{ "uniprot_canonical_ac": "O94916-1", "uniprot_ac": "O94916", "uniprot_id": "NFAT5_HUMAN", "mass": { "chemical_mass": 165763.0, "monoisotopic_mass": 165763.0 }, "refseq": { "ac": "NP_001106649", "name": "nuclear factor of activated T-cells 5 isoform d", "summary": "The product of this gene is a member of the nuclear factors of activated T cells family of transcription factors. Proteins belonging to this family play a central role in inducible gene transcription during the immune response. This protein regulates gene expression induced by osmotic stress in mammalian cells. Unlike monomeric members of this protein family, this protein exists as a homodimer and forms stable dimers with DNA elements. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001106649" }, "gene_names": [ { "name": "NFAT5", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O94916", "id": "O94916" }, { "name": "KIAA0827", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O94916", "id": "O94916" }, { "name": "NF-AT5; NFATL1; NFATZ; OREBP; TONEBP", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001106649", "id": "NP_001106649" }, { "name": "NFAT5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001106649", "id": "NP_001106649" }, { "name": "TONEBP", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O94916", "id": "O94916" } ], "protein_names": [ { "name": "Nuclear factor of activated T-cells 5", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O94916" }, { "name": "NF-AT5", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O94916" }, { "name": "T-cell transcription factor NFAT5", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O94916" }, { "name": "TonE-binding protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O94916" }, { "name": "TonEBP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O94916" }, { "name": "Tonicity-responsive enhancer-binding protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O94916" }, { "name": "nuclear factor of activated T-cells 5 isoform d", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001106649", "id": "NP_001106649" }, { "name": "osmotic response element-binding protein; glutamine rich protein H65; NFAT-like protein 1; TonE-binding protein; nuclear factor of activated T-cells 5, tonicity-responsive; T-cell transcription factor NFAT5; tonicity-responsive enhancer-binding protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001106649", "id": "NP_001106649" } ], "function": [ { "annotation": "Associations of the Methylation Levels of NFAT5, PVT1, RPS6KA1, and MIB1 with Steroid-Resistant Asthma.", "evidence": [ { "database": "RefSeq", "id": "NP_001106649", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001106649" }, { "database": "PubMed", "id": "35417913", "url": "https://glygen.org/publication/PubMed/35417913" } ] }, { "annotation": "Circular RNA_0037128 aggravates high glucose-induced damage in HK-2 cells via regulation of microRNA-497-5p/nuclear factor of activated T cells 5 axis.", "evidence": [ { "database": "RefSeq", "id": "NP_001106649", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001106649" }, { "database": "PubMed", "id": "34753398", "url": "https://glygen.org/publication/PubMed/34753398" } ] }, { "annotation": "Induced upon T cell activation in a calcineurin-dependent manner, which contrasts with the calcineurin-independent induction mediated by hyperosmotic stress.", "evidence": [ { "database": "RefSeq", "id": "NP_001106649", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001106649" }, { "database": "PubMed", "id": "11046013", "url": "https://glygen.org/publication/PubMed/11046013" } ] }, { "annotation": "NFAT5 Controls the Integrity of Epidermis. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001106649", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001106649" }, { "database": "PubMed", "id": "34956208", "url": "https://glygen.org/publication/PubMed/34956208" } ] }, { "annotation": "SAFB2 Inhibits the Progression of Breast Cancer by Suppressing the Wnt/beta-Catenin Signaling Pathway via NFAT5.", "evidence": [ { "database": "RefSeq", "id": "NP_001106649", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001106649" }, { "database": "PubMed", "id": "36652182", "url": "https://glygen.org/publication/PubMed/36652182" } ] }, { "annotation": "The product of this gene is a member of the nuclear factors of activated T cells family of transcription factors. Proteins belonging to this family play a central role in inducible gene transcription during the immune response. This protein regulates gene expression induced by osmotic stress in mammalian cells. Unlike monomeric members of this protein family, this protein exists as a homodimer and forms stable dimers with DNA elements. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001106649", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001106649" } ] }, { "annotation": "TonEBP expression is essential in the IL-1beta-induced migration and invasion of human A549 lung cancer cells. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001106649", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001106649" }, { "database": "PubMed", "id": "38188678", "url": "https://glygen.org/publication/PubMed/38188678" } ] }, { "annotation": "Transcription factor involved, among others, in the transcriptional regulation of osmoprotective and inflammatory genes. Binds the DNA consensus sequence 5'-[ACT][AG]TGGAAA[CAT]A[TA][ATC][CA][ATG][GT][GAC][CG][CT]-3' (PubMed:10377394). Mediates the transcriptional response to hypertonicity (PubMed:10051678). Positively regulates the transcription of LCN2 and S100A4 genes; optimal transactivation of these genes requires the presence of DDX5/DDX17 (PubMed:22266867). Also involved in the DNA damage response by preventing formation of R-loops; R-loops are composed of a DNA:RNA hybrid and the associated non-template single-stranded DNA (PubMed:34049076).", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916#function" }, { "database": "PubMed", "id": "22266867", "url": "https://glygen.org/publication/PubMed/22266867" }, { "database": "PubMed", "id": "10377394", "url": "https://glygen.org/publication/PubMed/10377394" }, { "database": "PubMed", "id": "10051678", "url": "https://glygen.org/publication/PubMed/10051678" }, { "database": "PubMed", "id": "34049076", "url": "https://glygen.org/publication/PubMed/34049076" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 120, "end_pos": 120, "sequence_org": "S", "sequence_mut": "A", "comment": "Normal nuclear localization.", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" }, { "database": "PubMed", "id": "21209322", "url": "https://glygen.org/publication/PubMed/21209322" } ] }, { "start_pos": 134, "end_pos": 134, "sequence_org": "S", "sequence_mut": "A", "comment": "Reduced nuclear localization.", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" }, { "database": "PubMed", "id": "21209322", "url": "https://glygen.org/publication/PubMed/21209322" } ] }, { "start_pos": 135, "end_pos": 135, "sequence_org": "T", "sequence_mut": "A", "comment": "Reduced nuclear localization.", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" }, { "database": "PubMed", "id": "21209322", "url": "https://glygen.org/publication/PubMed/21209322" } ] }, { "start_pos": 155, "end_pos": 155, "sequence_org": "S", "sequence_mut": "A", "comment": "Increased nuclear localization.", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" }, { "database": "PubMed", "id": "21209322", "url": "https://glygen.org/publication/PubMed/21209322" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "75.09", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000102908", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102908" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "84.29", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000102908", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102908" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "75.06", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000102908", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102908" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "58.41", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000102908", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102908" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "83.71", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000102908", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102908" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "83.74", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000102908", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102908" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "57.51", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000102908", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102908" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "83.27", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000102908", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102908" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "86.13", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000102908", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102908" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "71.49", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000102908", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102908" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "86.53", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000102908", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102908" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "80.96", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000102908", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102908" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "81.63", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000102908", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102908" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O94916", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94916" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O94916", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94916" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O94916", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94916" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O94916", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94916" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O94916", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94916" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O94916", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94916" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O94916", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94916" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O94916", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94916" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O94916", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94916" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O94916", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94916" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O94916", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94916" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O94916", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94916" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "common_name": "Human" } ], "gene": [ { "name": "NFAT5", "url": "https://www.uniprot.org/uniprot/O94916", "locus": { "chromosome": "16", "start_pos": 69704666, "end_pos": 69565094, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000102908", "url": "https://www.ensembl.org/id/ENSG00000102908" } ] } } ], "crossref": [ { "id": "ENSG00000102908", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102908", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd01178", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01178", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd07882", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd07882", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "NFAT5", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=NFAT5", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "10725", "url": "https://www.ncbi.nlm.nih.gov/gene/10725", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "7774", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=7774", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O94916", "url": "https://www.ebi.ac.uk/intact/interactors/id:O94916*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002909", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002909", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008366", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008366", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008967", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008967", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011539", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011539", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014756", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014756", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015646", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015646", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR032397", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032397", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037059", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037059", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:10725", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10725", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "604708", "url": "http://www.omim.org/entry/604708", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O94916", "url": "https://www.nextprot.org/entry/NX_O94916", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O94916", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O94916", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "PYQNQVI", "url": "https://omabrowser.org/oma/group/PYQNQVI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5405363at2759", "url": "http://www.orthodb.org/?query=5405363at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12533", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12533", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12533:SF10", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12533:SF10", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1IMH", "url": "https://www.rcsb.org/structure/1IMH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00554", "url": "http://pfam.xfam.org/family/PF00554", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF16179", "url": "http://pfam.xfam.org/family/PF16179", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O94916", "url": "https://pharos.nih.gov/targets/O94916", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O94916", "url": "http://purl.obolibrary.org/obo/PR_O94916", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001106649", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001106649", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A494C020", "url": "https://www.uniprot.org/uniprot/A0A494C020", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494C020-1", "url": "https://www.uniprot.org/uniprot/A0A494C020-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A499FIS8", "url": "https://www.uniprot.org/uniprot/A0A499FIS8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A499FIS8-1", "url": "https://www.uniprot.org/uniprot/A0A499FIS8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A499FJX5", "url": "https://www.uniprot.org/uniprot/A0A499FJX5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A499FJX5-1", "url": "https://www.uniprot.org/uniprot/A0A499FJX5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BP21", "url": "https://www.uniprot.org/uniprot/H3BP21", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BP21-1", "url": "https://www.uniprot.org/uniprot/H3BP21-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3KRL6", "url": "https://www.uniprot.org/uniprot/J3KRL6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3KRL6-1", "url": "https://www.uniprot.org/uniprot/J3KRL6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3QKS5", "url": "https://www.uniprot.org/uniprot/J3QKS5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3QKS5-1", "url": "https://www.uniprot.org/uniprot/J3QKS5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O94916-1", "url": "https://www.uniprot.org/uniprot/O94916-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O94916-2", "url": "https://www.uniprot.org/uniprot/O94916-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O94916-3", "url": "https://www.uniprot.org/uniprot/O94916-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O94916-4", "url": "https://www.uniprot.org/uniprot/O94916-4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O94916-5", "url": "https://www.uniprot.org/uniprot/O94916-5", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPSDFISLLSADLDLESPKSLYSRESVYDLLPKELQLPPSRETSVASMSQTSGGEAGSPPPAVVAADASSAPSSSSMGGACSSFTTSSSPTIYSTSVTDSKAMQVESCSSAVGVSNRGVSEKQLTSNTVQQHPSTPKRHTVLYISPPPEDLLDNSRMSCQDEGCGLESEQSCSMWMEDSPSNFSNMSTSSYNDNTEVPRKSRKRNPKQRPGVKRRDCEESNMDIFDADSAKAPHYVLSQLTTDNKGNSKAGNGTLENQKGTGVKKSPMLCGQYPVKSEGKELKIVVQPETQHRARYLTEGSRGSVKDRTQQGFPTVKLEGHNEPVVLQVFVGNDSGRVKPHGFYQACRVTGRNTTPCKEVDIEGTTVIEVGLDPSNNMTLAVDCVGILKLRNADVEARIGIAGSKKKSTRARLVFRVNIMRKDGSTLTLQTPSSPILCTQPAGVPEILKKSLHSCSVKGEEEVFLIGKNFLKGTKVIFQENVSDENSWKSEAEIDMELFHQNHLIVKVPPYHDQHITLPVSVGIYVVTNAGRSHDVQPFTYTPDPAAAGALNVNVKKEISSPARPCSFEEAMKAMKTTGCNLDKVNIIPNALMTPLIPSSMIKSEDVTPMEVTAEKRSSTIFKTTKSVGSTQQTLENISNIAGNGSFSSPSSSHLPSENEKQQQIQPKAYNPETLTTIQTQDISQPGTFPAVSASSQLPNSDALLQQATQFQTRETQSREILQSDGTVVNLSQLTEASQQQQQSPLQEQAQTLQQQISSNIFPSPNSVSQLQNTIQQLQAGSFTGSTASGSSGSVDLVQQVLEAQQQLSSVLFSAPDGNENVQEQLSADIFQQVSQIQSGVSPGMFSSTEPTVHTRPDNLLPGRAESVHPQSENTLSNQQQQQQQQQQVMESSAAMVMEMQQSICQAAAQIQSELFPSTASANGNLQQSPVYQQTSHMMSALSTNEDMQMQCELFSSPPAVSGNETSTTTTQQVATPGTTMFQTSSSGDGEETGTQAKQIQNSVFQTMVQMQHSGDNQPQVNLFSSTKSMMSVQNSGTQQQGNGLFQQGNEMMSLQSGNFLQQSSHSQAQLFHPQNPIADAQNLSQETQGSLFHSPNPIVHSQTSTTSSEQMQPPMFHSQSTIAVLQGSSVPQDQQSTNIFLSQSPMNNLQTNTVAQEAFFAAPNSISPLQSTSNSEQQAAFQQQAPISHIQTPMLSQEQAQPPQQGLFQPQVALGSLPPNPMPQSQQGTMFQSQHSIVAMQSNSPSQEQQQQQQQQQQQQQQQQQSILFSNQNTMATMASPKQPPPNMIFNPNQNPMANQEQQNQSIFHQQSNMAPMNQEQQPMQFQSQSTVSSLQNPGPTQSESSQTPLFHSSPQIQLVQGSPSSQEQQVTLFLSPASMSALQTSINQQDMQQSPLYSPQNNMPGIQGATSSPQPQATLFHNTAGGTMNQLQNSPGSSQQTSGMFLFGIQNNCSQLLTSGPATLPDQLMAISQPGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGNNLTGSF", "length": 1531, "header": "sp|O94916-1|NFAT5_HUMAN Isoform 1 of Nuclear factor of activated T-cells 5 OS=Homo sapiens OX=9606 GN=NFAT5 PE=1 SV=1 CANONICAL=O94916-1" }, "isoforms": [ { "isoform_ac": "A0A494C020-1", "url": "", "sequence": { "sequence": "MPSDFISLLSADLDLESPKSLYSRESVYDLLPKELQLPPSRETSVASMSQTSGGEAGSPPPAVVAADASSAPSSSSMGGACSSFTTSSSPTIYSTSVTDSKAMQVESCSSAVGNIGKPKRNWSKEEPYVVWTISC", "length": 135, "header": "tr|A0A494C020-1|NFAT5_HUMAN Computationally mapped isoform of Nuclear factor of activated T-cells 5 OS=Homo sapiens OX=9606 GN=NFAT5 PE=1 SV=1 CANONICAL=O94916-1" }, "locus": { "chromosome": "16", "start_pos": 69653301, "end_pos": 69566302, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000650987.1", "url": "https://www.ensembl.org/id/ENST00000650987.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000498326.1", "url": "https://www.ensembl.org/id/ENSP00000498326.1" } ] } }, { "isoform_ac": "A0A499FIS8-1", "url": "", "sequence": { "sequence": "MPSDFISLLSADLDLESPKSLYSRESVYDLLPKELQLPPSRETSVASMSQTSGGEAGSPPPAVVAAGFASEAGSVCIKNDL", "length": 81, "header": "tr|A0A499FIS8-1|A0A499FIS8_HUMAN Computationally mapped isoform of Nuclear factor of activated T cells 5 OS=Homo sapiens OX=9606 GN=NFAT5 PE=1 SV=1 CANONICAL=O94916-1" }, "locus": { "chromosome": "16", "start_pos": 69646560, "end_pos": 69566302, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000393742.7", "url": "https://www.ensembl.org/id/ENST00000393742.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000377343.3", "url": "https://www.ensembl.org/id/ENSP00000377343.3" } ] } }, { "isoform_ac": "A0A499FJX5-1", "url": "", "sequence": { "sequence": "XPKSLYSRESVYDLLPKELQLPPSRETSVASMSQTSGGEAGSPPPAVVAAGFASEAGSVCIKNDL", "length": 65, "header": "tr|A0A499FJX5-1|NFAT5_HUMAN Computationally mapped isoform of Nuclear factor of activated T-cells 5 OS=Homo sapiens OX=9606 GN=NFAT5 PE=1 SV=1 CANONICAL=O94916-1" }, "locus": { "chromosome": "16", "start_pos": 69646561, "end_pos": 69566351, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000566899.6", "url": "https://www.ensembl.org/id/ENST00000566899.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000455628.2", "url": "https://www.ensembl.org/id/ENSP00000455628.2" } ] } }, { "isoform_ac": "H3BP21-1", "url": "", "sequence": { "sequence": "MPSDFISLLSADLDLESPKSLYSRDSLKLHPSQNFHRAGLLEESVYDLLPKELQLPPSRETSVASMSQTSGGEAGSPPPAVVAAGIPEMFILCILMCMILRFKKGFASEAGSVCIKNDL", "length": 119, "header": "tr|H3BP21-1|NFAT5_HUMAN Computationally mapped isoform of Nuclear factor of activated T-cells 5 OS=Homo sapiens OX=9606 GN=NFAT5 PE=1 SV=1 CANONICAL=O94916-1" }, "locus": { "chromosome": "16", "start_pos": 69646560, "end_pos": 69566302, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000567990.5", "url": "https://www.ensembl.org/id/ENST00000567990.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000455115.1", "url": "https://www.ensembl.org/id/ENSP00000455115.1" } ] } }, { "isoform_ac": "J3KRL6-1", "url": "", "sequence": { "sequence": "XTLENQKGTGVKKSPMLCGQYPVKSEGKELKIVVQPETQHRARYLTEGSRGSVKDRTQQGFPTVKLEGHNEPVVLQVFVGNDSGRVKPHGFYQACRVTGRNTTPCKEVDIEGTTVIEVGLDPSNNMTLASASRSARNLKEKLA", "length": 143, "header": "tr|J3KRL6-1|J3KRL6_HUMAN Computationally mapped isoform of Nuclear factor of activated T cells 5 OS=Homo sapiens OX=9606 GN=NFAT5 PE=1 SV=1 CANONICAL=O94916-1" }, "locus": { "chromosome": "16", "start_pos": 69670021, "end_pos": 69653236, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000563474.2", "url": "https://www.ensembl.org/id/ENST00000563474.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000462061.1", "url": "https://www.ensembl.org/id/ENSP00000462061.1" } ] } }, { "isoform_ac": "J3QKS5-1", "url": "", "sequence": { "sequence": "XESPKSLYSRESVYDLLPKELQLPPSRETSVASMSQTSGGEAGSPPPAVVAADASSAPSSSSMGGACSSFTTSSSPTIYSTSVTDSKAMQVESCSSAVGNNMPGIQGATSSPQPQATLFHNTAGGTMNQLQNSPGSSQQTSGMFLFGIQNNCSQLLTSGPATLPDQLMAISQPGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGNNLTGSF", "length": 228, "header": "tr|J3QKS5-1|J3QKS5_HUMAN Computationally mapped isoform of Nuclear factor of activated T cells 5 OS=Homo sapiens OX=9606 GN=NFAT5 PE=1 SV=2 CANONICAL=O94916-1" }, "locus": { "chromosome": "16", "start_pos": 69695369, "end_pos": 69566345, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000565301.2", "url": "https://www.ensembl.org/id/ENST00000565301.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000463214.2", "url": "https://www.ensembl.org/id/ENSP00000463214.2" } ] } }, { "isoform_ac": "O94916-1", "url": "", "sequence": { "sequence": "MPSDFISLLSADLDLESPKSLYSRESVYDLLPKELQLPPSRETSVASMSQTSGGEAGSPPPAVVAADASSAPSSSSMGGACSSFTTSSSPTIYSTSVTDSKAMQVESCSSAVGVSNRGVSEKQLTSNTVQQHPSTPKRHTVLYISPPPEDLLDNSRMSCQDEGCGLESEQSCSMWMEDSPSNFSNMSTSSYNDNTEVPRKSRKRNPKQRPGVKRRDCEESNMDIFDADSAKAPHYVLSQLTTDNKGNSKAGNGTLENQKGTGVKKSPMLCGQYPVKSEGKELKIVVQPETQHRARYLTEGSRGSVKDRTQQGFPTVKLEGHNEPVVLQVFVGNDSGRVKPHGFYQACRVTGRNTTPCKEVDIEGTTVIEVGLDPSNNMTLAVDCVGILKLRNADVEARIGIAGSKKKSTRARLVFRVNIMRKDGSTLTLQTPSSPILCTQPAGVPEILKKSLHSCSVKGEEEVFLIGKNFLKGTKVIFQENVSDENSWKSEAEIDMELFHQNHLIVKVPPYHDQHITLPVSVGIYVVTNAGRSHDVQPFTYTPDPAAAGALNVNVKKEISSPARPCSFEEAMKAMKTTGCNLDKVNIIPNALMTPLIPSSMIKSEDVTPMEVTAEKRSSTIFKTTKSVGSTQQTLENISNIAGNGSFSSPSSSHLPSENEKQQQIQPKAYNPETLTTIQTQDISQPGTFPAVSASSQLPNSDALLQQATQFQTRETQSREILQSDGTVVNLSQLTEASQQQQQSPLQEQAQTLQQQISSNIFPSPNSVSQLQNTIQQLQAGSFTGSTASGSSGSVDLVQQVLEAQQQLSSVLFSAPDGNENVQEQLSADIFQQVSQIQSGVSPGMFSSTEPTVHTRPDNLLPGRAESVHPQSENTLSNQQQQQQQQQQVMESSAAMVMEMQQSICQAAAQIQSELFPSTASANGNLQQSPVYQQTSHMMSALSTNEDMQMQCELFSSPPAVSGNETSTTTTQQVATPGTTMFQTSSSGDGEETGTQAKQIQNSVFQTMVQMQHSGDNQPQVNLFSSTKSMMSVQNSGTQQQGNGLFQQGNEMMSLQSGNFLQQSSHSQAQLFHPQNPIADAQNLSQETQGSLFHSPNPIVHSQTSTTSSEQMQPPMFHSQSTIAVLQGSSVPQDQQSTNIFLSQSPMNNLQTNTVAQEAFFAAPNSISPLQSTSNSEQQAAFQQQAPISHIQTPMLSQEQAQPPQQGLFQPQVALGSLPPNPMPQSQQGTMFQSQHSIVAMQSNSPSQEQQQQQQQQQQQQQQQQQSILFSNQNTMATMASPKQPPPNMIFNPNQNPMANQEQQNQSIFHQQSNMAPMNQEQQPMQFQSQSTVSSLQNPGPTQSESSQTPLFHSSPQIQLVQGSPSSQEQQVTLFLSPASMSALQTSINQQDMQQSPLYSPQNNMPGIQGATSSPQPQATLFHNTAGGTMNQLQNSPGSSQQTSGMFLFGIQNNCSQLLTSGPATLPDQLMAISQPGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGNNLTGSF", "length": 1531, "header": "sp|O94916-1|NFAT5_HUMAN Isoform 1 of Nuclear factor of activated T-cells 5 OS=Homo sapiens OX=9606 GN=NFAT5 PE=1 SV=1 CANONICAL=O94916-1" }, "locus": { "chromosome": "16", "start_pos": 69695368, "end_pos": 69566302, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000354436.6", "url": "https://www.ensembl.org/id/ENST00000354436.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000346420.2", "url": "https://www.ensembl.org/id/ENSP00000346420.2" } ] } }, { "isoform_ac": "O94916-2", "url": "", "sequence": { "sequence": "MGGACSSFTTSSSPTIYSTSVTDSKAMQVESCSSAVGVSNRGVSEKQLTSNTVQQHPSTPKRHTVLYISPPPEDLLDNSRMSCQDEGCGLESEQSCSMWMEDSPSNFSNMSTSSYNDNTEVPRKSRKRNPKQRPGVKRRDCEESNMDIFDADSAKAPHYVLSQLTTDNKGNSKAGNGTLENQKGTGVKKSPMLCGQYPVKSEGKELKIVVQPETQHRARYLTEGSRGSVKDRTQQGFPTVKLEGHNEPVVLQVFVGNDSGRVKPHGFYQACRVTGRNTTPCKEVDIEGTTVIEVGLDPSNNMTLAVDCVGILKLRNADVEARIGIAGSKKKSTRARLVFRVNIMRKDGSTLTLQTPSSPILCTQPAGVPEILKKSLHSCSVKGEEEVFLIGKNFLKGTKVIFQENVSDENSWKSEAEIDMELFHQNHLIVKVPPYHDQHITLPVSVGIYVVTNAGRSHDVQPFTYTPDPAAAGALNVNVKKEISSPARPCSFEEAMKAMKTTGCNLDKVNIIPNALMTPLIPSSMIKSEDVTPMEVTAEKRSSTIFKTTKSVGSTQQTLENISNIAGNGSFSSPSSSHLPSENEKQQQIQPKAYNPETLTTIQTQDISQPGTFPAVSASSQLPNSDALLQQATQFQTRETQSREILQSDGTVVNLSQLTEASQQQQQSPLQEQAQTLQQQISSNIFPSPNSVSQLQNTIQQLQAGSFTGSTASGSSGSVDLVQQVLEAQQQLSSVLFSAPDGNENVQEQLSADIFQQVSQIQSGVSPGMFSSTEPTVHTRPDNLLPGRAESVHPQSENTLSNQQQQQQQQQQVMESSAAMVMEMQQSICQAAAQIQSELFPSTASANGNLQQSPVYQQTSHMMSALSTNEDMQMQCELFSSPPAVSGNETSTTTTQQVATPGTTMFQTSSSGDGEETGTQAKQIQNSVFQTMVQMQHSGDNQPQVNLFSSTKSMMSVQNSGTQQQGNGLFQQGNEMMSLQSGNFLQQSSHSQAQLFHPQNPIADAQNLSQETQGSLFHSPNPIVHSQTSTTSSEQMQPPMFHSQSTIAVLQGSSVPQDQQSTNIFLSQSPMNNLQTNTVAQEAFFAAPNSISPLQSTSNSEQQAAFQQQAPISHIQTPMLSQEQAQPPQQGLFQPQVALGSLPPNPMPQSQQGTMFQSQHSIVAMQSNSPSQEQQQQQQQQQQQQQQQQQSILFSNQNTMATMASPKQPPPNMIFNPNQNPMANQEQQNQSIFHQQSNMAPMNQEQQPMQFQSQSTVSSLQNPGPTQSESSQTPLFHSSPQIQLVQGSPSSQEQQVTLFLSPASMSALQTSINQQDMQQSPLYSPQNNMPGIQGATSSPQPQATLFHNTAGGTMNQLQNSPGSSQQTSGMFLFGIQNNCSQLLTSGPATLPDQLMAISQPGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGNNLTGSF", "length": 1455, "header": "sp|O94916-2|NFAT5_HUMAN Isoform 2 of Nuclear factor of activated T-cells 5 OS=Homo sapiens OX=9606 GN=NFAT5 PE=1 SV=1 CANONICAL=O94916-1" }, "locus": {} }, { "isoform_ac": "O94916-3", "url": "", "sequence": { "sequence": "MPSDFISLLSADLDLESPKSLYSRDSLKLHPSQNFHRAGLLEESVYDLLPKELQLPPSRETSVASMSQTSGGEAGSPPPAVVAAGFASEAGSVCIKNDL", "length": 99, "header": "sp|O94916-3|NFAT5_HUMAN Isoform 3 of Nuclear factor of activated T-cells 5 OS=Homo sapiens OX=9606 GN=NFAT5 PE=1 SV=1 CANONICAL=O94916-1" }, "locus": { "chromosome": "16", "start_pos": 69646560, "end_pos": 69566302, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000426654.6", "url": "https://www.ensembl.org/id/ENST00000426654.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000413126.2", "url": "https://www.ensembl.org/id/ENSP00000413126.2" } ] } }, { "isoform_ac": "O94916-4", "url": "", "sequence": { "sequence": "MPSDFISLLSADLDLESPKSLYSRDSLKLHPSQNFHRAGLLEESVYDLLPKELQLPPSRETSVASMSQTSGGEAGSPPPAVVAADASSAPSSSSMGGACSSFTTSSSPTIYSTSVTDSKAMQVESCSSAVGVSNRGVSEKQLTSNTVQQHPSTPKRHTVLYISPPPEDLLDNSRMSCQDEGCGLESEQSCSMWMEDSPSNFSNMSTSSYNDNTEVPRKSRKRNPKQRPGVKRRDCEESNMDIFDADSAKAPHYVLSQLTTDNKGNSKAGNGTLENQKGTGVKKSPMLCGQYPVKSEGKELKIVVQPETQHRARYLTEGSRGSVKDRTQQGFPTVKLEGHNEPVVLQVFVGNDSGRVKPHGFYQACRVTGRNTTPCKEVDIEGTTVIEVGLDPSNNMTLAVDCVGILKLRNADVEARIGIAGSKKKSTRARLVFRVNIMRKDGSTLTLQTPSSPILCTQPAGVPEILKKSLHSCSVKGEEEVFLIGKNFLKGTKVIFQENVSDENSWKSEAEIDMELFHQNHLIVKVPPYHDQHITLPVSVGIYVVTNAGRSHDVQPFTYTPDPAAGALNVNVKKEISSPARPCSFEEAMKAMKTTGCNLDKVNIIPNALMTPLIPSSMIKSEDVTPMEVTAEKRSSTIFKTTKSVGSTQQTLENISNIAGNGSFSSPSSSHLPSENEKQQQIQPKAYNPETLTTIQTQDISQPGTFPAVSASSQLPNSDALLQQATQFQTRETQSREILQSDGTVVNLSQLTEASQQQQQSPLQEQAQTLQQQISSNIFPSPNSVSQLQNTIQQLQAGSFTGSTASGSSGSVDLVQQVLEAQQQLSSVLFSAPDGNENVQEQLSADIFQQVSQIQSGVSPGMFSSTEPTVHTRPDNLLPGRAESVHPQSENTLSNQQQQQQQQQQVMESSAAMVMEMQQSICQAAAQIQSELFPSTASANGNLQQSPVYQQTSHMMSALSTNEDMQMQCELFSSPPAVSGNETSTTTTQQVATPGTTMFQTSSSGDGEETGTQAKQIQNSVFQTMVQMQHSGDNQPQVNLFSSTKSMMSVQNSGTQQQGNGLFQQGNEMMSLQSGNFLQQSSHSQAQLFHPQNPIADAQNLSQETQGSLFHSPNPIVHSQTSTTSSEQMQPPMFHSQSTIAVLQGSSVPQDQQSTNIFLSQSPMNNLQTNTVAQEAFFAAPNSISPLQSTSNSEQQAAFQQQAPISHIQTPMLSQEQAQPPQQGLFQPQVALGSLPPNPMPQSQQGTMFQSQHSIVAMQSNSPSQEQQQQQQQQQQQQQQQQQSILFSNQNTMATMASPKQPPPNMIFNPNQNPMANQEQQNQSIFHQQSNMAPMNQEQQPMQFQSQSTVSSLQNPGPTQSESSQTPLFHSSPQIQLVQGSPSSQEQQVTLFLSPASMSALQTSINQQDMQQSPLYSPQNNMPGIQGATSSPQPQATLFHNTAGGTMNQLQNSPGSSQQTSGMFLFGIQNNCSQLLTSGPATLPDQLMAISQPGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGNNLTGSF", "length": 1548, "header": "sp|O94916-4|NFAT5_HUMAN Isoform 4 of Nuclear factor of activated T-cells 5 OS=Homo sapiens OX=9606 GN=NFAT5 PE=1 SV=1 CANONICAL=O94916-1" }, "locus": { "chromosome": "16", "start_pos": 69695368, "end_pos": 69566302, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000567239.5", "url": "https://www.ensembl.org/id/ENST00000567239.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000457593.1", "url": "https://www.ensembl.org/id/ENSP00000457593.1" } ] } }, { "isoform_ac": "O94916-5", "url": "", "sequence": { "sequence": "MPSDFISLLSADLDLESPKSLYSRDSLKLHPSQNFHRAGLLEESVYDLLPKELQLPPSRETSVASMSQTSGGEAGSPPPAVVAADASSAPSSSSMGGACSSFTTSSSPTIYSTSVTDSKAMQVESCSSAVGVSNRGVSEKQLTSNTVQQHPSTPKRHTVLYISPPPEDLLDNSRMSCQDEGCGLESEQSCSMWMEDSPSNFSNMSTSSYNDNTEVPRKSRKRNPKQRPGVKRRDCEESNMDIFDADSAKAPHYVLSQLTTDNKGNSKAGNGTLENQKGTGVKKSPMLCGQYPVKSEGKELKIVVQPETQHRARYLTEGSRGSVKDRTQQGFPTVKLEGHNEPVVLQVFVGNDSGRVKPHGFYQACRVTGRNTTPCKEVDIEGTTVIEVGLDPSNNMTLAVDCVGILKLRNADVEARIGIAGSKKKSTRARLVFRVNIMRKDGSTLTLQTPSSPILCTQPAGVPEILKKSLHSCSVKGEEEVFLIGKNFLKGTKVIFQENVSDENSWKSEAEIDMELFHQNHLIVKVPPYHDQHITLPVSVGIYVVTNAGRSHDVQPFTYTPDPAAAGALNVNVKKEISSPARPCSFEEAMKAMKTTGCNLDKVNIIPNALMTPLIPSSMIKSEDVTPMEVTAEKRSSTIFKTTKSVGSTQQTLENISNIAGNGSFSSPSSSHLPSENEKQQQIQPKAYNPETLTTIQTQDISQPGTFPAVSASSQLPNSDALLQQATQFQTRETQSREILQSDGTVVNLSQLTEASQQQQQSPLQEQAQTLQQQISSNIFPSPNSVSQLQNTIQQLQAGSFTGSTASGSSGSVDLVQQVLEAQQQLSSVLFSAPDGNENVQEQLSADIFQQVSQIQSGVSPGMFSSTEPTVHTRPDNLLPGRAESVHPQSENTLSNQQQQQQQQQQVMESSAAMVMEMQQSICQAAAQIQSELFPSTASANGNLQQSPVYQQTSHMMSALSTNEDMQMQCELFSSPPAVSGNETSTTTTQQVATPGTTMFQTSSSGDGEETGTQAKQIQNSVFQTMVQMQHSGDNQPQVNLFSSTKSMMSVQNSGTQQQGNGLFQQGNEMMSLQSGNFLQQSSHSQAQLFHPQNPIADAQNLSQETQGSLFHSPNPIVHSQTSTTSSEQMQPPMFHSQSTIAVLQGSSVPQDQQSTNIFLSQSPMNNLQTNTVAQEAFFAAPNSISPLQSTSNSEQQAAFQQQAPISHIQTPMLSQEQAQPPQQGLFQPQVALGSLPPNPMPQSQQGTMFQSQHSIVAMQSNSPSQEQQQQQQQQQQQQQQQQQSILFSNQNTMATMASPKQPPPNMIFNPNQNPMANQEQQNQSIFHQQSNMAPMNQEQQPMQFQSQSTVSSLQNPGPTQSESSQTPLFHSSPQIQLVQGSPSSQEQQVTLFLSPASMSALQTSINQQDMQQSPLYSPQNNMPGIQGATSSPQPQATLFHNTAGGTMNQLQNSPGSSQQTSGMFLFGIQNNCSQLLTSGPATLPDQLMAISQPGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGNNLTGSF", "length": 1549, "header": "sp|O94916-5|NFAT5_HUMAN Isoform 5 of Nuclear factor of activated T-cells 5 OS=Homo sapiens OX=9606 GN=NFAT5 PE=1 SV=1 CANONICAL=O94916-1" }, "locus": { "chromosome": "16", "start_pos": 69695368, "end_pos": 69566302, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000349945.7", "url": "https://www.ensembl.org/id/ENST00000349945.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000338806.3", "url": "https://www.ensembl.org/id/ENSP00000338806.3" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O94916", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O94916" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" } ] } ], "phosphorylation": [ { "start_pos": 1197, "end_pos": 1197, "kinase_uniprot_canonical_ac": "Q13315-1", "kinase_gene_name": "ATM", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "O94916", "url": "http://phospho.elm.eu.org/byAccession/O94916.html" }, { "database": "iPTMnet", "id": "O94916", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94916" }, { "database": "PubMed", "id": "15173573", "url": "https://glygen.org/publication/PubMed/15173573" } ], "site_lbl": "Ser1197" }, { "start_pos": 1197, "end_pos": 1197, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O94916", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94916" }, { "database": "PubMed", "id": "15173573", "url": "https://glygen.org/publication/PubMed/15173573" }, { "database": "PubMed", "id": "24614757", "url": "https://glygen.org/publication/PubMed/24614757" } ], "site_lbl": "Ser1197" }, { "start_pos": 120, "end_pos": 120, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" }, { "database": "PubMed", "id": "21209322", "url": "https://glygen.org/publication/PubMed/21209322" }, { "database": "iPTMnet", "id": "O94916", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94916" } ], "site_lbl": "Ser120" }, { "start_pos": 1247, "end_pos": 1247, "kinase_uniprot_canonical_ac": "Q13315-1", "kinase_gene_name": "ATM", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "O94916", "url": "http://phospho.elm.eu.org/byAccession/O94916.html" }, { "database": "iPTMnet", "id": "O94916", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94916" }, { "database": "PubMed", "id": "15173573", "url": "https://glygen.org/publication/PubMed/15173573" } ], "site_lbl": "Ser1247" }, { "start_pos": 1247, "end_pos": 1247, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O94916", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94916" }, { "database": "PubMed", "id": "15173573", "url": "https://glygen.org/publication/PubMed/15173573" } ], "site_lbl": "Ser1247" }, { "start_pos": 134, "end_pos": 134, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" }, { "database": "PubMed", "id": "21209322", "url": "https://glygen.org/publication/PubMed/21209322" }, { "database": "iPTMnet", "id": "O94916", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94916" } ], "site_lbl": "Ser134" }, { "start_pos": 135, "end_pos": 135, "kinase_uniprot_canonical_ac": "P06493-1", "kinase_gene_name": "CDK1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O94916", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94916" }, { "database": "PubMed", "id": "21209322", "url": "https://glygen.org/publication/PubMed/21209322" } ], "site_lbl": "Thr135" }, { "start_pos": 135, "end_pos": 135, "kinase_uniprot_canonical_ac": "Q00535-1", "kinase_gene_name": "CDK5", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O94916", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94916" }, { "database": "PubMed", "id": "21209322", "url": "https://glygen.org/publication/PubMed/21209322" } ], "site_lbl": "Thr135" }, { "start_pos": 135, "end_pos": 135, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK5", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" }, { "database": "iPTMnet", "id": "O94916", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94916" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "21209322", "url": "https://glygen.org/publication/PubMed/21209322" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ], "site_lbl": "Thr135" }, { "start_pos": 1367, "end_pos": 1367, "kinase_uniprot_canonical_ac": "Q13315-1", "kinase_gene_name": "ATM", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "O94916", "url": "http://phospho.elm.eu.org/byAccession/O94916.html" }, { "database": "iPTMnet", "id": "O94916", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94916" }, { "database": "PubMed", "id": "15173573", "url": "https://glygen.org/publication/PubMed/15173573" } ], "site_lbl": "Ser1367" }, { "start_pos": 1367, "end_pos": 1367, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O94916", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94916" }, { "database": "PubMed", "id": "15173573", "url": "https://glygen.org/publication/PubMed/15173573" } ], "site_lbl": "Ser1367" }, { "start_pos": 143, "end_pos": 143, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O94916", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94916" }, { "database": "PubMed", "id": "20351292", "url": "https://glygen.org/publication/PubMed/20351292" }, { "database": "PubMed", "id": "30190682", "url": "https://glygen.org/publication/PubMed/30190682" } ], "site_lbl": "Tyr143" }, { "start_pos": 145, "end_pos": 145, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O94916", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94916" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser145" }, { "start_pos": 155, "end_pos": 155, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" }, { "database": "PubMed", "id": "21209322", "url": "https://glygen.org/publication/PubMed/21209322" }, { "database": "iPTMnet", "id": "O94916", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94916" }, { "database": "PubMed", "id": "22992674", "url": "https://glygen.org/publication/PubMed/22992674" } ], "site_lbl": "Ser155" }, { "start_pos": 17, "end_pos": 17, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O94916", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94916" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser17" }, { "start_pos": 298, "end_pos": 298, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O94916", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94916" }, { "database": "PubMed", "id": "22992674", "url": "https://glygen.org/publication/PubMed/22992674" } ], "site_lbl": "Thr298" }, { "start_pos": 3, "end_pos": 3, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O94916", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94916" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser3" }, { "start_pos": 433, "end_pos": 433, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O94916", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94916" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser433" }, { "start_pos": 560, "end_pos": 560, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O94916", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94916" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Ser560" }, { "start_pos": 561, "end_pos": 561, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O94916", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94916" } ], "site_lbl": "Ser561" }, { "start_pos": 646, "end_pos": 646, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O94916", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94916" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Ser646" }, { "start_pos": 648, "end_pos": 648, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O94916", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94916" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Ser648" }, { "start_pos": 649, "end_pos": 649, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O94916", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94916" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Ser649" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Tonicity-responsive enhancer binding protein, a rel-like protein that stimulates transcription in response to hypertonicity.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Miyakawa H, Woo SK, Dahl SC, Handler JS, Kwon HM", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "reference": [ { "type": "PubMed", "id": "10051678", "url": "https://glygen.org/publication/PubMed/10051678" } ] }, { "title": "NFAT5, a constitutively nuclear NFAT protein that does not cooperate with Fos and Jun.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Lopez-Rodriguez C, Aramburu J, Rakeman AS, Rao A", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "reference": [ { "type": "PubMed", "id": "10377394", "url": "https://glygen.org/publication/PubMed/10377394" } ] }, { "title": "Isolation and characterization of novel CAG repeat containing genes expressed in human brain.", "journal": "DNA Seq.", "date": "1999", "authors": "Zuhlke C, Kiehl R, Johannsmeyer A, Grzeschik KH, Schwinger E", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "reference": [ { "type": "PubMed", "id": "10565538", "url": "https://glygen.org/publication/PubMed/10565538" } ] }, { "title": "The NFAT-related protein NFATL1 (TonEBP/NFAT5) is induced upon T cell activation in a calcineurin-dependent manner.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2000", "authors": "Trama J, Lu Q, Hawley RG, Ho SN", "evidence": [ { "database": "RefSeq", "id": "NP_001106649", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001106649" } ], "reference": [ { "type": "PubMed", "id": "11046013", "url": "https://glygen.org/publication/PubMed/11046013" } ] }, { "title": "NFAT5: the NF-AT family of transcription factors expands in a new direction.", "journal": "Cold Spring Harb. Symp. Quant. Biol.", "date": "1999", "authors": "Lopez-Rodriguez C, Aramburu J, Rakeman AS, Copeland NG, Gilbert DJ, Thomas S, Disteche C, Jenkins NA, Rao A", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "reference": [ { "type": "PubMed", "id": "11233530", "url": "https://glygen.org/publication/PubMed/11233530" } ] }, { "title": "Genomic organization of the human NFAT5 gene: exon-intron structure of the 14-kb transcript and CpG-island analysis of the promoter region.", "journal": "Cytogenet. Cell Genet.", "date": "2001", "authors": "Dalski A, Schwinger E, Z\u00fchlke C", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "reference": [ { "type": "PubMed", "id": "11528118", "url": "https://glygen.org/publication/PubMed/11528118" } ] }, { "title": "Structure of a TonEBP-DNA complex reveals DNA encircled by a transcription factor.", "journal": "Nat. Struct. Biol.", "date": "2002", "authors": "Stroud JC, Lopez-Rodriguez C, Rao A, Chen L", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "reference": [ { "type": "PubMed", "id": "11780147", "url": "https://glygen.org/publication/PubMed/11780147" } ] }, { "title": "Mouse TonEBP-NFAT5: expression in early development and alternative splicing.", "journal": "Am. J. Physiol.", "date": "2002", "authors": "Maouyo Djikolngar, Kim Jee Y, Lee Sang D, Wu Yanhong, Woo Seung K, Kwon Hyug M", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "reference": [ { "type": "PubMed", "id": "11934689", "url": "https://glygen.org/publication/PubMed/11934689" } ] }, { "title": "ATM, a DNA damage-inducible kinase, contributes to activation by high NaCl of the transcription factor TonEBP/OREBP.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Irarrazabal CE, Liu JC, Burg MB, Ferraris JD", "evidence": [ { "database": "iPTMnet", "id": "O94916", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94916" } ], "reference": [ { "type": "PubMed", "id": "15173573", "url": "https://glygen.org/publication/PubMed/15173573" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "O94916-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94916-1" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O94916-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94916-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Contribution of SHP-1 protein tyrosine phosphatase to osmotic regulation of the transcription factor TonEBP/OREBP.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Zhou X, Gallazzini M, Burg MB, Ferraris JD", "evidence": [ { "database": "iPTMnet", "id": "O94916", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94916" } ], "reference": [ { "type": "PubMed", "id": "20351292", "url": "https://glygen.org/publication/PubMed/20351292" } ] }, { "title": "High NaCl-induced activation of CDK5 increases phosphorylation of the osmoprotective transcription factor TonEBP/OREBP at threonine 135, which contributes to its rapid nuclear localization.", "journal": "Molecular biology of the cell", "date": "2011", "authors": "Gallazzini M, Heussler GE, Kunin M, Izumi Y, Burg MB, Ferraris JD", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" }, { "database": "iPTMnet", "id": "O94916", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94916" } ], "reference": [ { "type": "PubMed", "id": "21209322", "url": "https://glygen.org/publication/PubMed/21209322" } ] }, { "title": "Dual role of the ddx5/ddx17 RNA helicases in the control of the pro-migratory NFAT5 transcription factor.", "journal": "Oncogene", "date": "2012", "authors": "Germann S, Gratadou L, Zonta E, Dardenne E, Gaudineau B, Fougere M, Samaan S, Dutertre M, Jauliac S, Auboeuf D", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "reference": [ { "type": "PubMed", "id": "22266867", "url": "https://glygen.org/publication/PubMed/22266867" } ] }, { "title": "Mutations that reduce its specific DNA binding inhibit high NaCl-induced nuclear localization of the osmoprotective transcription factor NFAT5.", "journal": "American journal of physiology. Cell physiology", "date": "2012", "authors": "Izumi Y, Li J, Villers C, Hashimoto K, Burg MB, Ferraris JD", "evidence": [ { "database": "iPTMnet", "id": "O94916", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94916" } ], "reference": [ { "type": "PubMed", "id": "22992674", "url": "https://glygen.org/publication/PubMed/22992674" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" }, { "database": "iPTMnet", "id": "O94916", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94916" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Proteome wide purification and identification of O-GlcNAc-modified proteins using click chemistry and mass spectrometry.", "journal": "Journal of proteome research", "date": "2013", "authors": "Hahne H, Sobotzki N, Nyberg T, Helm D, Borodkin VS, van Aalten DM, Agnew B, Kuster B", "evidence": [ { "database": "O-GlcNAc Database", "id": "O94916", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O94916" } ], "reference": [ { "type": "PubMed", "id": "23301498", "url": "https://glygen.org/publication/PubMed/23301498" } ] }, { "title": "Arterial wall stress controls NFAT5 activity in vascular smooth muscle cells.", "journal": "Journal of the American Heart Association", "date": "2014", "authors": "Scherer C, Pfisterer L, Wagner AH, Hodebeck M, Cattaruzza M, Hecker M, Korff T", "evidence": [ { "database": "iPTMnet", "id": "O94916", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94916" } ], "reference": [ { "type": "PubMed", "id": "24614757", "url": "https://glygen.org/publication/PubMed/24614757" } ] }, { "title": "Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2014", "authors": "Impens F, Radoshevich L, Cossart P, Ribet D", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "reference": [ { "type": "PubMed", "id": "25114211", "url": "https://glygen.org/publication/PubMed/25114211" } ] }, { "title": "Uncovering global SUMOylation signaling networks in a site-specific manner.", "journal": "Nat. Struct. Mol. Biol.", "date": "2014", "authors": "Hendriks IA, D'Souza RC, Yang B, Verlaan-de Vries M, Mann M, Vertegaal AC", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "reference": [ { "type": "PubMed", "id": "25218447", "url": "https://glygen.org/publication/PubMed/25218447" } ] }, { "title": "System-wide analysis of SUMOylation dynamics in response to replication stress reveals novel small ubiquitin-like modified target proteins and acceptor lysines relevant for genome stability.", "journal": "Mol. Cell. Proteomics", "date": "2015", "authors": "Xiao Zhenyu, Chang Jer-Gung, Hendriks Ivo A, Sigur\u00f0sson J\u00f3n Otti, Olsen Jesper V, Vertegaal Alfred C O", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "reference": [ { "type": "PubMed", "id": "25755297", "url": "https://glygen.org/publication/PubMed/25755297" } ] }, { "title": "SUMO-2 orchestrates chromatin modifiers in response to DNA damage.", "journal": "Cell Rep.", "date": "2015", "authors": "Hendriks Ivo A, Treffers Louise W, Verlaan-de Vries Matty, Olsen Jesper V, Vertegaal Alfred C O", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "reference": [ { "type": "PubMed", "id": "25772364", "url": "https://glygen.org/publication/PubMed/25772364" } ] }, { "title": "NFAT5 Isoform C Controls Biomechanical Stress Responses of Vascular Smooth Muscle Cells.", "journal": "Frontiers in physiology", "date": "2018", "authors": "Zappe M, Feldner A, Arnold C, Sticht C, Hecker M, Korff T", "evidence": [ { "database": "iPTMnet", "id": "O94916", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94916" } ], "reference": [ { "type": "PubMed", "id": "30190682", "url": "https://glygen.org/publication/PubMed/30190682" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "O94916", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O94916" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "O94916", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O94916" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "PARP1-mediated PARylation of TonEBP prevents R-loop-associated DNA damage.", "journal": "DNA repair", "date": "2021", "authors": "Ye BJ, Kang HJ, Lee-Kwon W, Kwon HM, Choi SY", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "reference": [ { "type": "PubMed", "id": "34049076", "url": "https://glygen.org/publication/PubMed/34049076" } ] }, { "title": "Truncation of the TPR domain of OGT alters substrate and glycosite selection.", "journal": "Analytical and bioanalytical chemistry", "date": "2021", "authors": "Ramirez DH, Yang B, D'Souza AK, Shen D, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "O94916", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O94916" } ], "reference": [ { "type": "PubMed", "id": "34725712", "url": "https://glygen.org/publication/PubMed/34725712" } ] }, { "title": "Circular RNA_0037128 aggravates high glucose-induced damage in HK-2 cells via regulation of microRNA-497-5p/nuclear factor of activated T cells 5 axis.", "journal": "Bioengineered", "date": "2021", "authors": "Feng T, Li W, Li T, Jiao W, Chen S", "evidence": [ { "database": "RefSeq", "id": "NP_001106649", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001106649" } ], "reference": [ { "type": "PubMed", "id": "34753398", "url": "https://glygen.org/publication/PubMed/34753398" } ] }, { "title": "NFAT5 Controls the Integrity of Epidermis.", "journal": "Frontiers in immunology", "date": "2021", "authors": "Muhammad K, Xavier D, Klein-Hessling S, Azeem M, Rauschenberger T, Murti K, Avots A, Goebeler M, Klein M, Bopp T, Sielaff M, Tenzer S, Mockel S, Aramburu J, Lopez-Rodriguez C, Kerstan A, Serfling E", "evidence": [ { "database": "RefSeq", "id": "NP_001106649", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001106649" } ], "reference": [ { "type": "PubMed", "id": "34956208", "url": "https://glygen.org/publication/PubMed/34956208" } ] }, { "title": "Spatiotemporal Activation of Protein O-GlcNAcylation in Living Cells.", "journal": "Journal of the American Chemical Society", "date": "2022", "authors": "He J, Fan Z, Tian Y, Yang W, Zhou Y, Zhu Q, Zhang W, Qin W, Yi W", "evidence": [ { "database": "O-GlcNAc Database", "id": "O94916", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O94916" } ], "reference": [ { "type": "PubMed", "id": "35138101", "url": "https://glygen.org/publication/PubMed/35138101" } ] }, { "title": "Associations of the Methylation Levels of NFAT5, PVT1, RPS6KA1, and MIB1 with Steroid-Resistant Asthma.", "journal": "International archives of allergy and immunology", "date": "2022", "authors": "Chen L, Wang W, Leng Q, Cong L, Wu C, Yang X", "evidence": [ { "database": "RefSeq", "id": "NP_001106649", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001106649" } ], "reference": [ { "type": "PubMed", "id": "35417913", "url": "https://glygen.org/publication/PubMed/35417913" } ] }, { "title": "SAFB2 Inhibits the Progression of Breast Cancer by Suppressing the Wnt/\u03b2-Catenin Signaling Pathway via NFAT5.", "journal": "Molecular biotechnology", "date": "2023-09", "authors": "Zhen Huifen, Yao Yarong, Yang Haibo", "evidence": [ { "database": "RefSeq", "id": "NP_001106649", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001106649" } ], "reference": [ { "type": "PubMed", "id": "36652182", "url": "https://glygen.org/publication/PubMed/36652182" } ] }, { "title": "TonEBP expression is essential in the IL-1\u03b2-induced migration and invasion of human A549 lung cancer cells.", "journal": "Oncology research", "date": "2023", "authors": "Song Hee Ju, Kim Taehee, Choi Han Na, Kim Soo Jin, Lee Sang DO", "evidence": [ { "database": "RefSeq", "id": "NP_001106649", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001106649" } ], "reference": [ { "type": "PubMed", "id": "38188678", "url": "https://glygen.org/publication/PubMed/38188678" } ] } ], "pathway": [ { "id": "hsa:10725", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10725", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZGB1-1", "protein_name": "Nuclear factor of activated T-cells 5", "gene_name": "Nfat5", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MPSDFISLLSADLDLESPKSLYSRDSLKLHPSQNFHRAGLLEESVYDLLPKELQLPPPRETSAASMSQTSGGEAGSPPPAVVAADASSAPSSSMGGACSSFTTSSSPTIYSTSVTDSKAMQVESCSSAVGVSNRGVSEKQLTGNTVQQHPSTPKRHTVLYISPPPEDLLDNSRMSCQDEGCGLESEQSCSMWMEDSPSNFSNMSTSSYNDNTEVPRKSRKRNPKQRPGVKRRDCEESNMDIFDADSAKAPHYVLSQLTTDNKGNSKAGNGTLDSQKGTGVKKSPMLCGQYPVKSEGKELKIVVQPETQHRARYLTEGSRGSVKDRTQQGFPTVKLEGHNEPVVLQVFVGNDSGRVKPHGFYQACRVTGRNTTPCKEVDIEGTTVIEVGLDPSSNMTLAVDCVGILKLRNADVEARIGIAGSKKKSTRARLVFRVNITRKDGSTLTLQTPSSPILCTQPAGVPEILKKSLHSCSVKGEEEVFLIGKNFLKGTKVIFQENVSDENSWKSEAEIDMELFHQNHLIVKVPPYHDQHITLPVSVGIYVVTNAGRSHDVQPFTYTPDPAAGALSVNVKKEISSPARPCSFEEALKAMKTTGCNVDKVTILPNALITPLISSSMIKTEDVTPMEVTSEKRSSPIFQTTKTVGSTQQTLETISNIAGNASFSSPSSSHLSPENENQQQLQPKAYNPETLTTIQTQDISQPGTFPAVSASSQLPSSDALLQQAAQFQTRDAQSRDTMQSDSVVNLSQLTEAPQQQQSPLQEQAQIPSNIFPSPNSVSQLQSTIQQLQAGSFTGSTASGSNGSVDLVQQVLEAQQQLSSVLFSTPDGNENVQEQLNADIFQVSQIQNSVSPGMFSSTESAVHTRPDNLLPGRADSVHQQTENTLSSQQQQQQQQQQQQQQQVIESSAAMVMEMQQSICQAAAQIQSELFPSAASANGSLQQSPVYQQPSHMMSALPTSEDMQMQCELFSSPPAVSGNETSTTTTPQVATPGSTMFQPPNSGDGEETGAQAKQIQSSVFQTMVQMQHSGDSQPQVNLFSSTKNIMSVQSNGTQQQGNSLFQQGSEMLSLQSGSFLQQSSHSQAQLFHPQNPIADAQSLSQETQGPMFHSANPIVHSQTSTASSEQLQPSMFHSQSTIAVLQGSSVPQDQQSPNIYLSQSSISNLQTNTVAQEEQISFFSAQNSISPLQSTSNTEQQAAFQQQPPISHIQTPLLSQEQAQPSQQGLFQPQVALGSLPANPMPQNQQGPIFQTQRPIVGMQSNSPSQEQQQQQQQQQQQQQQQQQQSILFSNQNAMATMASQKQPPPNMIFSPNQNPMASQEQQNQSIFHQQSNMAPMNQEQQPMQFQNQPTVSSLQNPGPTPSESPQTSLFHSSPQIQLVQGSPSSQEQQVTLFLSPASMSALQTSINQPDMQQSPLYSPQNNIPGIQGSTSSPQPQAALFHNTTGGTINQLQNSPGSSQQTSGMFLFGIQNNCSQLLTSGPATLPEQLMAINQPGQPQNEGQSSVTTLLSQQMPESAPLASSVNNSQNMEKIDLLVSLQSQGNNLTGSF", "length": 1548 }, "evidence": [ { "id": "45924180", "url": "http://www.informatics.jax.org/homology/45924180", "database": "MGI" }, { "id": "O94916", "url": "https://omabrowser.org/oma/group/O94916/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9WV30-1", "protein_name": "Nuclear factor of activated T-cells 5", "gene_name": "Nfat5", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MPSDFISLLSADLDLESPKSLYSRESVYDLLPKELQLPPPRETSVASMSQTSGGEAGSPPPAVVAADASSAPSSSSMGGACSSFTTSSSPTIYSTSVTDSKAMQVESCSSAVGVSNRGVSEKQLTGNTVQQHPSTPKRHTVLYISPPPEDLLDNSRMSCQDEGCGLESEQSCSMWMEDSPSNFSNMSTSSYNDNTEVPRKSRKRNPKQRPGVKRRDCEESNMDIFDADSAKAPHYVLSQLTTDNKGNSKAGNGTLDSQKGTGVKKSPMLCGQYPVKSEGKELKIVVQPETQHRARYLTEGSRGSVKDRTQQGFPTVKLEGHNEPVVLQVFVGNDSGRVKPHGFYQACRVTGRNTTPCKEVDIEGTTVIEVGLDPSNNMTLAVDCVGILKLRNADVEARIGIAGSKKKSTRARLVFRVNITRKDGSTLTLQTPSSPILCTQPAGVPEILKKSLHSCSVKGEEEVFLIGKNFLKGTKVIFQENVSDENSWKSEAEIDMELFHQNHLIVKVPPYHDQHITLPVSVGIYVVTNAGRSHDVQPFTYTPDPAAGALNVNVKKEISSPARPCSFEEAMKAMKTTGCNVDKVTILPNALITPLISSSMIKTEDVTPMEVTSEKRSSPIFQTTKSIGSTQQTLETISNIAGGAPFSSPSSSSHLTPESENQQQLQPKAYNPETLTTIQTQDISQPGTFPAVSAASQLPSSDALLQQATQFQTREAQSRDTIQSDTVVNLSQLTEASQQQQSPLQEQAQTLQQQIPSNIFPSPSSVSQLQSTIQQLQAGSFTGSAAGGRSGSVDLVQQVLEAQQQLSSVLFSTPDGNENVQEQLNADIFQVSQIQNSVSPGMFSSAESAVHTRPDNLLPGRADSVHQQTENTLSNQQQQQQQQQQVMESSAAMVMEMQQSICQAAAQIQSELFPSAASASGSLQQSPVYQQPSHMMSALPTNEDMQMQCELFSSPPAASGNETSTTTTPQVATPGSTMFQTPSSGDGEETGAQAKQIQNSVFQTMVQMQRSGDSQPQVNLFSSTKNIMSVQNNGTQQQGNSLFQQGSEMMSLQSGNFLQQSSHSQAQLFHPQNPIADAQNLSQETQGSIFHSPNPIVHSQTSTASSEQLQPSMFHSQNTIAVLQGSSVPQDQQSPNIFLSQSSINNLQTNTVAQEEQISFFAAQNSISPLQSTSNTEQQAAFQQQPPISHIQTPILSQEQAQPSQQGLFQPQVALGSLPPNPMPQNQQGPIFQTQRPIVGMQSNSPSQEQQQQQQQQQQQQQQQQQQQQSILFSNQNAMATMASQKQPPPNMMFSPNQNPMASQEQQNQSIFHQQSNMAPMNQEQQPMQFQNQPTVSSLQNPGPTQSESPQTSLFHSSPQIQLVQGSPSSQDQQVTLFLSPASMSALQTSINQPDMQQSPLYSPQNNIPGIQGSTSSPQPQATLFHNTTGGTINQIQNSPGSSQQTSGMFLFGIQNNCSQLLTSGPATLPDQLMAINQQGQPQNEGQSSVTTLLSQQMPETSPLASSVNSSQNMEKIDLLVSLQSQGNNLTGSF", "length": 1534 }, "evidence": [ { "id": "45924180", "url": "http://www.informatics.jax.org/homology/45924180", "database": "MGI" }, { "id": "O94916", "url": "https://omabrowser.org/oma/group/O94916/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 13, "go_terms": [ { "name": "positive regulation of leukocyte adhesion to vascular endothelial cell", "id": "GO:1904996", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904996", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "pmid": "" }, { "name": "regulation of calcineurin-NFAT signaling cascade", "id": "GO:0070884", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070884", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "pmid": "" }, { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "pmid": "" }, { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "pmid": "" }, { "name": "positive regulation of gene expression", "id": "GO:0010628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "pmid": "" }, { "name": "DNA damage response", "id": "GO:0006974", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006974", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "pmid": "" }, { "name": "positive regulation of canonical NF-kappaB signal transduction", "id": "GO:0043123", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043123", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "pmid": "" }, { "name": "transcription by RNA polymerase II", "id": "GO:0006366", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006366", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "pmid": "" }, { "name": "cellular response to cytokine stimulus", "id": "GO:0071345", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071345", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "pmid": "" }, { "name": "cellular hyperosmotic response", "id": "GO:0071474", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071474", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "pmid": "" }, { "name": "calcineurin-NFAT signaling cascade", "id": "GO:0033173", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033173", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "pmid": "" }, { "name": "R-loop processing", "id": "GO:0062176", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062176", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 7, "go_terms": [ { "name": "chromatin binding", "id": "GO:0003682", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003682", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity", "id": "GO:0003700", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003700", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "pmid": "" }, { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "pmid": "" }, { "name": "DNA-binding transcription activator activity, RNA polymerase II-specific", "id": "GO:0001228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001228", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "pmid": "" }, { "name": "sequence-specific double-stranded DNA binding", "id": "GO:1990837", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990837", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "pmid": "" }, { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "pmid": "" }, { "name": "transcription regulator complex", "id": "GO:0005667", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005667", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "pmid": "" }, { "name": "chromatin", "id": "GO:0000785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000785", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 1083, "end_pos": 1085, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1305, "end_pos": 1307, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1454, "end_pos": 1456, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1526, "end_pos": 1528, "annotation": "n_glycosylation_sequon" }, { "start_pos": 182, "end_pos": 184, "annotation": "n_glycosylation_sequon" }, { "start_pos": 185, "end_pos": 187, "annotation": "n_glycosylation_sequon" }, { "start_pos": 252, "end_pos": 254, "annotation": "n_glycosylation_sequon" }, { "start_pos": 333, "end_pos": 335, "annotation": "n_glycosylation_sequon" }, { "start_pos": 353, "end_pos": 355, "annotation": "n_glycosylation_sequon" }, { "start_pos": 377, "end_pos": 379, "annotation": "n_glycosylation_sequon" }, { "start_pos": 481, "end_pos": 483, "annotation": "n_glycosylation_sequon" }, { "start_pos": 637, "end_pos": 639, "annotation": "n_glycosylation_sequon" }, { "start_pos": 644, "end_pos": 646, "annotation": "n_glycosylation_sequon" }, { "start_pos": 730, "end_pos": 732, "annotation": "n_glycosylation_sequon" }, { "start_pos": 964, "end_pos": 966, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylated (PubMed:10377394). Phosphorylated at Thr-135 by CDK5 in response to osmotic stress; this phosphorylation mediates its rapid nuclear localization (PubMed:21209322).", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" }, { "database": "PubMed", "id": "10377394", "url": "https://glygen.org/publication/PubMed/10377394" }, { "database": "PubMed", "id": "21209322", "url": "https://glygen.org/publication/PubMed/21209322" } ] }, { "annotation": "Poly-ADP-ribosylated by PARP1 in response to DNA damage, promoting recruitment to sites of R-loop-associated DNA damage.", "evidence": [ { "database": "UniProtKB", "id": "O94916", "url": "https://www.uniprot.org/uniprot/O94916" }, { "database": "PubMed", "id": "34049076", "url": "https://glygen.org/publication/PubMed/34049076" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 3, 17, 120, 134, 135, 143, 145, 155, 298, 433, 560, 561, 646, 648, 649, 1197, 1247, 1367 ], "sequon_annotation_sites": [ { "start_pos": 1083, "end_pos": 1085 }, { "start_pos": 1305, "end_pos": 1307 }, { "start_pos": 1454, "end_pos": 1456 }, { "start_pos": 1526, "end_pos": 1528 }, { "start_pos": 182, "end_pos": 184 }, { "start_pos": 185, "end_pos": 187 }, { "start_pos": 252, "end_pos": 254 }, { "start_pos": 333, "end_pos": 335 }, { "start_pos": 353, "end_pos": 355 }, { "start_pos": 377, "end_pos": 379 }, { "start_pos": 481, "end_pos": 483 }, { "start_pos": 637, "end_pos": 639 }, { "start_pos": 644, "end_pos": 646 }, { "start_pos": 730, "end_pos": 732 }, { "start_pos": 964, "end_pos": 966 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 23 }, { "field": "total_sites", "count": 18 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 33 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }