id": "18378770", "url": "https://glygen.org/publication/PubMed/18378770" } ] }, { "title": "Differential phosphorylation of Cdc25C phosphatase in mitosis.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Bonnet J, Mayonove P, Morris MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "18384749", "url": "https://glygen.org/publication/PubMed/18384749" } ] }, { "title": "The role of GRASP55 in Golgi fragmentation and entry of cells into mitosis.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "Duran JM, Kinseth M, Bossard C, Rose DW, Polishchuk R, Wu CC, Yates J, Zimmerman T, Malhotra V", "evidence": [ { "database": "Reactome", "id": "R-HSA-162658", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162658" } ], "reference": [ { "type": "PubMed", "id": "18385516", "url": "https://glygen.org/publication/PubMed/18385516" } ] }, { "title": "Structural mechanism of demethylation and inactivation of protein phosphatase 2A.", "journal": "Cell", "date": "2008", "authors": "Xing Y, Li Z, Chen Y, Stock JB, Jeffrey PD, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "18394995", "url": "https://glygen.org/publication/PubMed/18394995" } ] }, { "title": "GRASP55 regulates Golgi ribbon formation.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "Feinstein TN, Linstedt AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-162658", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162658" } ], "reference": [ { "type": "PubMed", "id": "18434598", "url": "https://glygen.org/publication/PubMed/18434598" } ] }, { "title": "Myosin phosphatase-targeting subunit 1 regulates mitosis by antagonizing polo-like kinase 1.", "journal": "Developmental cell", "date": "2008", "authors": "Yamashiro S, Yamakita Y, Totsukawa G, Goto H, Kaibuchi K, Ito M, Hartshorne DJ, Matsumura F", "evidence": [ { "database": "Reactome", "id": "R-HSA-2565942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2565942" } ], "reference": [ { "type": "PubMed", "id": "18477460", "url": "https://glygen.org/publication/PubMed/18477460" } ] }, { "title": "Plk1 regulates mitotic Aurora A function through betaTrCP-dependent degradation of hBora.", "journal": "Chromosoma", "date": "2008", "authors": "Chan EH, Santamaria A, Sillje HH, Nigg EA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2565942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2565942" } ], "reference": [ { "type": "PubMed", "id": "18521620", "url": "https://glygen.org/publication/PubMed/18521620" } ] }, { "title": "Bora and the kinase Aurora a cooperatively activate the kinase Plk1 and control mitotic entry.", "journal": "Science (New York, N.Y.)", "date": "2008", "authors": "Seki A, Coppinger JA, Jang CY, Yates JR, Fang G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2565942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2565942" } ], "reference": [ { "type": "PubMed", "id": "18566290", "url": "https://glygen.org/publication/PubMed/18566290" } ] }, { "title": "Polo-like kinase-1 is activated by aurora A to promote checkpoint recovery.", "journal": "Nature", "date": "2008", "authors": "Macurek L, Lindqvist A, Lim D, Lampson MA, Klompmaker R, Freire R, Clouin C, Taylor SS, Yaffe MB, Medema RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2565942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2565942" } ], "reference": [ { "type": "PubMed", "id": "18615013", "url": "https://glygen.org/publication/PubMed/18615013" } ] }, { "title": "Live cell imaging and electron microscopy reveal dynamic processes of BAF-directed nuclear envelope assembly.", "journal": "Journal of cell science", "date": "2008", "authors": "Haraguchi T, Kojidani T, Koujin T, Shimi T, Osakada H, Mori C, Yamamoto A, Hiraoka Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2995383", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2995383" } ], "reference": [ { "type": "PubMed", "id": "18628300", "url": "https://glygen.org/publication/PubMed/18628300" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "O95067", "url": "https://www.uniprot.org/uniprot/O95067" }, { "database": "iPTMnet", "id": "O95067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95067" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.", "journal": "Molecular cell", "date": "2008", "authors": "Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O95067", "url": "https://www.uniprot.org/uniprot/O95067" }, { "database": "iPTMnet", "id": "O95067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95067" } ], "reference": [ { "type": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ] }, { "title": "Heterochromatin links to centromeric protection by recruiting shugoshin.", "journal": "Nature", "date": "2008", "authors": "Yamagishi Y, Sakuno T, Shimura M, Watanabe Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "18716626", "url": "https://glygen.org/publication/PubMed/18716626" } ] }, { "title": "Phosphorylation of CAP-G is required for its chromosomal DNA localization during mitosis.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Murphy LA, Sarge KD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514853", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514853" } ], "reference": [ { "type": "PubMed", "id": "18977199", "url": "https://glygen.org/publication/PubMed/18977199" } ] }, { "title": "Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis.", "journal": "Analytical chemistry", "date": "2008", "authors": "Wang B, Malik R, Nigg EA, Korner R", "evidence": [ { "database": "iPTMnet", "id": "O95067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95067" } ], "reference": [ { "type": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" } ] }, { "title": "Phosphorylation of two small GTP-binding proteins of the Rab family by p34cdc2.", "journal": "Nature", "date": "1991", "authors": "Bailly E, McCaffrey M, Touchot N, Zahraoui A, Goud B, Bornens M", "evidence": [ { "database": "Reactome", "id": "R-HSA-162658", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162658" } ], "reference": [ { "type": "PubMed", "id": "1902553", "url": "https://glygen.org/publication/PubMed/1902553" } ] }, { "title": "Plk1-dependent phosphorylation of FoxM1 regulates a transcriptional programme required for mitotic progression.", "journal": "Nature cell biology", "date": "2008", "authors": "Fu Z, Malureanu L, Huang J, Wang W, Li H, van Deursen JM, Tindall DJ, Chen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "19160488", "url": "https://glygen.org/publication/PubMed/19160488" } ] }, { "title": "Human Cdc25A phosphatase has a non-redundant function in G2 phase by activating Cyclin A-dependent kinases.", "journal": "FEBS letters", "date": "2009", "authors": "Timofeev O, Cizmecioglu O, Hu E, Orlik T, Hoffmann I", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "19192479", "url": "https://glygen.org/publication/PubMed/19192479" } ] }, { "title": "Large-scale proteomics analysis of the human kinome.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H", "evidence": [ { "database": "UniProtKB", "id": "O95067", "url": "https://www.uniprot.org/uniprot/O95067" }, { "database": "iPTMnet", "id": "O95067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95067" } ], "reference": [ { "type": "PubMed", "id": "19369195", "url": "https://glygen.org/publication/PubMed/19369195" } ] }, { "title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.", "journal": "Analytical chemistry", "date": "2009", "authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S", "evidence": [ { "database": "iPTMnet", "id": "O95067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95067" } ], "reference": [ { "type": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ] }, { "title": "Polo kinase regulates mitotic chromosome condensation by hyperactivation of condensin DNA supercoiling activity.", "journal": "Molecular cell", "date": "2009", "authors": "St-Pierre J, Douziech M, Bazile F, Pascariu M, Bonneil E, Sauve V, Ratsima H, D'Amours D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514853", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514853" } ], "reference": [ { "type": "PubMed", "id": "19481522", "url": "https://glygen.org/publication/PubMed/19481522" } ] }, { "title": "Recruitment of functionally distinct membrane proteins to chromatin mediates nuclear envelope formation in vivo.", "journal": "The Journal of cell biology", "date": "2009", "authors": "Anderson DJ, Vargas JD, Hsiao JP, Hetzer MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2995383", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2995383" } ], "reference": [ { "type": "PubMed", "id": "19620630", "url": "https://glygen.org/publication/PubMed/19620630" } ] }, { "title": "Specific phosphorylation and activation of ERK1c by MEK1b: a unique route in the ERK cascade.", "journal": "Genes & development", "date": "2009", "authors": "Shaul YD, Gibor G, Plotnikov A, Seger R", "evidence": [ { "database": "Reactome", "id": "R-HSA-162658", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162658" } ], "reference": [ { "type": "PubMed", "id": "19651986", "url": "https://glygen.org/publication/PubMed/19651986" } ] }, { "title": "Phosphoproteomic analysis of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Brill LM, Xiong W, Lee KB, Ficarro SB, Crain A, Xu Y, Terskikh A, Snyder EY, Ding S", "evidence": [ { "database": "iPTMnet", "id": "O95067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95067" } ], "reference": [ { "type": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" } ] }, { "title": "Releasing cohesin from chromosome arms in early mitosis: opposing actions of Wapl-Pds5 and Sgo1.", "journal": "Genes & development", "date": "2009", "authors": "Shintomi K, Hirano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "19696148", "url": "https://glygen.org/publication/PubMed/19696148" } ] }, { "title": "An autoinhibitory tyrosine motif in the cell-cycle-regulated Nek7 kinase is released through binding of Nek9.", "journal": "Molecular cell", "date": "2009", "authors": "Richards MW, O'Regan L, Mas-Droux C, Blot JM, Cheung J, Hoelder S, Fry AM, Bayliss R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2980767", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2980767" } ], "reference": [ { "type": "PubMed", "id": "19941817", "url": "https://glygen.org/publication/PubMed/19941817" } ] }, { "title": "Phosphorylation of H2A by Bub1 prevents chromosomal instability through localizing shugoshin.", "journal": "Science (New York, N.Y.)", "date": "2010", "authors": "Kawashima SA, Yamagishi Y, Honda T, Ishiguro K, Watanabe Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "19965387", "url": "https://glygen.org/publication/PubMed/19965387" } ] }, { "title": "Human GTSE-1 regulates p21(CIP1/WAF1) stability conferring resistance to paclitaxel treatment.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Bublik DR, Scolz M, Triolo G, Monte M, Schneider C", "evidence": [ { "database": "Reactome", "id": "R-HSA-8852276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8852276" } ], "reference": [ { "type": "PubMed", "id": "20018861", "url": "https://glygen.org/publication/PubMed/20018861" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O95067", "url": "https://www.uniprot.org/uniprot/O95067" }, { "database": "iPTMnet", "id": "O95067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95067" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "GRASP55 and GRASP65 play complementary and essential roles in Golgi cisternal stacking.", "journal": "The Journal of cell biology", "date": "2010", "authors": "Xiang Y, Wang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-162658", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162658" } ], "reference": [ { "type": "PubMed", "id": "20083603", "url": "https://glygen.org/publication/PubMed/20083603" } ] }, { "title": "The role of GRASP65 in Golgi cisternal stacking and cell cycle progression.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2010", "authors": "Tang D, Yuan H, Wang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-162658", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162658" } ], "reference": [ { "type": "PubMed", "id": "20214750", "url": "https://glygen.org/publication/PubMed/20214750" } ] }, { "title": "Cdc25 phosphatases are required for timely assembly of CDK1-cyclin B at the G2/M transition.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Timofeev O, Cizmecioglu O, Settele F, Kempf T, Hoffmann I", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "20360007", "url": "https://glygen.org/publication/PubMed/20360007" } ] }, { "title": "Requirement for lamin B receptor and its regulation by importin {beta} and phosphorylation in nuclear envelope assembly during mitotic exit.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Lu X, Shi Y, Lu Q, Ma Y, Luo J, Wang Q, Ji J, Jiang Q, Zhang C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2995383", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2995383" } ], "reference": [ { "type": "PubMed", "id": "20576617", "url": "https://glygen.org/publication/PubMed/20576617" } ] }, { "title": "Polo-like kinase 1 phosphorylation of G2 and S-phase-expressed 1 protein is essential for p53 inactivation during G2 checkpoint recovery.", "journal": "EMBO reports", "date": "2010", "authors": "Liu XS, Li H, Song B, Liu X", "evidence": [ { "database": "Reactome", "id": "R-HSA-8852276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8852276" } ], "reference": [ { "type": "PubMed", "id": "20577264", "url": "https://glygen.org/publication/PubMed/20577264" } ] }, { "title": "Live-cell imaging RNAi screen identifies PP2A-B55alpha and importin-beta1 as key mitotic exit regulators in human cells.", "journal": "Nature cell biology", "date": "2010", "authors": "Schmitz MH, Held M, Janssens V, Hutchins JR, Hudecz O, Ivanova E, Goris J, Trinkle-Mulcahy L, Lamond AI, Poser I, Hyman AA, Mechtler K, Peters JM, Gerlich DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2995383", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2995383" } ], "reference": [ { "type": "PubMed", "id": "20711181", "url": "https://glygen.org/publication/PubMed/20711181" } ] }, { "title": "Mitotic inhibition of GRASP65 organelle tethering involves Polo-like kinase 1 (PLK1) phosphorylation proximate to an internal PDZ ligand.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Sengupta D, Linstedt AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-162658", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162658" } ], "reference": [ { "type": "PubMed", "id": "20937827", "url": "https://glygen.org/publication/PubMed/20937827" } ] }, { "title": "Sororin mediates sister chromatid cohesion by antagonizing Wapl.", "journal": "Cell", "date": "2010", "authors": "Nishiyama T, Ladurner R, Schmitz J, Kreidl E, Schleiffer A, Bhaskara V, Bando M, Shirahige K, Hyman AA, Mechtler K, Peters JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "21111234", "url": "https://glygen.org/publication/PubMed/21111234" } ] }, { "title": "Phosphorylation of Nup98 by multiple kinases is crucial for NPC disassembly during mitotic entry.", "journal": "Cell", "date": "2011", "authors": "Laurell E, Beck K, Krupina K, Theerthagiri G, Bodenmiller B, Horvath P, Aebersold R, Antonin W, Kutay U", "evidence": [ { "database": "Reactome", "id": "R-HSA-3301854", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3301854" } ], "reference": [ { "type": "PubMed", "id": "21335236", "url": "https://glygen.org/publication/PubMed/21335236" } ] }, { "title": "The initial phase of chromosome condensation requires Cdk1-mediated phosphorylation of the CAP-D3 subunit of condensin II.", "journal": "Genes & development", "date": "2011", "authors": "Abe S, Nagasaka K, Hirayama Y, Kozuka-Hata H, Oyama M, Aoyagi Y, Obuse C, Hirota T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514853", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514853" } ], "reference": [ { "type": "PubMed", "id": "21498573", "url": "https://glygen.org/publication/PubMed/21498573" } ] }, { "title": "Nek9 is a Plk1-activated kinase that controls early centrosome separation through Nek6/7 and Eg5.", "journal": "The EMBO journal", "date": "2011", "authors": "Bertran MT, Sdelci S, Regue L, Avruch J, Caelles C, Roig J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2980767", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2980767" } ], "reference": [ { "type": "PubMed", "id": "21642957", "url": "https://glygen.org/publication/PubMed/21642957" } ] }, { "title": "Temporal control of nuclear envelope assembly by phosphorylation of lamin B receptor.", "journal": "Molecular biology of the cell", "date": "2011", "authors": "Tseng LC, Chen RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2995383", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2995383" } ], "reference": [ { "type": "PubMed", "id": "21795390", "url": "https://glygen.org/publication/PubMed/21795390" } ] }, { "title": "Protein phosphatase 2A (B55alpha) prevents premature activation of forkhead transcription factor FoxM1 by antagonizing cyclin A/cyclin-dependent kinase-mediated phosphorylation.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Alvarez-Fernandez M, Halim VA, Aprelia M, Laoukili J, Mohammed S, Medema RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "21813648", "url": "https://glygen.org/publication/PubMed/21813648" } ] }, { "title": "Regulation of sororin by Cdk1-mediated phosphorylation.", "journal": "Journal of cell science", "date": "2011", "authors": "Dreier MR, Bekier ME 2nd, Taylor WR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "21878504", "url": "https://glygen.org/publication/PubMed/21878504" } ] }, { "title": "Interaction of Sororin protein with polo-like kinase 1 mediates resolution of chromosomal arm cohesion.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Zhang N, Panigrahi AK, Mao Q, Pati D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "21987589", "url": "https://glygen.org/publication/PubMed/21987589" } ] }, { "title": "Plk1-dependent phosphorylation of optineurin provides a negative feedback mechanism for mitotic progression.", "journal": "Molecular cell", "date": "2012", "authors": "Kachaner D, Filipe J, Laplantine E, Bauch A, Bennett KL, Superti-Furga G, Israel A, Weil R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2565942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2565942" } ], "reference": [ { "type": "PubMed", "id": "22365832", "url": "https://glygen.org/publication/PubMed/22365832" } ] }, { "title": "The MuvB complex sequentially recruits B-Myb and FoxM1 to promote mitotic gene expression.", "journal": "Genes & development", "date": "2012", "authors": "Sadasivam S, Duan S, DeCaprio JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-156711", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156711" } ], "reference": [ { "type": "PubMed", "id": "22391450", "url": "https://glygen.org/publication/PubMed/22391450" } ] }, { "title": "LATS1/WARTS phosphorylates MYPT1 to counteract PLK1 and regulate mammalian mitotic progression.", "journal": "The Journal of cell biology", "date": "2012", "authors": "Chiyoda T, Sugiyama N, Shimizu T, Naoe H, Kobayashi Y, Ishizawa J, Arima Y, Tsuda H, Ito M, Kaibuchi K, Aoki D, Ishihama Y, Saya H, Kuninaka S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2565942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2565942" } ], "reference": [ { "type": "PubMed", "id": "22641346", "url": "https://glygen.org/publication/PubMed/22641346" } ] }, { "title": "Modular organization of the mammalian Golgi apparatus.", "journal": "Current opinion in cell biology", "date": "2012", "authors": "Nakamura N, Wei JH, Seemann J", "evidence": [ { "database": "Reactome", "id": "R-HSA-162658", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162658" } ], "reference": [ { "type": "PubMed", "id": "22726585", "url": "https://glygen.org/publication/PubMed/22726585" } ] }, { "title": "Coordination of kinase and phosphatase activities by Lem4 enables nuclear envelope reassembly during mitosis.", "journal": "Cell", "date": "2012", "authors": "Asencio C, Davidson IF, Santarella-Mellwig R, Ly-Hartig TB, Mall M, Wallenfang MR, Mattaj IW, Gorjanacz M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2995383", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2995383" } ], "reference": [ { "type": "PubMed", "id": "22770216", "url": "https://glygen.org/publication/PubMed/22770216" } ] }, { "title": "HDAC8 mutations in Cornelia de Lange syndrome affect the cohesin acetylation cycle.", "journal": "Nature", "date": "2012", "authors": "Deardorff MA, Bando M, Nakato R, Watrin E, Itoh T, Minamino M, Saitoh K, Komata M, Katou Y, Clark D, Cole KE, De Baere E, Decroos C, Di Donato N, Ernst S, Francey LJ, Gyftodimou Y, Hirashima K, Hullings M, Ishikawa Y, Jaulin C, Kaur M, Kiyono T, Lombardi PM, Magnaghi-Jaulin L, Mortier GR, Nozaki N, Petersen MB, Seimiya H, Siu VM, Suzuki Y, Takagaki K, Wilde JJ, Willems PJ, Prigent C, Gillessen-Kaesbach G, Christianson DW, Kaiser FJ, Jackson LG, Hirota T, Krantz ID, Shirahige K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "22885700", "url": "https://glygen.org/publication/PubMed/22885700" } ] }, { "title": "The forkhead transcription factor FOXM1 controls cell cycle-dependent gene expression through an atypical chromatin binding mechanism.", "journal": "Molecular and cellular biology", "date": "2013", "authors": "Chen X, Muller GA, Quaas M, Fischer M, Han N, Stutchbury B, Sharrocks AD, Engeland K", "evidence": [ { "database": "Reactome", "id": "R-HSA-156711", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156711" } ], "reference": [ { "type": "PubMed", "id": "23109430", "url": "https://glygen.org/publication/PubMed/23109430" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "O95067", "url": "https://www.uniprot.org/uniprot/O95067" }, { "database": "iPTMnet", "id": "O95067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95067" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "GTSE1 is a microtubule plus-end tracking protein that regulates EB1-dependent cell migration.", "journal": "PloS one", "date": "2012", "authors": "Scolz M, Widlund PO, Piazza S, Bublik DR, Reber S, Peche LY, Ciani Y, Hubner N, Isokane M, Monte M, Ellenberg J, Hyman AA, Schneider C, Bird AW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8852276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8852276" } ], "reference": [ { "type": "PubMed", "id": "23236459", "url": "https://glygen.org/publication/PubMed/23236459" } ] }, { "title": "Novel interactions between FOXM1 and CDC25A regulate the cell cycle.", "journal": "PloS one", "date": "2012", "authors": "Sullivan C, Liu Y, Shen J, Curtis A, Newman C, Hock JM, Li X", "evidence": [ { "database": "Reactome", "id": "R-HSA-156711", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156711" } ], "reference": [ { "type": "PubMed", "id": "23240008", "url": "https://glygen.org/publication/PubMed/23240008" } ] }, { "title": "SIRT2 regulates nuclear envelope reassembly through ANKLE2 deacetylation.", "journal": "Journal of cell science", "date": "2016", "authors": "Kaufmann T, Kukolj E, Brachner A, Beltzung E, Bruno M, Kostrhon S, Opravil S, Hudecz O, Mechtler K, Warren G, Slade D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2995383", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2995383" } ], "reference": [ { "type": "PubMed", "id": "27875273", "url": "https://glygen.org/publication/PubMed/27875273" } ] }, { "title": "CRHBP is degraded via autophagy and exerts anti-hepatocellular carcinoma effects by reducing cyclin B2 expression and dissociating cyclin B2-CDK1 complex.", "journal": "Cancer gene therapy", "date": "2022", "authors": "Wang Z, Li M, Liu Y, Qiao Z, Yang L, Liu B, Bai T", "evidence": [ { "database": "RefSeq", "id": "NP_004692", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004692" } ], "reference": [ { "type": "PubMed", "id": "35082401", "url": "https://glygen.org/publication/PubMed/35082401" } ] }, { "title": "Mad2 promotes Cyclin B2 recruitment to the kinetochore for guiding accurate mitotic checkpoint.", "journal": "EMBO reports", "date": "2022", "authors": "Liu S, Yuan X, Gui P, Liu R, Durojaye O, Hill DL, Fu C, Yao X, Dou Z, Liu X", "evidence": [ { "database": "RefSeq", "id": "NP_004692", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004692" } ], "reference": [ { "type": "PubMed", "id": "35384228", "url": "https://glygen.org/publication/PubMed/35384228" } ] }, { "title": "Hsa_circ_0000285 knockdown inhibits the progression of hepatocellular carcinoma by sponging miR-582-3p to regulate CCNB2 expression.", "journal": "Human & experimental toxicology", "date": "2022", "authors": "Huang J, Zhou H, Diao Y, Yang Z", "evidence": [ { "database": "RefSeq", "id": "NP_004692", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004692" } ], "reference": [ { "type": "PubMed", "id": "35839486", "url": "https://glygen.org/publication/PubMed/35839486" } ] }, { "title": "Cyclin B2 impairs the p53 signaling in nasopharyngeal carcinoma.", "journal": "BMC cancer", "date": "2024-01-02", "authors": "Liu Qinsong, Yuan Yong, Shang Xiaofen, Xin Lu", "evidence": [ { "database": "RefSeq", "id": "NP_004692", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004692" } ], "reference": [ { "type": "PubMed", "id": "38166895", "url": "https://glygen.org/publication/PubMed/38166895" } ] }, { "title": "Prognostic value of cyclin B1 and cyclin B2 expression in breast cancer: A systematic review and updated meta-analysis.", "journal": "Medicine", "date": "2024-01-19", "authors": "Kang Jeongwan, Jung Hera, Kim Hyunchul", "evidence": [ { "database": "RefSeq", "id": "NP_004692", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004692" } ], "reference": [ { "type": "PubMed", "id": "38241547", "url": "https://glygen.org/publication/PubMed/38241547" } ] }, { "title": "Human cyclins B1 and B2 are localized to strikingly different structures: B1 to microtubules, B2 primarily to the Golgi apparatus.", "journal": "The EMBO journal", "date": "1995", "authors": "Jackman M, Firth M, Pines J", "evidence": [ { "database": "Reactome", "id": "R-HSA-162658", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162658" } ], "reference": [ { "type": "PubMed", "id": "7737117", "url": "https://glygen.org/publication/PubMed/7737117" } ] }, { "title": "Effects of phosphorylation by CAK on cyclin binding by CDC2 and CDK2.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "Desai D, Wessling HC, Fisher RP, Morgan DO", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "7799941", "url": "https://glygen.org/publication/PubMed/7799941" } ] }, { "title": "Activation of p34cdc2 protein kinase by microinjection of human cdc25C into mammalian cells. Requirement for prior phosphorylation of cdc25C by p34cdc2 on sites phosphorylated at mitosis.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Strausfeld U, Fernandez A, Capony JP, Girard F, Lautredou N, Derancourt J, Labbe JC, Lamb NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "8119945", "url": "https://glygen.org/publication/PubMed/8119945" } ] }, { "title": "Human Wee1 kinase inhibits cell division by phosphorylating p34cdc2 exclusively on Tyr15.", "journal": "The EMBO journal", "date": "1993", "authors": "McGowan CH, Russell P", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "8428596", "url": "https://glygen.org/publication/PubMed/8428596" } ] }, { "title": "Dephosphorylation of human p34cdc2 kinase on both Thr-14 and Tyr-15 by human cdc25B phosphatase.", "journal": "FEBS letters", "date": "1993", "authors": "Honda R, Ohba Y, Nagata A, Okayama H, Yasuda H", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "8440392", "url": "https://glygen.org/publication/PubMed/8440392" } ] }, { "title": "Purification and molecular cloning of Plx1, a Cdc25-regulatory kinase from Xenopus egg extracts.", "journal": "Science (New York, N.Y.)", "date": "1996", "authors": "Kumagai A, Dunphy WG", "evidence": [ { "database": "Reactome", "id": "R-HSA-156711", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156711" } ], "reference": [ { "type": "PubMed", "id": "8703070", "url": "https://glygen.org/publication/PubMed/8703070" } ] }, { "title": "The human Myt1 kinase preferentially phosphorylates Cdc2 on threonine 14 and localizes to the endoplasmic reticulum and Golgi complex.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Liu F, Stanton JJ, Wu Z, Piwnica-Worms H", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "9001210", "url": "https://glygen.org/publication/PubMed/9001210" } ] }, { "title": "The vesicle docking protein p115 binds GM130, a cis-Golgi matrix protein, in a mitotically regulated manner.", "journal": "Cell", "date": "1997", "authors": "Nakamura N, Lowe M, Levine TP, Rabouille C, Warren G", "evidence": [ { "database": "Reactome", "id": "R-HSA-162658", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162658" } ], "reference": [ { "type": "PubMed", "id": "9150144", "url": "https://glygen.org/publication/PubMed/9150144" } ] }, { "title": "Identification of Xenopus SMC protein complexes required for sister chromatid cohesion.", "journal": "Genes & development", "date": "1998", "authors": "Losada A, Hirano M, Hirano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "9649503", "url": "https://glygen.org/publication/PubMed/9649503" } ] }, { "title": "MPF localization is controlled by nuclear export.", "journal": "The EMBO journal", "date": "1998", "authors": "Hagting A, Karlsson C, Clute P, Jackman M, Pines J", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "9670027", "url": "https://glygen.org/publication/PubMed/9670027" } ] }, { "title": "Control of cyclin B1 localization through regulated binding of the nuclear export factor CRM1.", "journal": "Genes & development", "date": "1998", "authors": "Yang J, Bardes ES, Moore JD, Brennan J, Powers MA, Kornbluth S", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "9679058", "url": "https://glygen.org/publication/PubMed/9679058" } ] }, { "title": "Cdc2 kinase directly phosphorylates the cis-Golgi matrix protein GM130 and is required for Golgi fragmentation in mitosis.", "journal": "Cell", "date": "1998", "authors": "Lowe M, Rabouille C, Nakamura N, Watson R, Jackman M, Jamsa E, Rahman D, Pappin DJ, Warren G", "evidence": [ { "database": "Reactome", "id": "R-HSA-162658", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162658" } ], "reference": [ { "type": "PubMed", "id": "9753325", "url": "https://glygen.org/publication/PubMed/9753325" } ] }, { "title": "Phosphorylation and activation of 13S condensin by Cdc2 in vitro.", "journal": "Science (New York, N.Y.)", "date": "1998", "authors": "Kimura K, Hirano M, Kobayashi R, Hirano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2514853", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514853" } ], "reference": [ { "type": "PubMed", "id": "9774278", "url": "https://glygen.org/publication/PubMed/9774278" } ] }, { "title": "Overexpression of ErbB2 blocks Taxol-induced apoptosis by upregulation of p21Cip1, which inhibits p34Cdc2 kinase.", "journal": "Molecular cell", "date": "1998", "authors": "Yu D, Jing T, Liu B, Yao J, Tan M, McDonnell TJ, Hung MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8852276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8852276" } ], "reference": [ { "type": "PubMed", "id": "9844631", "url": "https://glygen.org/publication/PubMed/9844631" } ] } ], "pathway": [ { "id": "hsa:9133", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9133", "resource": "KEGG Pathway" }, { "id": "R-HSA-156711", "name": "Polo-like kinase mediated events", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156711", "resource": "Reactome", "description": "Polo-like kinase mediated events" }, { "id": "R-HSA-162658", "name": "Golgi Cisternae Pericentriolar Stack Reorganization", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162658", "resource": "Reactome", "description": "Golgi Cisternae Pericentriolar Stack Reorganization" }, { "id": "R-HSA-2500257", "name": "Resolution of Sister Chromatid Cohesion", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257", "resource": "Reactome", "description": "Resolution of Sister Chromatid Cohesion" }, { "id": "R-HSA-2514853", "name": "Condensation of Prometaphase Chromosomes", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514853", "resource": "Reactome", "description": "Condensation of Prometaphase Chromosomes" }, { "id": "R-HSA-2565942", "name": "Regulation of PLK1 Activity at G2/M Transition", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2565942", "resource": "Reactome", "description": "Regulation of PLK1 Activity at G2/M Transition" }, { "id": "R-HSA-2980767", "name": "Activation of NIMA Kinases NEK9, NEK6, NEK7", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2980767", "resource": "Reactome", "description": "Activation of NIMA Kinases NEK9, NEK6, NEK7" }, { "id": "R-HSA-2995383", "name": "Initiation of Nuclear Envelope (NE) Reformation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2995383", "resource": "Reactome", "description": "Initiation of Nuclear Envelope (NE) Reformation" }, { "id": "R-HSA-3301854", "name": "Nuclear Pore Complex (NPC) Disassembly", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3301854", "resource": "Reactome", "description": "Nuclear Pore Complex (NPC) Disassembly" }, { "id": "R-HSA-69273", "name": "Cyclin A/B1/B2 associated events during G2/M transition", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273", "resource": "Reactome", "description": "Cyclin A/B1/B2 associated events during G2/M transition" }, { "id": "R-HSA-69478", "name": "G2/M DNA replication checkpoint", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69478", "resource": "Reactome", "description": "G2/M DNA replication checkpoint" }, { "id": "R-HSA-8852276", "name": "The role of GTSE1 in G2/M progression after G2 checkpoint", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8852276", "resource": "Reactome", "description": "The role of GTSE1 in G2/M progression after G2 checkpoint" } ], "orthologs": [ { "uniprot_canonical_ac": "P30276-1", "protein_name": "G2/mitotic-specific cyclin-B2", "gene_name": "Ccnb2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MALLRRPTVSSDLKNIDTEVIPKAKSHVTIRRAVLEEIGNKVRNRTTQVAKKPQNTKVPALPTKVTNVNKQPKPTASVKPVQMEALAPKDRPPAPEDVSMKEESLCQAFSDALLCKIEDIDNEDRENPQLCSDYVKDIYQYLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKFRLLQETLYMCIAIMDRFLQAQLVCRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLVDYDMVHYHPSQVAAAASCLSQKVLGQGKWNLKQQYYTGYMESEVLEVMQHMAKNVVKVNDNRTKFIAVKNKYASSRLLKISTIPQLNSKIIKDLASPLLGSP", "length": 398 }, "evidence": [ { "id": "45918034", "url": "http://www.informatics.jax.org/homology/45918034", "database": "MGI" }, { "id": "O95067", "url": "https://omabrowser.org/oma/group/O95067/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q5M857-1", "protein_name": "G2/mitotic-specific cyclin-B2", "gene_name": "Ccnb2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MALLRRPTVSSDLKNIDTGVNPKAKSHVTVRRAVLEEIGNKVRARPAQVAKKPQNTKVPVQPTKAINASKQPKPTASVKPVQMETLAPKDPLPAPEDVSMKEESLCQAFSDALLCKIEDIDNEDGENPQLCSDYVKDIYQYLRQLEALQSINPHFLDGRDINGRMRAILVDWLVQVHSKFRLLQETLYMCIAIMDRFLQAQPVCRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLVDYDMVHYHPSQVAAAASCLSQKVLGQGKWNLKQQYYTGYMESEILEVMQHMAKNVVKVNENLTKFIAVKNKYASSRLLKISTIPQLNSRTIKDLASPLMGRP", "length": 398 }, "evidence": [ { "id": "O95067", "url": "https://omabrowser.org/oma/group/O95067/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "mitotic cell cycle phase transition", "id": "GO:0044772", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044772", "evidence": [ { "database": "UniProtKB", "id": "O95067", "url": "https://www.uniprot.org/uniprot/O95067" } ], "pmid": "" }, { "name": "cell division", "id": "GO:0051301", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051301", "evidence": [ { "database": "UniProtKB", "id": "O95067", "url": "https://www.uniprot.org/uniprot/O95067" } ], "pmid": "" }, { "name": "in utero embryonic development", "id": "GO:0001701", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001701", "evidence": [ { "database": "UniProtKB", "id": "O95067", "url": "https://www.uniprot.org/uniprot/O95067" } ], "pmid": "" }, { "name": "regulation of growth", "id": "GO:0040008", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0040008", "evidence": [ { "database": "UniProtKB", "id": "O95067", "url": "https://www.uniprot.org/uniprot/O95067" } ], "pmid": "" }, { "name": "thymus development", "id": "GO:0048538", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048538", "evidence": [ { "database": "UniProtKB", "id": "O95067", "url": "https://www.uniprot.org/uniprot/O95067" } ], "pmid": "" }, { "name": "T cell homeostasis", "id": "GO:0043029", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043029", "evidence": [ { "database": "UniProtKB", "id": "O95067", "url": "https://www.uniprot.org/uniprot/O95067" } ], "pmid": "" }, { "name": "spindle assembly involved in female meiosis I", "id": "GO:0007057", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007057", "evidence": [ { "database": "UniProtKB", "id": "O95067", "url": "https://www.uniprot.org/uniprot/O95067" } ], "pmid": "" }, { "name": "G2/MI transition of meiotic cell cycle", "id": "GO:0008315", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008315", "evidence": [ { "database": "UniProtKB", "id": "O95067", "url": "https://www.uniprot.org/uniprot/O95067" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "cyclin-dependent protein serine/threonine kinase regulator activity", "id": "GO:0016538", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016538", "evidence": [ { "database": "UniProtKB", "id": "O95067", "url": "https://www.uniprot.org/uniprot/O95067" } ], "pmid": "" }, { "name": "cadherin binding", "id": "GO:0045296", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045296", "evidence": [ { "database": "UniProtKB", "id": "O95067", "url": "https://www.uniprot.org/uniprot/O95067" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O95067", "url": "https://www.uniprot.org/uniprot/O95067" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O95067", "url": "https://www.uniprot.org/uniprot/O95067" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O95067", "url": "https://www.uniprot.org/uniprot/O95067" } ], "pmid": "" }, { "name": "centrosome", "id": "GO:0005813", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005813", "evidence": [ { "database": "UniProtKB", "id": "O95067", "url": "https://www.uniprot.org/uniprot/O95067" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O95067", "url": "https://www.uniprot.org/uniprot/O95067" } ], "pmid": "" }, { "name": "microtubule cytoskeleton", "id": "GO:0015630", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015630", "evidence": [ { "database": "UniProtKB", "id": "O95067", "url": "https://www.uniprot.org/uniprot/O95067" } ], "pmid": "" }, { "name": "cyclin-dependent protein kinase holoenzyme complex", "id": "GO:0000307", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000307", "evidence": [ { "database": "UniProtKB", "id": "O95067", "url": "https://www.uniprot.org/uniprot/O95067" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 357, "end_pos": 359, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 8, 11, 77, 92, 94, 99, 204, 392, 398 ], "sequon_annotation_sites": [ { "start_pos": 357, "end_pos": 359 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 9 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 136 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }