{ "uniprot_canonical_ac": "O94956-1", "uniprot_ac": "O94956", "uniprot_id": "SO2B1_HUMAN", "mass": { "chemical_mass": 76699.0, "monoisotopic_mass": 76699.0 }, "refseq": { "ac": "NP_001138683", "name": "solute carrier organic anion transporter family member 2B1 isoform 2", "summary": "This locus encodes a member of the organic anion-transporting polypeptide family of membrane proteins. The protein encoded by this locus may function in regulation of placental uptake of sulfated steroids. Alternatively spliced transcript variants have been described. [provided by RefSeq, Nov 2010].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138683" }, "gene_names": [ { "name": "SLCO2B1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O94956", "id": "O94956" }, { "name": "KIAA0880", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O94956", "id": "O94956" }, { "name": "OATP-B; OATP2B1; OATPB; SLC21A9", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138683", "id": "NP_001138683" }, { "name": "OATP2B1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O94956", "id": "O94956" }, { "name": "OATPB", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O94956", "id": "O94956" }, { "name": "SLC21A9", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O94956", "id": "O94956" }, { "name": "SLCO2B1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138683", "id": "NP_001138683" } ], "protein_names": [ { "name": "Solute carrier organic anion transporter family member 2B1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O94956" }, { "name": "OATP-B", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O94956" }, { "name": "OATP-RP2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O94956" }, { "name": "OATP2B1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O94956" }, { "name": "OATPRP2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O94956" }, { "name": "Organic anion transporter B", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O94956" }, { "name": "Organic anion transporter polypeptide-related protein 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O94956" }, { "name": "Organic anion transporting polypeptide 2B1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O94956" }, { "name": "Solute carrier family 21 member 9", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O94956" }, { "name": "solute carrier family 21 (organic anion transporter), member 9; OATP-RP2; organic anion transporter B; organic anion transporter polypeptide-related protein 2; organic anion transporting polypeptide 2B1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138683", "id": "NP_001138683" }, { "name": "solute carrier organic anion transporter family member 2B1 isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138683", "id": "NP_001138683" } ], "function": [ { "annotation": "Association of genetic polymorphisms with local steroid metabolism in human benign breasts.", "evidence": [ { "database": "RefSeq", "id": "NP_001138683", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138683" }, { "database": "PubMed", "id": "34762930", "url": "https://glygen.org/publication/PubMed/34762930" } ] }, { "annotation": "Genetic Polymorphisms in SLCO2B1 and ABCC1 Conjointly Modulate Atorvastatin Intracellular Accumulation in HEK293 Recombinant Cell Lines.", "evidence": [ { "database": "RefSeq", "id": "NP_001138683", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138683" }, { "database": "PubMed", "id": "36253893", "url": "https://glygen.org/publication/PubMed/36253893" } ] }, { "annotation": "Genetic polymorphisms: allele frequencies in the Japanese population and functional analysis GeneRIF: Observational study of genotype prevalence. (HuGE Navigator)", "evidence": [ { "database": "RefSeq", "id": "NP_001138683", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138683" }, { "database": "PubMed", "id": "12130747", "url": "https://glygen.org/publication/PubMed/12130747" } ] }, { "annotation": "Has estrone 3-sulfate (E1S) transport activity comparable with the full-length isoform 1.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956#function" }, { "database": "PubMed", "id": "23531488", "url": "https://glygen.org/publication/PubMed/23531488" } ] }, { "annotation": "Mediates the Na(+)-independent transport of steroid sulfate conjugates and other specific organic anions (PubMed:10873595, PubMed:11159893, PubMed:11932330, PubMed:12724351, PubMed:14610227, PubMed:16908597, PubMed:18501590, PubMed:20507927, PubMed:22201122, PubMed:23531488, PubMed:25132355, PubMed:27576593, PubMed:26383540, PubMed:28408210, PubMed:29871943, PubMed:34628357). Responsible for the transport of estrone 3-sulfate (E1S) through the basal membrane of syncytiotrophoblast, highlighting a potential role in the placental absorption of fetal-derived sulfated steroids including the steroid hormone precursor dehydroepiandrosterone sulfate (DHEA-S) (PubMed:11932330, PubMed:12409283). Also facilitates the uptake of sulfated steroids at the basal/sinusoidal membrane of hepatocytes, therefore accounting for the major part of organic anions clearance of liver (PubMed:11159893). Mediates the intestinal uptake of sulfated steroids (PubMed:12724351, PubMed:28408210). Mediates the uptake of the neurosteroids DHEA-S and pregnenolone sulfate (PregS) into the endothelial cells of the blood-brain barrier as the first step to enter the brain (PubMed:16908597, PubMed:25132355). Also plays a role in the reuptake of neuropeptides such as substance P/TAC1 and vasoactive intestinal peptide/VIP released from retinal neurons (PubMed:25132355). May act as a heme transporter that promotes cellular iron availability via heme oxygenase/HMOX2 and independently of TFRC (PubMed:35714613). Also transports heme by-product coproporphyrin III (CPIII), and may be involved in their hepatic disposition (PubMed:26383540). Mediates the uptake of other substrates such as prostaglandins D2 (PGD2), E1 (PGE1) and E2 (PGE2), taurocholate, L-thyroxine, leukotriene C4 and thromboxane B2 (PubMed:10873595, PubMed:14610227, PubMed:19129463, Ref.25, PubMed:29871943). May contribute to regulate the transport of organic compounds in testis across the blood-testis-barrier (Probable). Shows a pH-sensitive substrate specificity which may be ascribed to the protonation state of the binding site and leads to a stimulation of substrate transport in an acidic microenvironment (PubMed:14610227, PubMed:19129463, PubMed:22201122). The exact transport mechanism has not been yet deciphered but most likely involves an anion exchange, coupling the cellular uptake of organic substrate with the efflux of an anionic compound (PubMed:19129463, PubMed:20507927, PubMed:26277985). Hydrogencarbonate/HCO3(-) acts as a probable counteranion that exchanges for organic anions (PubMed:19129463). Cytoplasmic glutamate may also act as counteranion in the placenta (PubMed:26277985). An inwardly directed proton gradient has also been proposed as the driving force of E1S uptake with a (H(+):E1S) stoichiometry of (1:1) (PubMed:20507927).", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956#function" }, { "database": "PubMed", "id": "23531488", "url": "https://glygen.org/publication/PubMed/23531488" }, { "database": "PubMed", "id": "10873595", "url": "https://glygen.org/publication/PubMed/10873595" }, { "database": "PubMed", "id": "29871943", "url": "https://glygen.org/publication/PubMed/29871943" }, { "database": "PubMed", "id": "11159893", "url": "https://glygen.org/publication/PubMed/11159893" }, { "database": "PubMed", "id": "27576593", "url": "https://glygen.org/publication/PubMed/27576593" }, { "database": "PubMed", "id": "11932330", "url": "https://glygen.org/publication/PubMed/11932330" }, { "database": "PubMed", "id": "12724351", "url": "https://glygen.org/publication/PubMed/12724351" }, { "database": "PubMed", "id": "12409283", "url": "https://glygen.org/publication/PubMed/12409283" }, { "database": "UniProtKB", "id": "SIPDA64B7C8FDC16680", "url": "https://www.uniprot.org/uniprot/SIPDA64B7C8FDC16680#function" }, { "database": "PubMed", "id": "22201122", "url": "https://glygen.org/publication/PubMed/22201122" }, { "database": "PubMed", "id": "18501590", "url": "https://glygen.org/publication/PubMed/18501590" }, { "database": "PubMed", "id": "14610227", "url": "https://glygen.org/publication/PubMed/14610227" }, { "database": "PubMed", "id": "26277985", "url": "https://glygen.org/publication/PubMed/26277985" }, { "database": "PubMed", "id": "26383540", "url": "https://glygen.org/publication/PubMed/26383540" }, { "database": "PubMed", "id": "25132355", "url": "https://glygen.org/publication/PubMed/25132355" }, { "database": "PubMed", "id": "34628357", "url": "https://glygen.org/publication/PubMed/34628357" }, { "database": "PubMed", "id": "35307651", "url": "https://glygen.org/publication/PubMed/35307651" }, { "database": "PubMed", "id": "35714613", "url": "https://glygen.org/publication/PubMed/35714613" }, { "database": "PubMed", "id": "19129463", "url": "https://glygen.org/publication/PubMed/19129463" }, { "database": "PubMed", "id": "20507927", "url": "https://glygen.org/publication/PubMed/20507927" }, { "database": "PubMed", "id": "16908597", "url": "https://glygen.org/publication/PubMed/16908597" } ] }, { "annotation": "This locus encodes a member of the organic anion-transporting polypeptide family of membrane proteins. The protein encoded by this locus may function in regulation of placental uptake of sulfated steroids. Alternatively spliced transcript variants have been described. [provided by RefSeq, Nov 2010].", "evidence": [ { "database": "RefSeq", "id": "NP_001138683", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138683" } ] }, { "annotation": "Uptake of steroid sulfates by isolated trophoblasts is mediated by OATP-B and OAT-4 suggesting a physiological role of both carrier proteins in placental uptake of fetal-derived steroid sulfates.", "evidence": [ { "database": "RefSeq", "id": "NP_001138683", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138683" }, { "database": "PubMed", "id": "12409283", "url": "https://glygen.org/publication/PubMed/12409283" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 113, "end_pos": 113, "sequence_org": "H", "sequence_mut": "Q", "comment": "Decreased low-affinity transport of E1S; no change in high-affinity transport of E1S.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ] }, { "start_pos": 136, "end_pos": 136, "sequence_org": "H", "sequence_mut": "Q", "comment": "Decreased low-affinity transport of E1S; no change in high-affinity transport of E1S.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ] }, { "start_pos": 185, "end_pos": 185, "sequence_org": "H", "sequence_mut": "Q", "comment": "Increased low- and high-affinity transport of E1S.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ] }, { "start_pos": 219, "end_pos": 219, "sequence_org": "H", "sequence_mut": "Q", "comment": "Decreased low- and high-affinity transport of E1S.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ] }, { "start_pos": 272, "end_pos": 272, "sequence_org": "W", "sequence_mut": "A", "comment": "Decreased E1S transport; decreased cell surface expression. Strong decrease in cell surface expression; when associated with A-276 and A-277.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "27576593", "url": "https://glygen.org/publication/PubMed/27576593" } ] }, { "start_pos": 272, "end_pos": 272, "sequence_org": "W", "sequence_mut": "F", "comment": "No change in E1S transport; decreased cell surface expression.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "27576593", "url": "https://glygen.org/publication/PubMed/27576593" } ] }, { "start_pos": 276, "end_pos": 276, "sequence_org": "W", "sequence_mut": "A", "comment": "Decreased E1S transport; decreased cell surface expression. Strong decrease in cell surface expression; when associated with A-272 and A-277.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "27576593", "url": "https://glygen.org/publication/PubMed/27576593" } ] }, { "start_pos": 276, "end_pos": 276, "sequence_org": "W", "sequence_mut": "F", "comment": "Decreased E1S transport; decreased cell surface expression.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "27576593", "url": "https://glygen.org/publication/PubMed/27576593" } ] }, { "start_pos": 277, "end_pos": 277, "sequence_org": "W", "sequence_mut": "A", "comment": "Decreased E1S transport; decreased cell surface expression. Strong decrease in cell surface expression; when associated with A-272 and A-276.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "27576593", "url": "https://glygen.org/publication/PubMed/27576593" } ] }, { "start_pos": 277, "end_pos": 277, "sequence_org": "W", "sequence_mut": "F", "comment": "Decreased E1S transport; decreased cell surface expression.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "27576593", "url": "https://glygen.org/publication/PubMed/27576593" } ] }, { "start_pos": 370, "end_pos": 370, "sequence_org": "H", "sequence_mut": "Q", "comment": "No change in low- and high-affinity transport of E1S.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ] }, { "start_pos": 436, "end_pos": 436, "sequence_org": "H", "sequence_mut": "Q", "comment": "Decreased low-affinity transport of E1S; no change in high affinity transport of E1S.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ] }, { "start_pos": 468, "end_pos": 468, "sequence_org": "H", "sequence_mut": "Q", "comment": "Decreased high-affinity transport of E1S; no change in low-affinity transport of E1S.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ] }, { "start_pos": 46, "end_pos": 46, "sequence_org": "H", "sequence_mut": "Q", "comment": "No change in low- and high-affinity transport of E1S.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ] }, { "start_pos": 475, "end_pos": 475, "sequence_org": "H", "sequence_mut": "Q", "comment": "Increased high-affinity transport of E1S; decreased low-affinity transport of E1S.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ] }, { "start_pos": 480, "end_pos": 480, "sequence_org": "H", "sequence_mut": "Q", "comment": "No change in low- and high-affinity transport of E1S.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ] }, { "start_pos": 49, "end_pos": 49, "sequence_org": "K", "sequence_mut": "A", "comment": "Decreased E1S transport, no change in cell surface expression.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "29871943", "url": "https://glygen.org/publication/PubMed/29871943" } ] }, { "start_pos": 50, "end_pos": 50, "sequence_org": "L", "sequence_mut": "A", "comment": "No change in E1S transport.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "29871943", "url": "https://glygen.org/publication/PubMed/29871943" } ] }, { "start_pos": 517, "end_pos": 517, "sequence_org": "H", "sequence_mut": "Q", "comment": "Decreased low-affinity transport of E1S; no change in high-affinity transport of E1S.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ] }, { "start_pos": 51, "end_pos": 51, "sequence_org": "F", "sequence_mut": "A", "comment": "Decreased E1S transport; decreased cell surface expression; no change in Km and Vmax values. Decreased taurocholate transport.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "29871943", "url": "https://glygen.org/publication/PubMed/29871943" } ] }, { "start_pos": 51, "end_pos": 51, "sequence_org": "F", "sequence_mut": "Y", "comment": "Decreased E1S transport; decreased cell surface expression.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "29871943", "url": "https://glygen.org/publication/PubMed/29871943" } ] }, { "start_pos": 523, "end_pos": 523, "sequence_org": "W", "sequence_mut": "A", "comment": "No change in E1S transport; no change in cell surface expression.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "27576593", "url": "https://glygen.org/publication/PubMed/27576593" } ] }, { "start_pos": 52, "end_pos": 52, "sequence_org": "V", "sequence_mut": "A", "comment": "Decreased E1S transport, decreased cell surface expression; no change in Km value and decreased Vmax value. Decreased taurocholate transport.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "29871943", "url": "https://glygen.org/publication/PubMed/29871943" } ] }, { "start_pos": 52, "end_pos": 52, "sequence_org": "V", "sequence_mut": "I", "comment": "Decreased E1S transport.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "29871943", "url": "https://glygen.org/publication/PubMed/29871943" } ] }, { "start_pos": 53, "end_pos": 53, "sequence_org": "L", "sequence_mut": "A", "comment": "No change in E1S transport.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "29871943", "url": "https://glygen.org/publication/PubMed/29871943" } ] }, { "start_pos": 54, "end_pos": 54, "sequence_org": "C", "sequence_mut": "A", "comment": "No change in E1S transport.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "29871943", "url": "https://glygen.org/publication/PubMed/29871943" } ] }, { "start_pos": 55, "end_pos": 55, "sequence_org": "H", "sequence_mut": "A", "comment": "Decreased E1S transport, decreased cell surface expression; no change in Km value and decreased Vmax value for E1S transport activity. Decreased taurocholate transport.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "29871943", "url": "https://glygen.org/publication/PubMed/29871943" } ] }, { "start_pos": 55, "end_pos": 55, "sequence_org": "H", "sequence_mut": "K", "comment": "Decreased E1S transport; decreased cell surface expression.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "29871943", "url": "https://glygen.org/publication/PubMed/29871943" } ] }, { "start_pos": 55, "end_pos": 55, "sequence_org": "H", "sequence_mut": "Q", "comment": "Decreased low- and high-affinity transport of E1S.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ] }, { "start_pos": 56, "end_pos": 56, "sequence_org": "S", "sequence_mut": "A", "comment": "Decreased E1S transport.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "29871943", "url": "https://glygen.org/publication/PubMed/29871943" } ] }, { "start_pos": 579, "end_pos": 579, "sequence_org": "H", "sequence_mut": "Q", "comment": "Strong decrease in low-affinity and decreased in high-affinity transport of E1S; undetectable kinetic parameter for low-affinity and no change in Vmax/Km value for high-affinity transort. Increased PGE2 transport. Decreased in low- and high-affinity transport of E1S and lower Vmax/Km values; when associated with Q-618.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ] }, { "start_pos": 57, "end_pos": 57, "sequence_org": "L", "sequence_mut": "A", "comment": "Decreased E1S transport.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "29871943", "url": "https://glygen.org/publication/PubMed/29871943" } ] }, { "start_pos": 58, "end_pos": 58, "sequence_org": "L", "sequence_mut": "A", "comment": "Decreased E1S transport, no change in cell surface expression; increased Km value and decreased Vmax value for E1S transport activity. Decreased taurocholate transport.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "29871943", "url": "https://glygen.org/publication/PubMed/29871943" } ] }, { "start_pos": 58, "end_pos": 58, "sequence_org": "L", "sequence_mut": "I", "comment": "Decreased E1S transport.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "29871943", "url": "https://glygen.org/publication/PubMed/29871943" } ] }, { "start_pos": 59, "end_pos": 59, "sequence_org": "Q", "sequence_mut": "A", "comment": "Decreased E1S transport, no change in cell surface expression; no change in Km value and decreased Vmax value for E1S transport activity. Decreased taurocholate transport.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "29871943", "url": "https://glygen.org/publication/PubMed/29871943" } ] }, { "start_pos": 59, "end_pos": 59, "sequence_org": "Q", "sequence_mut": "N", "comment": "Decreased E1S transport.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "29871943", "url": "https://glygen.org/publication/PubMed/29871943" } ] }, { "start_pos": 607, "end_pos": 607, "sequence_org": "R", "sequence_mut": "A", "comment": "Loss of E1S transport; small decrease in cell surface expression. Strong decrease in low-affinity transport of E1S and loss of high-affinity transport of E1S. Decreased PGE2 transport.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "27576593", "url": "https://glygen.org/publication/PubMed/27576593" } ] }, { "start_pos": 60, "end_pos": 60, "sequence_org": "L", "sequence_mut": "A", "comment": "No change in E1S transport.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "29871943", "url": "https://glygen.org/publication/PubMed/29871943" } ] }, { "start_pos": 611, "end_pos": 611, "sequence_org": "W", "sequence_mut": "A", "comment": "Decreased E1S transport; decreased cell surface expression.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "27576593", "url": "https://glygen.org/publication/PubMed/27576593" } ] }, { "start_pos": 611, "end_pos": 611, "sequence_org": "W", "sequence_mut": "F", "comment": "Decreased E1S transport; decreased cell surface expression.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "27576593", "url": "https://glygen.org/publication/PubMed/27576593" } ] }, { "start_pos": 611, "end_pos": 611, "sequence_org": "W", "sequence_mut": "H", "comment": "Decreased E1S transport; decreased cell surface expression.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "27576593", "url": "https://glygen.org/publication/PubMed/27576593" } ] }, { "start_pos": 611, "end_pos": 611, "sequence_org": "W", "sequence_mut": "S", "comment": "Decreased E1S transport; decreased cell surface expression.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "27576593", "url": "https://glygen.org/publication/PubMed/27576593" } ] }, { "start_pos": 611, "end_pos": 611, "sequence_org": "W", "sequence_mut": "Y", "comment": "Decreased E1S transport; decreased cell surface expression.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "27576593", "url": "https://glygen.org/publication/PubMed/27576593" } ] }, { "start_pos": 618, "end_pos": 618, "sequence_org": "H", "sequence_mut": "Q", "comment": "Strong decrease in high-affinity transport of E1S and lower Vmax/Km value; no change in low-affinity transport of E1S and higher Vmax/Km value. No change in PGE2 transport. Decreased in low- and high-affinity transport of E1S and lower Vmax/Km values; when associated with Q-579.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ] }, { "start_pos": 61, "end_pos": 61, "sequence_org": "A", "sequence_mut": "V", "comment": "Decreased E1S transport, no change in cell surface expression, increased Km value and decreased Vmax value for E1S transport activity. Decreased taurocholate transport.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "29871943", "url": "https://glygen.org/publication/PubMed/29871943" } ] }, { "start_pos": 628, "end_pos": 628, "sequence_org": "H", "sequence_mut": "Q", "comment": "Decreased low- and high-affinity transport of E1S.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ] }, { "start_pos": 629, "end_pos": 629, "sequence_org": "W", "sequence_mut": "A", "comment": "No change in E1S transport; decreased cell surface expression.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "27576593", "url": "https://glygen.org/publication/PubMed/27576593" } ] }, { "start_pos": 62, "end_pos": 62, "sequence_org": "Q", "sequence_mut": "A", "comment": "Decreased E1S transport, no change in cell surface expression; no change in Km value and decreased Vmax value for E1S transport activity. Decreased taurocholate transport.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "29871943", "url": "https://glygen.org/publication/PubMed/29871943" } ] }, { "start_pos": 62, "end_pos": 62, "sequence_org": "Q", "sequence_mut": "N", "comment": "Decreased E1S transport; no change in cell surface expression.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "29871943", "url": "https://glygen.org/publication/PubMed/29871943" } ] }, { "start_pos": 63, "end_pos": 63, "sequence_org": "L", "sequence_mut": "A", "comment": "Decreased E1S transport.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "29871943", "url": "https://glygen.org/publication/PubMed/29871943" } ] }, { "start_pos": 64, "end_pos": 64, "sequence_org": "M", "sequence_mut": "A", "comment": "No change in E1S transport.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "29871943", "url": "https://glygen.org/publication/PubMed/29871943" } ] }, { "start_pos": 65, "end_pos": 65, "sequence_org": "I", "sequence_mut": "A", "comment": "Decreased E1S transport, no change in cell surface expression.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "29871943", "url": "https://glygen.org/publication/PubMed/29871943" } ] }, { "start_pos": 66, "end_pos": 66, "sequence_org": "S", "sequence_mut": "A", "comment": "Decreased E1S transport, no change in cell surface expression, increased Km value and decreased Vmax value for E1S transport activity. Decreased taurocholate transport.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "29871943", "url": "https://glygen.org/publication/PubMed/29871943" } ] }, { "start_pos": 66, "end_pos": 66, "sequence_org": "S", "sequence_mut": "T", "comment": "Decreased E1S transport.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "29871943", "url": "https://glygen.org/publication/PubMed/29871943" } ] }, { "start_pos": 67, "end_pos": 67, "sequence_org": "G", "sequence_mut": "A", "comment": "Decreased E1S transport.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "29871943", "url": "https://glygen.org/publication/PubMed/29871943" } ] }, { "start_pos": 68, "end_pos": 68, "sequence_org": "Y", "sequence_mut": "A", "comment": "No change in E1S transport.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "29871943", "url": "https://glygen.org/publication/PubMed/29871943" } ] }, { "start_pos": 69, "end_pos": 69, "sequence_org": "L", "sequence_mut": "A", "comment": "Decreased E1S transport, no change in cell surface expression; no change in Km value and decreased Vmax value for E1S transport activity. Decreased taurocholate transport.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "29871943", "url": "https://glygen.org/publication/PubMed/29871943" } ] }, { "start_pos": 69, "end_pos": 69, "sequence_org": "L", "sequence_mut": "I", "comment": "Decreased E1S transport.", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "29871943", "url": "https://glygen.org/publication/PubMed/29871943" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "80.22", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000137491", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137491" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "77.45", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000137491", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137491" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "85.45", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137491", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137491" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "72.34", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000137491", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137491" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "96.66", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137491", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137491" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "92.32", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137491", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137491" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "72.97", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000137491", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137491" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "79.22", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000137491", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137491" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "82.36", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137491", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137491" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "80.67", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000137491", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137491" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "95.99", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137491", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137491" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "81.17", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000137491", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137491" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "83.16", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137491", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137491" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O94956", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94956" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O94956", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94956" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O94956", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94956" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O94956", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94956" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O94956", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94956" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O94956", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94956" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O94956", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94956" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O94956", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94956" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O94956", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94956" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O94956", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94956" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O94956", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94956" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O94956", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94956" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "common_name": "Human" } ], "gene": [ { "name": "SLCO2B1", "url": "https://www.uniprot.org/uniprot/O94956", "locus": { "chromosome": "11", "start_pos": 75206549, "end_pos": 75100563, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000137491", "url": "https://www.ensembl.org/id/ENSG00000137491" } ] } } ], "crossref": [ { "id": "ENSG00000137491", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137491", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd17460", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd17460", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL1743124", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL1743124", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "SLCO2B1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=SLCO2B1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "11309", "url": "https://www.ncbi.nlm.nih.gov/gene/11309", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "10962", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=10962", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "IPR002350", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002350", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR004156", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004156", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036259", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036259", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:11309", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:11309", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "604988", "url": "http://www.omim.org/entry/604988", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O94956", "url": "https://www.nextprot.org/entry/NX_O94956", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "FMLGSAM", "url": "https://omabrowser.org/oma/group/FMLGSAM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2874223at2759", "url": "http://www.orthodb.org/?query=2874223at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11388", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11388", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11388:SF87", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11388:SF87", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF03137", "url": "http://pfam.xfam.org/family/PF03137", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O94956", "url": "https://pharos.nih.gov/targets/O94956", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O94956", "url": "http://purl.obolibrary.org/obo/PR_O94956", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-879518", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-879518", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001138683", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138683", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "50976", "url": "https://www.rhea-db.org/rhea/50976", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "50984", "url": "https://www.rhea-db.org/rhea/50984", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "71703", "url": "https://www.rhea-db.org/rhea/71703", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "71819", "url": "https://www.rhea-db.org/rhea/71819", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "71835", "url": "https://www.rhea-db.org/rhea/71835", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "71839", "url": "https://www.rhea-db.org/rhea/71839", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "73023", "url": "https://www.rhea-db.org/rhea/73023", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "73055", "url": "https://www.rhea-db.org/rhea/73055", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "74363", "url": "https://www.rhea-db.org/rhea/74363", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "74367", "url": "https://www.rhea-db.org/rhea/74367", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A0A0MTF1", "url": "https://www.uniprot.org/uniprot/A0A0A0MTF1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0A0MTF1-1", "url": "https://www.uniprot.org/uniprot/A0A0A0MTF1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GX35", "url": "https://www.uniprot.org/uniprot/A0A1B0GX35", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GX35-1", "url": "https://www.uniprot.org/uniprot/A0A1B0GX35-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PI53", "url": "https://www.uniprot.org/uniprot/E9PI53", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PI53-1", "url": "https://www.uniprot.org/uniprot/E9PI53-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PIU9", "url": "https://www.uniprot.org/uniprot/E9PIU9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PIU9-1", "url": "https://www.uniprot.org/uniprot/E9PIU9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PN87", "url": "https://www.uniprot.org/uniprot/E9PN87", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PN87-1", "url": "https://www.uniprot.org/uniprot/E9PN87-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PRW4", "url": "https://www.uniprot.org/uniprot/E9PRW4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PRW4-1", "url": "https://www.uniprot.org/uniprot/E9PRW4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YE11", "url": "https://www.uniprot.org/uniprot/H0YE11", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YE11-1", "url": "https://www.uniprot.org/uniprot/H0YE11-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O94956-1", "url": "https://www.uniprot.org/uniprot/O94956-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O94956-2", "url": "https://www.uniprot.org/uniprot/O94956-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O94956-3", "url": "https://www.uniprot.org/uniprot/O94956-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O94956-4", "url": "https://www.uniprot.org/uniprot/O94956-4", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGPRIGPAGEVPQVPDKETKATMGTENTPGGKASPDPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQTSGLLASFNEVGNTALIVFVSYFGSRVHRPRMIGYGAILVALAGLLMTLPHFISEPYRYDNTSPEDMPQDFKASLCLPTTSAPASAPSNGNCSSYTETQHLSVVGIMFVAQTLLGVGGVPIQPFGISYIDDFAHNSNSPLYLGILFAVTMMGPGLAFGLGSLMLRLYVDINQMPEGGISLTIKDPRWVGAWWLGFLIAAGAVALAAIPYFFFPKEMPKEKRELQFRRKVLAVTDSPARKGKDSPSKQSPGESTKKQDGLVQIAPNLTVIQFIKVFPRVLLQTLRHPIFLLVVLSQVCLSSMAAGMATFLPKFLERQFSITASYANLLIGCLSFPSVIVGIVVGGVLVKRLHLGPVGCGALCLLGMLLCLFFSLPLFFIGCSSHQIAGITHQTSAHPGLELSPSCMEACSCPLDGFNPVCDPSTRVEYITPCHAGCSSWVVQDALDNSQVFYTNCSCVVEGNPVLAGSCDSTCSHLVVPFLLLVSLGSALACLTHTPSFMLILRGVKKEDKTLAVGIQFMFLRILAWMPSPVIHGSAIDTTCVHWALSCGRRAVCRYYNNDLLRNRFIGLQFFFKTGSVICFALVLAVLRQQDKEARTKESRSSPAVEQQLLVSGPGKKPEDSRV", "length": 709, "header": "sp|O94956-1|SO2B1_HUMAN Isoform 1 of Solute carrier organic anion transporter family member 2B1 OS=Homo sapiens OX=9606 GN=SLCO2B1 PE=1 SV=3 CANONICAL=O94956-1" }, "isoforms": [ { "isoform_ac": "A0A0A0MTF1-1", "url": "", "sequence": { "sequence": "MGPRIEDMPQDFKASLCLPTTSAPASAPSNGNCSSYTETQHLSVVGIMFVAQTLLGVGGVPIQPFGISYIDDFAHNSNSPLYLGILFAVTMMGPGLAFGLGSLMLRLYVDINQMPEGGISLTIKDPRWVGAWWLGFLIAAGAVALAAIPYFFFPKEMPKEKRELQFRRKVLAVTDSPARKGKDSPSKQSPGESTKKQDGLVQIAPNLTVIQFIKVFPRVLLQTLRHPIFLLVVLSQVCLSSMAAGMATFLPKFLERQFSITASYANLLIGCLSFPSVIVGIVVGGVLVKRLHLGPVGCGALCLLGMLLCLFFSLPLFFIGCSSHQIAGITHQTSAHPGLELSPSCMEACSCPLDGFNPVCDPSTRVEYITPCHAGCSSWVVQDALDNSQVFYTNCSCVVEGNPVLAGSCDSTCSHLVVPFLLLVSLGSALACLTHTPSFMLILRGVKKEDKTLAVGIQFMFLRILAWMPSPVIHGSAIDTTCVHWALSCGRRAVCRYYNNDLLRNRFIGLQFFFKTGSVICFALVLAVLRQQDKEARTKESRSSPAVEQQLLVSGPGKKPEDSRV", "length": 565, "header": "tr|A0A0A0MTF1-1|A0A0A0MTF1_HUMAN Computationally mapped isoform of Solute carrier organic anion transporter family member OS=Homo sapiens OX=9606 GN=SLCO2B1 PE=1 SV=1 CANONICAL=O94956-1" }, "locus": { "chromosome": "11", "start_pos": 75204577, "end_pos": 75151382, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000525650.5", "url": "https://www.ensembl.org/id/ENST00000525650.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000436324.1", "url": "https://www.ensembl.org/id/ENSP00000436324.1" } ] } }, { "isoform_ac": "A0A1B0GX35-1", "url": "", "sequence": { "sequence": "MGTENTPGGKASPDPQDVRPSVFHNIKLFVLCHSLLQLAQLMI", "length": 43, "header": "tr|A0A1B0GX35-1|A0A1B0GX35_HUMAN Computationally mapped isoform of Solute carrier organic anion transporter family member 2B1 OS=Homo sapiens OX=9606 GN=SLCO2B1 PE=1 SV=1 CANONICAL=O94956-1" }, "locus": { "chromosome": "11", "start_pos": 75164010, "end_pos": 75162705, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000525845.5", "url": "https://www.ensembl.org/id/ENST00000525845.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000431324.1", "url": "https://www.ensembl.org/id/ENSP00000431324.1" } ] } }, { "isoform_ac": "E9PI53-1", "url": "", "sequence": { "sequence": "MGTENTPGGKASPDPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQTSGLLASFNEVGNTALIVFVSYFGSRVHRPRMIGYGAILVALAGLLMTLPHFISEPYRYDNTSPEDMPQDFKASLCLPTTSAPASAP", "length": 150, "header": "tr|E9PI53-1|E9PI53_HUMAN Computationally mapped isoform of Solute carrier organic anion transporter family member 2B1 OS=Homo sapiens OX=9606 GN=SLCO2B1 PE=1 SV=1 CANONICAL=O94956-1" }, "locus": { "chromosome": "11", "start_pos": 75169240, "end_pos": 75162705, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000527180.5", "url": "https://www.ensembl.org/id/ENST00000527180.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000436513.1", "url": "https://www.ensembl.org/id/ENSP00000436513.1" } ] } }, { "isoform_ac": "E9PIU9-1", "url": "", "sequence": { "sequence": "MGTENTPGGKASPDPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQTSGLLASFNEVGNTALIVFVSYFGSRVHRPRMIGYGAILVALAGLLMTLPHFISEPYRYDNTSP", "length": 127, "header": "tr|E9PIU9-1|E9PIU9_HUMAN Computationally mapped isoform of Solute carrier organic anion transporter family member 2B1 OS=Homo sapiens OX=9606 GN=SLCO2B1 PE=1 SV=1 CANONICAL=O94956-1" }, "locus": { "chromosome": "11", "start_pos": 75165948, "end_pos": 75162705, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000534186.5", "url": "https://www.ensembl.org/id/ENST00000534186.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000433872.1", "url": "https://www.ensembl.org/id/ENSP00000433872.1" } ] } }, { "isoform_ac": "E9PN87-1", "url": "", "sequence": { "sequence": "MGTENTPGGKASPDPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQTSGLLASFNEVGNTALIVFVSYFG", "length": 87, "header": "tr|E9PN87-1|E9PN87_HUMAN Computationally mapped isoform of Solute carrier organic anion transporter family member 2B1 OS=Homo sapiens OX=9606 GN=SLCO2B1 PE=1 SV=1 CANONICAL=O94956-1" }, "locus": { "chromosome": "11", "start_pos": 75165828, "end_pos": 75162705, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000531713.5", "url": "https://www.ensembl.org/id/ENST00000531713.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000432889.1", "url": "https://www.ensembl.org/id/ENSP00000432889.1" } ] } }, { "isoform_ac": "E9PRW4-1", "url": "", "sequence": { "sequence": "MIGYGAILVALAGLLMTLPHFISEPYRYDNTSPEDMPQDFKASLCLPTTSAPASAPSNGNCSSYTETQHLSVVGIMFVAQTLLGVGGVPIQPFGISYIDDFAHNSNSPLYLGILFAVTMMGPGLAFGLGSLMLRLYVDINQMPEGGISLTIKDPRWVGAWWLGFLIAAGAVALAAIPYFFFPKEMPKEKRELQFRRKVLAVTDSPARKGKDSPSKQSPGESTKKQDGLVQIAPNLTVIQFIKVFPRVLLQTLRHPIFLLVVLSQVCLSSMAAGMATFLPKFLERQFSITASYANLLIGCLSFPSVIVGIVVGGVLVKRLHLGPVGCGALCLLGMLLCLFFSLPLFFIGCSSHQIAGITHQTSAHPGLELSPSCMEACSCPLDGFNPVCDPSTRVEYITPCHAGCSSWVVQDALDNSQVFYTNCSCVVEGNPVLAGSCDSTCSHLVVPFLLLVSLGSALACLTHTPSFMLILRGVKKEDKTLAVGIQFMFLRILAWMPSPVIHGSAIDTTCVHWALSCGRRAVCRYYNNDLLRNRFIGLQFFFKTGSVICFALVLAVLRQQDKEARTKESRSSPAVEQQLLVSGPGKKPEDSRV", "length": 593, "header": "tr|E9PRW4-1|E9PRW4_HUMAN Computationally mapped isoform of Solute carrier organic anion transporter family member OS=Homo sapiens OX=9606 GN=SLCO2B1 PE=1 SV=2 CANONICAL=O94956-1" }, "locus": { "chromosome": "11", "start_pos": 75204577, "end_pos": 75165850, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000532236.5", "url": "https://www.ensembl.org/id/ENST00000532236.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000434112.1", "url": "https://www.ensembl.org/id/ENSP00000434112.1" } ] } }, { "isoform_ac": "H0YE11-1", "url": "", "sequence": { "sequence": "VALAGLLMTLPHFISEPYRYDNTSPEDMPQDFKASLCLPTTSAPASAPSNGNCSSYTETQHLSVVGIMFVAQTLLGVGGVPIQPFGISYIDDFAHNSNSPLYLGILFAVTMMGPGLAFGLGSLMLRLYVDINQMPEGEPQEHMFARP", "length": 147, "header": "tr|H0YE11-1|H0YE11_HUMAN Computationally mapped isoform of Solute carrier organic anion transporter family member 2B1 OS=Homo sapiens OX=9606 GN=SLCO2B1 PE=1 SV=1 CANONICAL=O94956-1" }, "locus": { "chromosome": "11", "start_pos": 75169796, "end_pos": 75165874, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000526839.1", "url": "https://www.ensembl.org/id/ENST00000526839.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000434742.1", "url": "https://www.ensembl.org/id/ENSP00000434742.1" } ] } }, { "isoform_ac": "O94956-1", "url": "", "sequence": { "sequence": "MGPRIGPAGEVPQVPDKETKATMGTENTPGGKASPDPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQTSGLLASFNEVGNTALIVFVSYFGSRVHRPRMIGYGAILVALAGLLMTLPHFISEPYRYDNTSPEDMPQDFKASLCLPTTSAPASAPSNGNCSSYTETQHLSVVGIMFVAQTLLGVGGVPIQPFGISYIDDFAHNSNSPLYLGILFAVTMMGPGLAFGLGSLMLRLYVDINQMPEGGISLTIKDPRWVGAWWLGFLIAAGAVALAAIPYFFFPKEMPKEKRELQFRRKVLAVTDSPARKGKDSPSKQSPGESTKKQDGLVQIAPNLTVIQFIKVFPRVLLQTLRHPIFLLVVLSQVCLSSMAAGMATFLPKFLERQFSITASYANLLIGCLSFPSVIVGIVVGGVLVKRLHLGPVGCGALCLLGMLLCLFFSLPLFFIGCSSHQIAGITHQTSAHPGLELSPSCMEACSCPLDGFNPVCDPSTRVEYITPCHAGCSSWVVQDALDNSQVFYTNCSCVVEGNPVLAGSCDSTCSHLVVPFLLLVSLGSALACLTHTPSFMLILRGVKKEDKTLAVGIQFMFLRILAWMPSPVIHGSAIDTTCVHWALSCGRRAVCRYYNNDLLRNRFIGLQFFFKTGSVICFALVLAVLRQQDKEARTKESRSSPAVEQQLLVSGPGKKPEDSRV", "length": 709, "header": "sp|O94956-1|SO2B1_HUMAN Isoform 1 of Solute carrier organic anion transporter family member 2B1 OS=Homo sapiens OX=9606 GN=SLCO2B1 PE=1 SV=3 CANONICAL=O94956-1" }, "locus": {} }, { "isoform_ac": "O94956-2", "url": "", "sequence": { "sequence": "MIGYGAILVALAGLLMTLPHFISEPYRYDNTSPGGISLTIKDPRWVGAWWLGFLIAAGAVALAAIPYFFFPKEMPKEKRELQFRRKVLAVTDSPARKGKDSPSKQSPGESTKKQDGLVQIAPNLTVIQFIKVFPRVLLQTLRHPIFLLVVLSQVCLSSMAAGMATFLPKFLERQFSITASYANLLIGCLSFPSVIVGIVVGGVLVKRLHLGPVGCGALCLLGMLLCLFFSLPLFFIGCSSHQIAGITHQTSAHPGLELSPSCMEACSCPLDGFNPVCDPSTRVEYITPCHAGCSSWVVQDALDNSQVFYTNCSCVVEGNPVLAGSCDSTCSHLVVPFLLLVSLGSALACLTHTPSFMLILRGVKKEDKTLAVGIQFMFLRILAWMPSPVIHGSAIDTTCVHWALSCGRRAVCRYYNNDLLRNRFIGLQFFFKTGSVICFALVLAVLRQQDKEARTKESRSSPAVEQQLLVSGPGKKPEDSRV", "length": 482, "header": "sp|O94956-2|SO2B1_HUMAN Isoform 2 of Solute carrier organic anion transporter family member 2B1 OS=Homo sapiens OX=9606 GN=SLCO2B1 PE=1 SV=3 CANONICAL=O94956-1" }, "locus": {} }, { "isoform_ac": "O94956-3", "url": "", "sequence": { "sequence": "MGTENTPGGKASPDPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQTSGLLASFNEVGNTALIVFVSYFGSRVHRPRMIGYGAILVALAGLLMTLPHFISEPYRYDNTSPEDMPQDFKASLCLPTTSAPASAPSNGNCSSYTETQHLSVVGIMFVAQTLLGVGGVPIQPFGISYIDDFAHNSNSPLYLGILFAVTMMGPGLAFGLGSLMLRLYVDINQMPEGGISLTIKDPRWVGAWWLGFLIAAGAVALAAIPYFFFPKEMPKEKRELQFRRKVLAVTDSPARKGKDSPSKQSPGESTKKQDGLVQIAPNLTVIQFIKVFPRVLLQTLRHPIFLLVVLSQVCLSSMAAGMATFLPKFLERQFSITASYANLLIGCLSFPSVIVGIVVGGVLVKRLHLGPVGCGALCLLGMLLCLFFSLPLFFIGCSSHQIAGITHQTSAHPGLELSPSCMEACSCPLDGFNPVCDPSTRVEYITPCHAGCSSWVVQDALDNSQVFYTNCSCVVEGNPVLAGSCDSTCSHLVVPFLLLVSLGSALACLTHTPSFMLILRGVKKEDKTLAVGIQFMFLRILAWMPSPVIHGSAIDTTCVHWALSCGRRAVCRYYNNDLLRNRFIGLQFFFKTGSVICFALVLAVLRQQDKEARTKESRSSPAVEQQLLVSGPGKKPEDSRV", "length": 687, "header": "sp|O94956-3|SO2B1_HUMAN Isoform 3 of Solute carrier organic anion transporter family member 2B1 OS=Homo sapiens OX=9606 GN=SLCO2B1 PE=1 SV=3 CANONICAL=O94956-1" }, "locus": {} }, { "isoform_ac": "O94956-4", "url": "", "sequence": { "sequence": "MGPRIEDMPQDFKASLCLPTTSAPASAPSNGNCSSYTETQHLSVVGIMFVAQTLLGVGGVPIQPFGISYIDDFAHNSNSPLYLGILFAVTMMGPGLAFGLGSLMLRLYVDINQMPEGGISLTIKDPRWVGAWWLGFLIAAGAVALAAIPYFFFPKEMPKEKRELQFRRKVLAVTDSPARKGKDSPSKQSPGESTKKQDGLVQIAPNLTVIQFIKVFPRVLLQTLRHPIFLLVVLSQVCLSSMAAGMATFLPKFLERQFSITASYANLLIGCLSFPSVIVGIVVGGVLVKRLHLGPVGCGALCLLGMLLCLFFSLPLFFIGCSSHQIAGITHQTSAHPGLELSPSCMEACSCPLDGFNPVCDPSTRVEYITPCHAGCSSWVVQDALDNSQVFYTNCSCVVEGNPVLAGSCDSTCSHLVVPFLLLVSLGSALACLTHTPSFMLILRGVKKEDKTLAVGIQFMFLRILAWMPSPVIHGSAIDTTCVHWALSCGRRAVCRYYNNDLLRNRFIGLQFFFKTGSVICFALVLAVLRQQDKEARTKESRSSPAVEQQLLVSGPGKKPEDSRV", "length": 565, "header": "sp|O94956-4|SO2B1_HUMAN Isoform 4 of Solute carrier organic anion transporter family member 2B1 OS=Homo sapiens OX=9606 GN=SLCO2B1 PE=1 SV=3 CANONICAL=O94956-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "O94956", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O94956#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 538, "start_aa": "Asn", "end_pos": 538, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn538", "evidence": [ { "id": "O94956", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O94956#ptm_processing" } ] } ], "phosphorylation": [ { "start_pos": 318, "end_pos": 318, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "O94956", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94956" } ], "site_lbl": "Thr318" }, { "start_pos": 320, "end_pos": 320, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O94956", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94956" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" } ], "site_lbl": "Ser320" }, { "start_pos": 34, "end_pos": 34, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "site_lbl": "Ser34" }, { "start_pos": 687, "end_pos": 687, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O94956", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94956" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" } ], "site_lbl": "Ser687" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Identification of a novel gene family encoding human liver-specific organic anion transporter LST-1.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Abe T, Kakyo M, Tokui T, Nakagomi R, Nishio T, Nakai D, Nomura H, Unno M, Suzuki M, Naitoh T, Matsuno S, Yawo H", "evidence": [ { "database": "Reactome", "id": "R-HSA-879518", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-879518" } ], "reference": [ { "type": "PubMed", "id": "10358072", "url": "https://glygen.org/publication/PubMed/10358072" } ] }, { "title": "A novel human hepatic organic anion transporting polypeptide (OATP2). Identification of a liver-specific human organic anion transporting polypeptide and identification of rat and human hydroxymethylglutaryl-CoA reductase inhibitor transporters.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Hsiang B, Zhu Y, Wang Z, Wu Y, Sasseville V, Yang WP, Kirchgessner TG", "evidence": [ { "database": "Reactome", "id": "R-HSA-879518", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-879518" } ], "reference": [ { "type": "PubMed", "id": "10601278", "url": "https://glygen.org/publication/PubMed/10601278" } ] }, { "title": "Molecular identification and characterization of novel members of the human organic anion transporter (OATP) family.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Tamai I, Nezu J, Uchino H, Sai Y, Oku A, Shimane M, Tsuji A", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "Reactome", "id": "R-HSA-879518", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-879518" } ], "reference": [ { "type": "PubMed", "id": "10873595", "url": "https://glygen.org/publication/PubMed/10873595" } ] }, { "title": "Organic anion-transporting polypeptide B (OATP-B) and its functional comparison with three other OATPs of human liver.", "journal": "Gastroenterology", "date": "2001", "authors": "Kullak-Ublick GA, Ismair MG, Stieger B, Landmann L, Huber R, Pizzagalli F, Fattinger K, Meier PJ, Hagenbuch B", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "Reactome", "id": "R-HSA-879518", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-879518" } ], "reference": [ { "type": "PubMed", "id": "11159893", "url": "https://glygen.org/publication/PubMed/11159893" } ] }, { "title": "Identification of thyroid hormone transporters in humans: different molecules are involved in a tissue-specific manner.", "journal": "Endocrinology", "date": "2001", "authors": "Fujiwara K, Adachi H, Nishio T, Unno M, Tokui T, Okabe M, Onogawa T, Suzuki T, Asano N, Tanemoto M, Seki M, Shiiba K, Suzuki M, Kondo Y, Nunoki K, Shimosegawa T, Iinuma K, Ito S, Matsuno S, Abe T", "evidence": [ { "database": "Reactome", "id": "R-HSA-879518", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-879518" } ], "reference": [ { "type": "PubMed", "id": "11316767", "url": "https://glygen.org/publication/PubMed/11316767" } ] }, { "title": "Characterization of an organic anion-transporting polypeptide (OATP-B) in human placenta.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2002-04", "authors": "St-Pierre M V, Hagenbuch B, Ugele B, Meier P J, Stallmach T", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "reference": [ { "type": "PubMed", "id": "11932330", "url": "https://glygen.org/publication/PubMed/11932330" } ] }, { "title": "Genetic polymorphisms of human organic anion transporters OATP-C (SLC21A6) and OATP-B (SLC21A9): allele frequencies in the Japanese population and functional analysis.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2002", "authors": "Nozawa T, Nakajima M, Tamai I, Noda K, Nezu J, Sai Y, Tsuji A, Yokoi T", "evidence": [ { "database": "RefSeq", "id": "NP_001138683", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138683" } ], "reference": [ { "type": "PubMed", "id": "12130747", "url": "https://glygen.org/publication/PubMed/12130747" } ] }, { "title": "Identification of a novel human organic anion transporting polypeptide as a high affinity thyroxine transporter.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2002", "authors": "Pizzagalli F, Hagenbuch B, Stieger B, Klenk U, Folkers G, Meier PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-879518", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-879518" } ], "reference": [ { "type": "PubMed", "id": "12351693", "url": "https://glygen.org/publication/PubMed/12351693" } ] }, { "title": "Characterization and identification of steroid sulfate transporters of human placenta.", "journal": "American journal of physiology. Endocrinology and metabolism", "date": "2003", "authors": "Ugele B, St-Pierre MV, Pihusch M, Bahn A, Hantschmann P", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "RefSeq", "id": "NP_001138683", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138683" } ], "reference": [ { "type": "PubMed", "id": "12409283", "url": "https://glygen.org/publication/PubMed/12409283" } ] }, { "title": "Involvement of human organic anion transporting polypeptide OATP-B (SLC21A9) in pH-dependent transport across intestinal apical membrane.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2003", "authors": "Kobayashi D, Nozawa T, Imai K, Nezu J, Tsuji A, Tamai I", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "reference": [ { "type": "PubMed", "id": "12724351", "url": "https://glygen.org/publication/PubMed/12724351" } ] }, { "title": "Functional characterization of pH-sensitive organic anion transporting polypeptide OATP-B in human.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2004-02", "authors": "Nozawa Takashi, Imai Kozue, Nezu Jun-Ichi, Tsuji Akira, Tamai Ikumi", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "reference": [ { "type": "PubMed", "id": "14610227", "url": "https://glygen.org/publication/PubMed/14610227" } ] }, { "title": "Isolation and characterization of a digoxin transporter and its rat homologue expressed in the kidney.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Mikkaichi T, Suzuki T, Onogawa T, Tanemoto M, Mizutamari H, Okada M, Chaki T, Masuda S, Tokui T, Eto N, Abe M, Satoh F, Unno M, Hishinuma T, Inui K, Ito S, Goto J, Abe T", "evidence": [ { "database": "Reactome", "id": "R-HSA-879518", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-879518" } ], "reference": [ { "type": "PubMed", "id": "14993604", "url": "https://glygen.org/publication/PubMed/14993604" } ] }, { "title": "Functional analysis of the extracellular cysteine residues in the human organic anion transporting polypeptide, OATP2B1.", "journal": "Mol. Pharmacol.", "date": "2006", "authors": "H\u00e4nggi Emanuel, Grundschober Anne Freimoser, Leuthold Simone, Meier Peter J, St-Pierre Marie V", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "reference": [ { "type": "PubMed", "id": "16754786", "url": "https://glygen.org/publication/PubMed/16754786" } ] }, { "title": "Modification of OATP2B1-mediated transport by steroid hormones.", "journal": "Molecular pharmacology", "date": "2006-11", "authors": "Grube Markus, K\u00f6ck Kathleen, Karner Susanne, Reuther Sebastian, Ritter Christoph A, Jedlitschky Gabriele, Kroemer Heyo K", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "reference": [ { "type": "PubMed", "id": "16908597", "url": "https://glygen.org/publication/PubMed/16908597" } ] }, { "title": "The consensus coding sequences of human breast and colorectal cancers.", "journal": "Science (New York, N.Y.)", "date": "2006", "authors": "Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "reference": [ { "type": "PubMed", "id": "16959974", "url": "https://glygen.org/publication/PubMed/16959974" } ] }, { "title": "Characterization of two splice variants of human organic anion transporting polypeptide 3A1 isolated from human brain.", "journal": "American journal of physiology. Cell physiology", "date": "2007", "authors": "Huber RD, Gao B, Sidler Pfandler MA, Zhang-Fu W, Leuthold S, Hagenbuch B, Folkers G, Meier PJ, Stieger B", "evidence": [ { "database": "Reactome", "id": "R-HSA-879518", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-879518" } ], "reference": [ { "type": "PubMed", "id": "16971491", "url": "https://glygen.org/publication/PubMed/16971491" } ] }, { "title": "Functional differences in steroid sulfate uptake of organic anion transporter 4 (OAT4) and organic anion transporting polypeptide 2B1 (OATP2B1) in human placenta.", "journal": "The Journal of steroid biochemistry and molecular biology", "date": "2008", "authors": "Ugele B, Bahn A, Rex-Haffner M", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "reference": [ { "type": "PubMed", "id": "18501590", "url": "https://glygen.org/publication/PubMed/18501590" } ] }, { "title": "Mechanisms of pH-gradient driven transport mediated by organic anion polypeptide transporters.", "journal": "American journal of physiology. Cell physiology", "date": "2009", "authors": "Leuthold S, Hagenbuch B, Mohebbi N, Wagner CA, Meier PJ, Stieger B", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "reference": [ { "type": "PubMed", "id": "19129463", "url": "https://glygen.org/publication/PubMed/19129463" } ] }, { "title": "Evidence for a homodimeric structure of human monocarboxylate transporter 8.", "journal": "Endocrinology", "date": "2009", "authors": "Visser WE, Philp NJ, van Dijk TB, Klootwijk W, Friesema EC, Jansen J, Beesley PW, Ianculescu AG, Visser TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-879518", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-879518" } ], "reference": [ { "type": "PubMed", "id": "19797118", "url": "https://glygen.org/publication/PubMed/19797118" } ] }, { "title": "Phosphoproteome analysis of human liver tissue by long-gradient nanoflow LC coupled with multiple stage MS analysis.", "journal": "Electrophoresis", "date": "2010", "authors": "Han G, Ye M, Liu H, Song C, Sun D, Wu Y, Jiang X, Chen R, Wang C, Wang L, Zou H", "evidence": [ { "database": "iPTMnet", "id": "O94956", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94956" } ], "reference": [ { "type": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" } ] }, { "title": "pH dependence of organic anion-transporting polypeptide 2B1 in Caco-2 cells: potential role in antiretroviral drug oral bioavailability and drug-drug interactions.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2010-09-01", "authors": "Kis Olena, Zastre Jason A, Ramaswamy Manisha, Bendayan Reina", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "reference": [ { "type": "PubMed", "id": "20507927", "url": "https://glygen.org/publication/PubMed/20507927" } ] }, { "title": "Functional pleiotropy of organic anion transporting polypeptide OATP2B1 due to multiple binding sites.", "journal": "Drug metabolism and pharmacokinetics", "date": "2012", "authors": "Shirasaka Yoshiyuki, Mori Takanori, Shichiri Megumi, Nakanishi Takeo, Tamai Ikumi", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "reference": [ { "type": "PubMed", "id": "22201122", "url": "https://glygen.org/publication/PubMed/22201122" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "iPTMnet", "id": "O94956", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94956" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Transport function and transcriptional regulation of a liver-enriched human organic anion transporting polypeptide 2B1 transcriptional start site variant.", "journal": "Molecular pharmacology", "date": "2013", "authors": "Knauer MJ, Girdwood AJ, Kim RB, Tirona RG", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "reference": [ { "type": "PubMed", "id": "23531488", "url": "https://glygen.org/publication/PubMed/23531488" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" }, { "database": "iPTMnet", "id": "O94956", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94956" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "Differential cellular expression of organic anion transporting peptides OATP1A2 and OATP2B1 in the human retina and brain: implications for carrier-mediated transport of neuropeptides and neurosteriods in the CNS.", "journal": "Pflugers Archiv : European journal of physiology", "date": "2015-07", "authors": "Gao Bo, Vavricka Stephan R, Meier Peter J, Stieger Bruno", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "reference": [ { "type": "PubMed", "id": "25132355", "url": "https://glygen.org/publication/PubMed/25132355" } ] }, { "title": "Modulation of monocarboxylate transporter 8 oligomerization by specific pathogenic mutations.", "journal": "Journal of molecular endocrinology", "date": "2015", "authors": "Fischer J, Kleinau G, Muller A, Kuhnen P, Zwanziger D, Kinne A, Rehders M, Moeller LC, Fuhrer D, Gruters A, Krude H, Brix K, Biebermann H", "evidence": [ { "database": "Reactome", "id": "R-HSA-879518", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-879518" } ], "reference": [ { "type": "PubMed", "id": "25527620", "url": "https://glygen.org/publication/PubMed/25527620" } ] }, { "title": "Glutamate cycling may drive organic anion transport on the basal membrane of human placental syncytiotrophoblast.", "journal": "The Journal of physiology", "date": "2015-10-15", "authors": "Lofthouse Emma M, Brooks Suzanne, Cleal Jane K, Hanson Mark A, Poore Kirsten R, O'Kelly Ita M, Lewis Rohan M", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "reference": [ { "type": "PubMed", "id": "26277985", "url": "https://glygen.org/publication/PubMed/26277985" } ] }, { "title": "Organic anion transporting polypeptide (OATP)-mediated transport of coproporphyrins I and III.", "journal": "Xenobiotica; the fate of foreign compounds in biological systems", "date": "2016", "authors": "Bednarczyk Dallas, Boiselle Carri", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "reference": [ { "type": "PubMed", "id": "26383540", "url": "https://glygen.org/publication/PubMed/26383540" } ] }, { "title": "Tryptophan Residue Located at the Middle of Putative Transmembrane Domain 11 Is Critical for the Function of Organic Anion Transporting Polypeptide 2B1.", "journal": "Molecular pharmaceutics", "date": "2016", "authors": "Bian J, Jin M, Yue M, Wang M, Zhang H, Gui C", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "reference": [ { "type": "PubMed", "id": "27576593", "url": "https://glygen.org/publication/PubMed/27576593" } ] }, { "title": "The Organic Anion-Transporting Peptide 2B1 Is Localized in the Basolateral Membrane of the Human Jejunum and Caco-2 Monolayers.", "journal": "J. Pharm. Sci.", "date": "2017", "authors": "Keiser Markus, Kaltheuner Lars, Wildberg Charlotte, M\u00fcller Janett, Grube Markus, Partecke Lars Ivo, Heidecke Claus-Dieter, Oswald Stefan", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "reference": [ { "type": "PubMed", "id": "28408210", "url": "https://glygen.org/publication/PubMed/28408210" } ] }, { "title": "Transmembrane Domain 1 of Human Organic Anion Transporting Polypeptide 2B1 Is Essential for Transporter Function and Stability.", "journal": "Molecular pharmacology", "date": "2018", "authors": "Fang Z, Huang J, Chen J, Xu S, Xiang Z, Hong M", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "reference": [ { "type": "PubMed", "id": "29871943", "url": "https://glygen.org/publication/PubMed/29871943" } ] }, { "title": "Differences in transport function of the human and rat orthologue of the Organic Anion Transporting Polypeptide 2B1 (OATP2B1).", "journal": "Drug metabolism and pharmacokinetics", "date": "2021", "authors": "Hussner J, Foletti A, Seibert I, Fuchs A, Schuler E, Malagnino V, Grube M, Meyer Zu Schwabedissen HE", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "reference": [ { "type": "PubMed", "id": "34628357", "url": "https://glygen.org/publication/PubMed/34628357" } ] }, { "title": "Association of genetic polymorphisms with local steroid metabolism in human benign breasts.", "journal": "Steroids", "date": "2022", "authors": "Lee O, Fought AJ, Shidfar A, Heinz RE, Kmiecik TE, Gann PH, Khan SA, Chatterton RT", "evidence": [ { "database": "RefSeq", "id": "NP_001138683", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138683" } ], "reference": [ { "type": "PubMed", "id": "34762930", "url": "https://glygen.org/publication/PubMed/34762930" } ] }, { "title": "Localization of Xenobiotic Transporters Expressed at the Human Blood-Testis Barrier.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2022-06", "authors": "Hau Raymond K, Klein Robert R, Wright Stephen H, Cherrington Nathan J", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "reference": [ { "type": "PubMed", "id": "35307651", "url": "https://glygen.org/publication/PubMed/35307651" } ] }, { "title": "Metabolic-scale gene activation screens identify SLCO2B1 as a heme transporter that enhances cellular iron availability.", "journal": "Molecular cell", "date": "2022", "authors": "Unlu G, Prizer B, Erdal R, Yeh HW, Bayraktar EC, Birsoy K", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "reference": [ { "type": "PubMed", "id": "35714613", "url": "https://glygen.org/publication/PubMed/35714613" } ] }, { "title": "Genetic Polymorphisms in SLCO2B1 and ABCC1 Conjointly Modulate Atorvastatin Intracellular Accumulation in HEK293 Recombinant Cell Lines.", "journal": "Therapeutic drug monitoring", "date": "2023-06-01", "authors": "Hoste Emilia, Paquot Adrien, Panin Nadtha, Horion Shaleena, El Hamdaoui Halima, Muccioli Giulio G, Haufroid Vincent, Elens Laure", "evidence": [ { "database": "RefSeq", "id": "NP_001138683", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138683" } ], "reference": [ { "type": "PubMed", "id": "36253893", "url": "https://glygen.org/publication/PubMed/36253893" } ] }, { "title": "Cloning, in vitro expression, and tissue distribution of a human prostaglandin transporter cDNA(hPGT).", "journal": "The Journal of clinical investigation", "date": "1996", "authors": "Lu R, Kanai N, Bao Y, Schuster VL", "evidence": [ { "database": "Reactome", "id": "R-HSA-879518", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-879518" } ], "reference": [ { "type": "PubMed", "id": "8787677", "url": "https://glygen.org/publication/PubMed/8787677" } ] } ], "pathway": [ { "id": "hsa:11309", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:11309", "resource": "KEGG Pathway" }, { "id": "R-HSA-879518", "name": "Transport of organic anions", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-879518", "resource": "Reactome", "description": "Transport of organic anions" } ], "orthologs": [ { "uniprot_canonical_ac": "Q8BXB6-1", "protein_name": "Solute carrier organic anion transporter family member 2B1", "gene_name": "Slco2b1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MPDRSTKTTMGTEDMHERKVSVEPQDSHQDAQPRGMFHNIKFFVLCHSLLQLTQLMISGYLKSSISTVEKRFGLSSQISGLLAAFNEVGNVSLILFVSYFGSRVHRPRMIGYGALLVATAGLLMALPHFISEPYRYDHSSSDNRSLDFEASLCLPTTMAPASALSNGSCSSHTETKHLTMVGIMFAAQTLLGIGGVPIQPFGISYIDDFAHHSNSPLYIGILFGITTMGPGLAYGLGSLMLRLYVDIDRMPEGGINLTPKDPRWVGAWWLGFLISSGLVVLASSPYFFFPREMPKEKHEFHFRRKVLASAASTASKGEDLSSQHEPLKKQAGLAQIAPDLTLVQFVKVFPRVLLRNLRHPIFLLVVLSQVCTSSMVAGMATFLPKFLERQFSITASFANMLLGCLTIPLVIVGIMMGGVLVKRLHLSPVQCSALCLLGSLLCLLFSVPLFFIGCSTHQIAGITQDLGAQPGPSLFPGCSEPCSCQSDDFNPVCDTSAYVEYTTPCHAGCTGRVVQEALGKSQVFYTNCSCVAGNGTVPAGSCESACSRLVLPFIVLFSLGAGLASITHTPSFMLILRGVKKEDKTLAVGMQFMLLRVLAWMPSPVIHGSAIDTTCVHWALTCGRRAVCRYYDHDLLRNRFIGLQFFFKSGSLVCFTLVLAILRQQSREASTRTTVKSSELQQL", "length": 683 }, "evidence": [ { "id": "45926433", "url": "http://www.informatics.jax.org/homology/45926433", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9JHI3-1", "protein_name": "Solute carrier organic anion transporter family member 2B1", "gene_name": "Slco2b1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MPDRSTKATMGAEDIHERKVSMEPRDSHQDAQPRGMFQNIKFFVLCHSILQLAQLMISGYLKSSISTVEKRFGLSSQTSGLLAAFNEVGNISLILFVSYFGSRVHRPRMIGCGAILVAVAGLLMALPHFISEPYRYDHSSPDRSQDFEASLCLPTTMAPASALSNDSCSSRTETKHLTMVGIMFTAQTLLGIGGVPIQPFGISYIDDFAHHSNSPLYLGILFAITMMGPGLAYGLGSLMLRLYVDIDRMPEGGINLTTKDPRWVGAWWLGFLISAGLVVLAASPYFFFPREMPKEKYELHFRQKVLAGGASIGSKGEELSSQHEPLKKQAGLPQIAPDLTVVQFIKVFPRVLLRTLRHPIFLLVVLSQVCTSSMVAGTATFLPKFLERQFSITASFANLLLGCLTIPLAIVGIVVGGVLVKRLHLSPMQCSALCLLGSLLCLLLSLPLFFIGCSTHHIAGITQDLGAQPGPSLFPGCSEPCSCQSDDFNPVCDTSAYVEYTTPCHAGCTGRVVQEALDKSQVFYTNCSCVAGNGTISAGSCESACSRLVLPFILLISLGAAVASITHTPSFMLILRGVKKEDKTLAVGMQFMLLRVLAWMPSPVIHGSAIDTTCVHWALTCGRRAVCRYYDHDLLRNRFIGLQFFFKSGSLVCFALVLAILRQQSREASTKATVKSSDLQEL", "length": 682 }, "evidence": [ { "id": "45926433", "url": "http://www.informatics.jax.org/homology/45926433", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "pmid": "" }, { "name": "basolateral plasma membrane", "id": "GO:0016323", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016323", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "pmid": "" }, { "name": "apical plasma membrane", "id": "GO:0016324", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016324", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "pmid": "" }, { "name": "basal plasma membrane", "id": "GO:0009925", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009925", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "transmembrane transport", "id": "GO:0055085", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055085", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "pmid": "" }, { "name": "monoatomic ion transport", "id": "GO:0006811", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006811", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "pmid": "" }, { "name": "xenobiotic metabolic process", "id": "GO:0006805", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006805", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "pmid": "" }, { "name": "organic anion transport", "id": "GO:0015711", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015711", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "pmid": "" }, { "name": "sodium-independent organic anion transport", "id": "GO:0043252", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043252", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "pmid": "" }, { "name": "heme catabolic process", "id": "GO:0042167", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042167", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "pmid": "" }, { "name": "transport across blood-brain barrier", "id": "GO:0150104", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0150104", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "transmembrane transporter activity", "id": "GO:0022857", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022857", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "pmid": "" }, { "name": "organic anion transmembrane transporter activity", "id": "GO:0008514", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008514", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "pmid": "" }, { "name": "sodium-independent organic anion transmembrane transporter activity", "id": "GO:0015347", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015347", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "pmid": "" }, { "name": "prostaglandin transmembrane transporter activity", "id": "GO:0015132", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015132", "evidence": [ { "database": "UniProtKB", "id": "O94956", "url": "https://www.uniprot.org/uniprot/O94956" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 146, "end_pos": 148, "annotation": "n_glycosylation_sequon" }, { "start_pos": 176, "end_pos": 178, "annotation": "n_glycosylation_sequon" }, { "start_pos": 350, "end_pos": 352, "annotation": "n_glycosylation_sequon" }, { "start_pos": 538, "end_pos": 540, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "50976", "name": "", "equation": "prostaglandin D2(out) = prostaglandin D2(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "50976", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/50976" } ] }, { "id": "50984", "name": "", "equation": "prostaglandin E2(out) = prostaglandin E2(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "50984", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/50984" } ] }, { "id": "71703", "name": "", "equation": "taurocholate(out) = taurocholate(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "71703", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/71703" } ] }, { "id": "71819", "name": "", "equation": "L-thyroxine(out) = L-thyroxine(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "71819", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/71819" } ] }, { "id": "71835", "name": "", "equation": "estrone 3-sulfate(out) = estrone 3-sulfate(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "71835", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/71835" } ] }, { "id": "71839", "name": "", "equation": "dehydroepiandrosterone 3-sulfate(out) = dehydroepiandrosterone 3-sulfate(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "71839", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/71839" } ] }, { "id": "73023", "name": "", "equation": "pregnenolone sulfate(out) = pregnenolone sulfate(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73023", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73023" } ] }, { "id": "73055", "name": "", "equation": "estrone 3-sulfate(out) + hydrogencarbonate(in) = estrone 3-sulfate(in) + hydrogencarbonate(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73055", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73055" } ] }, { "id": "74363", "name": "", "equation": "coproporphyrin III(out) = coproporphyrin III(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "74363", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/74363" } ] }, { "id": "74367", "name": "", "equation": "substance P(out) = substance P(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "74367", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/74367" } ] } ], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 176, 538 ], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 34, 318, 320, 687 ], "sequon_annotation_sites": [ { "start_pos": 146, "end_pos": 148 }, { "start_pos": 176, "end_pos": 178 }, { "start_pos": 350, "end_pos": 352 }, { "start_pos": 538, "end_pos": 540 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 38 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }