{ "uniprot_canonical_ac": "O94760-1", "uniprot_ac": "O94760", "uniprot_id": "DDAH1_HUMAN", "mass": { "chemical_mass": 31122.0, "monoisotopic_mass": 31122.0 }, "refseq": { "ac": "NP_001127917", "name": "N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 isoform 2", "summary": "This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127917" }, "gene_names": [ { "name": "DDAH1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O94760", "id": "O94760" }, { "name": "DDAH1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127917", "id": "NP_001127917" }, { "name": "DDAH; DDAH-1; DDAHI; HEL-S-16", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127917", "id": "NP_001127917" }, { "name": "DDAH", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O94760", "id": "O94760" } ], "protein_names": [ { "name": "N(G),N(G)-dimethylarginine dimethylaminohydrolase 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O94760" }, { "name": "3.5.3.18", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O94760" }, { "name": "DDAH-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O94760" }, { "name": "DDAHI", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O94760" }, { "name": "Dimethylargininase-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O94760" }, { "name": "Dimethylarginine dimethylaminohydrolase 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O94760" }, { "name": "N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127917", "id": "NP_001127917" }, { "name": "NG, NG-dimethylarginine dimethylaminohydrolase; n(G),N(G)-dimethylarginine dimethylaminohydrolase 1; epididymis secretory protein Li 16; dimethylargininase-1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127917", "id": "NP_001127917" } ], "function": [ { "annotation": "Dimethylarginine Dimethylaminohydrolase - 1 expression is increased under tBHP-induced oxidative stress regulates nitric oxide production in PCa cells attenuates mitochondrial ROS-mediated apoptosis.", "evidence": [ { "database": "RefSeq", "id": "NP_001127917", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127917" }, { "database": "PubMed", "id": "37423418", "url": "https://glygen.org/publication/PubMed/37423418" } ] }, { "annotation": "Genome-wide admixture and association analysis identifies African ancestry-specific risk loci of eosinophilic esophagitis in African Americans.", "evidence": [ { "database": "RefSeq", "id": "NP_001127917", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127917" }, { "database": "PubMed", "id": "36400179", "url": "https://glygen.org/publication/PubMed/36400179" } ] }, { "annotation": "Hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. Has therefore a role in the regulation of nitric oxide generation.", "evidence": [ { "database": "UniProtKB", "id": "B4DYP1", "url": "https://www.uniprot.org/uniprot/B4DYP1#function" }, { "database": "UniProtKB", "id": "ARBA00025660", "url": "https://www.uniprot.org/uniprot/ARBA00025660#function" }, { "database": "UniProtKB", "id": "O94760", "url": "https://www.uniprot.org/uniprot/O94760#function" }, { "database": "PubMed", "id": "18171027", "url": "https://glygen.org/publication/PubMed/18171027" }, { "database": "PubMed", "id": "19663506", "url": "https://glygen.org/publication/PubMed/19663506" }, { "database": "PubMed", "id": "37296100", "url": "https://glygen.org/publication/PubMed/37296100" }, { "database": "PubMed", "id": "21493890", "url": "https://glygen.org/publication/PubMed/21493890" } ] }, { "annotation": "LncRNA DANCR deficiency promotes high glucose-induced endothelial to mesenchymal transition in cardiac microvascular cells via the FoxO1/DDAH1/ADMA signaling pathway.", "evidence": [ { "database": "RefSeq", "id": "NP_001127917", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127917" }, { "database": "PubMed", "id": "37116560", "url": "https://glygen.org/publication/PubMed/37116560" } ] }, { "annotation": "The effect of haptoglobin genotype on the association of asymmetric dimethylarginine and DDAH 1 polymorphism with diabetic macroangiopathy. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001127917", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127917" }, { "database": "PubMed", "id": "36461077", "url": "https://glygen.org/publication/PubMed/36461077" } ] }, { "annotation": "This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001127917", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127917" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 271, "end_pos": 271, "sequence_org": "L", "sequence_mut": "G", "comment": "Reduces enzyme activity about 10-fold, and affinity for asymmetric dimethylarginine about 7-fold.", "evidence": [ { "database": "UniProtKB", "id": "O94760", "url": "https://www.uniprot.org/uniprot/O94760" }, { "database": "PubMed", "id": "19663506", "url": "https://glygen.org/publication/PubMed/19663506" } ] }, { "start_pos": 30, "end_pos": 30, "sequence_org": "L", "sequence_mut": "A", "comment": "Reduces enzyme activity and affinity for asymmetric dimethylarginine about 12-fold.", "evidence": [ { "database": "UniProtKB", "id": "O94760", "url": "https://www.uniprot.org/uniprot/O94760" }, { "database": "PubMed", "id": "19663506", "url": "https://glygen.org/publication/PubMed/19663506" } ] }, { "start_pos": 78, "end_pos": 78, "sequence_org": "E", "sequence_mut": "A", "comment": "Reduces enzyme activity about 1000-fold, and affinity for asymmetric dimethylarginine about 100-fold.", "evidence": [ { "database": "UniProtKB", "id": "O94760", "url": "https://www.uniprot.org/uniprot/O94760" }, { "database": "PubMed", "id": "19663506", "url": "https://glygen.org/publication/PubMed/19663506" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "97.51", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000153904", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000153904" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "76.28", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000153904", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000153904" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "94.04", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000153904", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000153904" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "84.3", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000153904", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000153904" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "75.06", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000153904", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000153904" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "95.66", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000153904", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000153904" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "97.54", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000153904", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000153904" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "89.84", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000153904", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000153904" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "86.63", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000153904", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000153904" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "94.06", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000153904", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000153904" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "94.21", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000153904", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000153904" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "87.21", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000153904", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000153904" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "83.41", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000153904", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000153904" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O94760", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94760" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O94760", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94760" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O94760", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94760" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O94760", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94760" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O94760", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94760" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O94760", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94760" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O94760", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94760" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O94760", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94760" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O94760", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94760" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O94760", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94760" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O94760", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94760" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O94760", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O94760" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O94760", "url": "https://www.uniprot.org/uniprot/O94760" } ], "common_name": "Human" } ], "gene": [ { "name": "DDAH1", "url": "https://www.uniprot.org/uniprot/O94760", "locus": { "chromosome": "1", "start_pos": 85318481, "end_pos": 85578363, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000153904", "url": "https://www.ensembl.org/id/ENSG00000153904" } ] } } ], "crossref": [ { "id": "ENSG00000153904", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000153904", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "3.5.3.18", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.5.3.18&UniProtAcc=O94760", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "CHEMBL6036", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL6036", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "DDAH1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=DDAH1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "23576", "url": "https://www.ncbi.nlm.nih.gov/gene/23576", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "2715", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=2715", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O94760", "url": "https://www.ebi.ac.uk/intact/interactors/id:O94760*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR033199", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033199", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:23576", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:23576", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "604743", "url": "http://www.omim.org/entry/604743", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O94760", "url": "https://www.nextprot.org/entry/NX_O94760", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O94760", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O94760", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "HRYTHAI", "url": "https://omabrowser.org/oma/group/HRYTHAI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "315054at2759", "url": "http://www.orthodb.org/?query=315054at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12737", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12737", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12737:SF17", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12737:SF17", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2JAI", "url": "https://www.rcsb.org/structure/2JAI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2JAJ", "url": "https://www.rcsb.org/structure/2JAJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3I2E", "url": "https://www.rcsb.org/structure/3I2E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3I4A", "url": "https://www.rcsb.org/structure/3I4A", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3P8E", "url": "https://www.rcsb.org/structure/3P8E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3P8P", "url": "https://www.rcsb.org/structure/3P8P", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6DGE", "url": "https://www.rcsb.org/structure/6DGE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6SZP", "url": "https://www.rcsb.org/structure/6SZP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6SZQ", "url": "https://www.rcsb.org/structure/6SZQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7ULU", "url": "https://www.rcsb.org/structure/7ULU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7ULV", "url": "https://www.rcsb.org/structure/7ULV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7ULX", "url": "https://www.rcsb.org/structure/7ULX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7USZ", "url": "https://www.rcsb.org/structure/7USZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7UT0", "url": "https://www.rcsb.org/structure/7UT0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF19420", "url": "http://pfam.xfam.org/family/PF19420", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O94760", "url": "https://pharos.nih.gov/targets/O94760", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O94760", "url": "http://purl.obolibrary.org/obo/PR_O94760", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001127917", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127917", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "17305", "url": "https://www.rhea-db.org/rhea/17305", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "25173", "url": "https://www.rhea-db.org/rhea/25173", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "B4DYP1", "url": "https://www.uniprot.org/uniprot/B4DYP1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B4DYP1-1", "url": "https://www.uniprot.org/uniprot/B4DYP1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O94760", "url": "https://www.uniprot.org/uniprot/O94760", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O94760-1", "url": "https://www.uniprot.org/uniprot/O94760-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O94760-2", "url": "https://www.uniprot.org/uniprot/O94760-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAGLGHPAAFGRATHAVVRALPESLGQHALRSAKGEEVDVARAERQHQLYVGVLGSKLGLQVVELPADESLPDCVFVEDVAVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADTFKDYAVSTVPVADGLHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINKKVDS", "length": 285, "header": "sp|O94760-1|DDAH1_HUMAN Isoform 1 of N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 OS=Homo sapiens OX=9606 GN=DDAH1 PE=1 SV=3 CANONICAL=O94760-1" }, "isoforms": [ { "isoform_ac": "B4DYP1-1", "url": "", "sequence": { "sequence": "MVDMMKEALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADTFKDYAVSTVPVADGLHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINKKVDS", "length": 185, "header": "tr|B4DYP1-1|DDAH1_HUMAN Computationally mapped isoform of N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 OS=Homo sapiens OX=9606 GN=DDAH1 PE=1 SV=1 CANONICAL=O94760-1" }, "locus": { "chromosome": "1", "start_pos": 85404383, "end_pos": 85321455, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000633113.1", "url": "https://www.ensembl.org/id/ENST00000633113.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000488725.1", "url": "https://www.ensembl.org/id/ENSP00000488725.1" } ] } }, { "isoform_ac": "O94760-1", "url": "", "sequence": { "sequence": "MAGLGHPAAFGRATHAVVRALPESLGQHALRSAKGEEVDVARAERQHQLYVGVLGSKLGLQVVELPADESLPDCVFVEDVAVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADTFKDYAVSTVPVADGLHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINKKVDS", "length": 285, "header": "sp|O94760-1|DDAH1_HUMAN Isoform 1 of N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 OS=Homo sapiens OX=9606 GN=DDAH1 PE=1 SV=3 CANONICAL=O94760-1" }, "locus": { "chromosome": "1", "start_pos": 85465045, "end_pos": 85321455, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000284031.13", "url": "https://www.ensembl.org/id/ENST00000284031.13" }, { "database": "Ensembl Peptide", "id": "ENSP00000284031.8", "url": "https://www.ensembl.org/id/ENSP00000284031.8" } ] } }, { "isoform_ac": "O94760-2", "url": "", "sequence": { "sequence": "MMKEALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADTFKDYAVSTVPVADGLHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINKKVDS", "length": 182, "header": "sp|O94760-2|DDAH1_HUMAN Isoform 2 of N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 OS=Homo sapiens OX=9606 GN=DDAH1 PE=1 SV=3 CANONICAL=O94760-1" }, "locus": { "chromosome": "1", "start_pos": 85358841, "end_pos": 85321455, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000426972.8", "url": "https://www.ensembl.org/id/ENST00000426972.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000411189.4", "url": "https://www.ensembl.org/id/ENSP00000411189.4" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O94760", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O94760" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" } ] } ], "phosphorylation": [ { "start_pos": 261, "end_pos": 261, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O94760", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94760" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser261" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Regulation of endothelium-derived nitric oxide production by the protein kinase Akt.", "journal": "Nature", "date": "1999", "authors": "Fulton D, Gratton JP, McCabe TJ, Fontana J, Fujio Y, Walsh K, Franke TF, Papapetropoulos A, Sessa WC", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "10376602", "url": "https://glygen.org/publication/PubMed/10376602" } ] }, { "title": "Activation of nitric oxide synthase in endothelial cells by Akt-dependent phosphorylation.", "journal": "Nature", "date": "1999", "authors": "Dimmeler S, Fleming I, Fisslthaler B, Hermann C, Busse R, Zeiher AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "10376603", "url": "https://glygen.org/publication/PubMed/10376603" } ] }, { "title": "The Akt kinase signals directly to endothelial nitric oxide synthase.", "journal": "Current biology : CB", "date": "1999", "authors": "Michell BJ, Griffiths JE, Mitchelhill KI, Rodriguez-Crespo I, Tiganis T, Bozinovski S, de Montellano PR, Kemp BE, Pearson RB", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "10469573", "url": "https://glygen.org/publication/PubMed/10469573" } ] }, { "title": "Identification of two human dimethylarginine dimethylaminohydrolases with distinct tissue distributions and homology with microbial arginine deiminases.", "journal": "Biochem. J.", "date": "1999", "authors": "Leiper JM, Santa Maria J, Chubb A, MacAllister RJ, Charles IG, Whitley GS, Vallance P", "evidence": [ { "database": "UniProtKB", "id": "O94760", "url": "https://www.uniprot.org/uniprot/O94760" } ], "reference": [ { "type": "PubMed", "id": "10493931", "url": "https://glygen.org/publication/PubMed/10493931" } ] }, { "title": "Targeting and translocation of endothelial nitric oxide synthase.", "journal": "Brazilian journal of medical and biological research = Revista brasileira de pesquisas medicas e biologicas", "date": "1999", "authors": "Michel T", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "10559837", "url": "https://glygen.org/publication/PubMed/10559837" } ] }, { "title": "Reconstitution of an endothelial nitric-oxide synthase (eNOS), hsp90, and caveolin-1 complex in vitro. Evidence that hsp90 facilitates calmodulin stimulated displacement of eNOS from caveolin-1.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Gratton JP, Fontana J, O'Connor DS, Garcia-Cardena G, McCabe TJ, Sessa WC", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "10781589", "url": "https://glygen.org/publication/PubMed/10781589" } ] }, { "title": "Cellular regulation of endothelial nitric oxide synthase.", "journal": "American journal of physiology. Renal physiology", "date": "2001", "authors": "Govers R, Rabelink TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "11208594", "url": "https://glygen.org/publication/PubMed/11208594" } ] }, { "title": "Loss of caveolae, vascular dysfunction, and pulmonary defects in caveolin-1 gene-disrupted mice.", "journal": "Science (New York, N.Y.)", "date": "2001", "authors": "Drab M, Verkade P, Elger M, Kasper M, Lohn M, Lauterbach B, Menne J, Lindschau C, Mende F, Luft FC, Schedl A, Haller H, Kurzchalia TV", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "11498544", "url": "https://glygen.org/publication/PubMed/11498544" } ] }, { "title": "The ratio between tetrahydrobiopterin and oxidized tetrahydrobiopterin analogues controls superoxide release from endothelial nitric oxide synthase: an EPR spin trapping study.", "journal": "The Biochemical journal", "date": "2002", "authors": "Vasquez-Vivar J, Martasek P, Whitsett J, Joseph J, Kalyanaraman B", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "11879202", "url": "https://glygen.org/publication/PubMed/11879202" } ] }, { "title": "A ubiquitously expressed human hexacoordinate hemoglobin.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Trent JT 3rd, Hargrove MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "11893755", "url": "https://glygen.org/publication/PubMed/11893755" } ] }, { "title": "Cytoglobin: a novel globin type ubiquitously expressed in vertebrate tissues.", "journal": "Molecular biology and evolution", "date": "2002", "authors": "Burmester T, Ebner B, Weich B, Hankeln T", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "11919282", "url": "https://glygen.org/publication/PubMed/11919282" } ] }, { "title": "Domain mapping studies reveal that the M domain of hsp90 serves as a molecular scaffold to regulate Akt-dependent phosphorylation of endothelial nitric oxide synthase and NO release.", "journal": "Circulation research", "date": "2002", "authors": "Fontana J, Fulton D, Chen Y, Fairchild TA, McCabe TJ, Fujita N, Tsuruo T, Sessa WC", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "11988487", "url": "https://glygen.org/publication/PubMed/11988487" } ] }, { "title": "Synergistic activation of endothelial nitric-oxide synthase (eNOS) by HSP90 and Akt: calcium-independent eNOS activation involves formation of an HSP90-Akt-CaM-bound eNOS complex.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Takahashi S, Mendelsohn ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "12799359", "url": "https://glygen.org/publication/PubMed/12799359" } ] }, { "title": "The redox state of the cell regulates the ligand binding affinity of human neuroglobin and cytoglobin.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Hamdane D, Kiger L, Dewilde S, Green BN, Pesce A, Uzan J, Burmester T, Hankeln T, Bolognesi M, Moens L, Marden MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "14530264", "url": "https://glygen.org/publication/PubMed/14530264" } ] }, { "title": "Allosteric regulation and temperature dependence of oxygen binding in human neuroglobin and cytoglobin. Molecular mechanisms and physiological significance.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Fago A, Hundahl C, Dewilde S, Gilany K, Moens L, Weber RE", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "15299006", "url": "https://glygen.org/publication/PubMed/15299006" } ] }, { "title": "Nitric oxide dioxygenase function and mechanism of flavohemoglobin, hemoglobin, myoglobin and their associated reductases.", "journal": "Journal of inorganic biochemistry", "date": "2005", "authors": "Gardner PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "15598505", "url": "https://glygen.org/publication/PubMed/15598505" } ] }, { "title": "Subcellular targeting and trafficking of nitric oxide synthases.", "journal": "The Biochemical journal", "date": "2006", "authors": "Oess S, Icking A, Fulton D, Govers R, Muller-Esterl W", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "16722822", "url": "https://glygen.org/publication/PubMed/16722822" } ] }, { "title": "Identification of Golgi-localized acyl transferases that palmitoylate and regulate endothelial nitric oxide synthase.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Fernandez-Hernando C, Fukata M, Bernatchez PN, Fukata Y, Lin MI, Bredt DS, Sessa WC", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "16864653", "url": "https://glygen.org/publication/PubMed/16864653" } ] }, { "title": "Disruption of methylarginine metabolism impairs vascular homeostasis.", "journal": "Nat. Med.", "date": "2007", "authors": "Leiper James, Nandi Manasi, Torondel Belen, Murray-Rust Judith, Malaki Mohammed, O'Hara Bernard, Rossiter Sharon, Anthony Shelagh, Madhani Melanie, Selwood David, Smith Caroline, Wojciak-Stothard Beata, Rudiger Alain, Stidwill Ray, McDonald Neil Q, Vallance Patrick", "evidence": [ { "database": "UniProtKB", "id": "O94760", "url": "https://www.uniprot.org/uniprot/O94760" } ], "reference": [ { "type": "PubMed", "id": "17273169", "url": "https://glygen.org/publication/PubMed/17273169" } ] }, { "title": "Mechanism of 4-HNE mediated inhibition of hDDAH-1: implications in no regulation.", "journal": "Biochemistry", "date": "2008", "authors": "Forbes SP, Druhan LJ, Guzman JE, Parinandi N, Zhang L, Green-Church KB, Cardounel AJ", "evidence": [ { "database": "UniProtKB", "id": "O94760", "url": "https://www.uniprot.org/uniprot/O94760" }, { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "18171027", "url": "https://glygen.org/publication/PubMed/18171027" } ] }, { "title": "NO dioxygenase activity in hemoglobins is ubiquitous in vitro, but limited by reduction in vivo.", "journal": "PloS one", "date": "2008", "authors": "Smagghe BJ, Trent JT 3rd, Hargrove MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "18446211", "url": "https://glygen.org/publication/PubMed/18446211" } ] }, { "title": "Cytoglobin is expressed in the vasculature and regulates cell respiration and proliferation via nitric oxide dioxygenation.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Halligan KE, Jourd'heuil FL, Jourd'heuil D", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "19147491", "url": "https://glygen.org/publication/PubMed/19147491" } ] }, { "title": "Developing dual and specific inhibitors of dimethylarginine dimethylaminohydrolase-1 and nitric oxide synthase: toward a targeted polypharmacology to control nitric oxide.", "journal": "Biochemistry", "date": "2009", "authors": "Wang Y, Monzingo AF, Hu S, Schaller TH, Robertus JD, Fast W", "evidence": [ { "database": "UniProtKB", "id": "O94760", "url": "https://www.uniprot.org/uniprot/O94760" }, { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "19663506", "url": "https://glygen.org/publication/PubMed/19663506" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O94760-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94760-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Dimethylarginine dimethylaminohydrolase-1 is the critical enzyme for degrading the cardiovascular risk factor asymmetrical dimethylarginine.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2011-07", "authors": "Hu Xinli, Atzler Dorothee, Xu Xin, Zhang Ping, Guo Haipeng, Lu Zhongbing, Fassett John, Schwedhelm Edzard, B\u00f6ger Rainer H, Bache Robert J, Chen Yingjie", "evidence": [ { "database": "UniProtKB", "id": "O94760", "url": "https://www.uniprot.org/uniprot/O94760" } ], "reference": [ { "type": "PubMed", "id": "21493890", "url": "https://glygen.org/publication/PubMed/21493890" } ] }, { "title": "Dimethylarginine dimethylaminohydrolase 2, a newly identified mitochondrial protein modulating nitric oxide synthesis in normal human chondrocytes.", "journal": "Arthritis and rheumatism", "date": "2012", "authors": "Cillero-Pastor B, Mateos J, Fernandez-Lopez C, Oreiro N, Ruiz-Romero C, Blanco FJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "21898353", "url": "https://glygen.org/publication/PubMed/21898353" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "O94760", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O94760" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "Genome-wide admixture and association analysis identifies African ancestry-specific risk loci of eosinophilic esophagitis in African Americans.", "journal": "The Journal of allergy and clinical immunology", "date": "2022-11-15", "authors": "Gautam Yadu, Caldwell Julie, Kottyan Leah, Chehade Mirna, Dellon Evan S, Rothenberg Marc E, Mersha Tesfaye B,", "evidence": [ { "database": "RefSeq", "id": "NP_001127917", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127917" } ], "reference": [ { "type": "PubMed", "id": "36400179", "url": "https://glygen.org/publication/PubMed/36400179" } ] }, { "title": "The effect of haptoglobin genotype on the association of asymmetric dimethylarginine and DDAH 1 polymorphism with diabetic macroangiopathy.", "journal": "Cardiovascular diabetology", "date": "2022-12-02", "authors": "Wang Shiyun, Deng Zixuan, Zhang Hong, Zhang Rong, Yan Dandan, Zheng Xiaojiao, Jia Weiping, Hu Cheng", "evidence": [ { "database": "RefSeq", "id": "NP_001127917", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127917" } ], "reference": [ { "type": "PubMed", "id": "36461077", "url": "https://glygen.org/publication/PubMed/36461077" } ] }, { "title": "LncRNA DANCR deficiency promotes high glucose-induced endothelial to mesenchymal transition in cardiac microvascular cells via the FoxO1/DDAH1/ADMA signaling pathway.", "journal": "European journal of pharmacology", "date": "2023-04-26", "authors": "Wu Meiting, Li Ting, Li Ge, Niu Bingxuan, Wu Tian, Yan Li, Wang Shiming, He Shuangyi, Huang Chuyi, Tong Weiqiang, Li Niansheng, Jiang Junlin", "evidence": [ { "database": "RefSeq", "id": "NP_001127917", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127917" } ], "reference": [ { "type": "PubMed", "id": "37116560", "url": "https://glygen.org/publication/PubMed/37116560" } ] }, { "title": "A multicentric consortium study demonstrates that dimethylarginine dimethylaminohydrolase 2 is not a dimethylarginine dimethylaminohydrolase.", "journal": "Nature communications", "date": "2023-06-09", "authors": "Ragavan Vinitha N, Nair Pramod C, Jarzebska Natalia, Angom Ramcharan Singh, Ruta Luana, Bianconi Elisa, Grottelli Silvia, Tararova Natalia D, Ryazanskiy Daniel, Lentz Steven R, Tommasi Sara, Martens-Lobenhoffer Jens, Suzuki-Yamamoto Toshiko, Kimoto Masumi, Rubets Elena, Chau Sarah, Chen Yingjie, Hu Xinli, Bernhardt Nadine, Spieth Peter M, Weiss Norbert, Bornstein Stefan R, Mukhopadhyay Debabrata, Bode-B\u00f6ger Stefanie M, Maas Renke, Wang Ying, Macchiarulo Antonio, Mangoni Arduino A, Cellini Barbara, Rodionov Roman N", "evidence": [ { "database": "UniProtKB", "id": "O94760", "url": "https://www.uniprot.org/uniprot/O94760" }, { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "37296100", "url": "https://glygen.org/publication/PubMed/37296100" } ] }, { "title": "Dimethylarginine Dimethylaminohydrolase - 1 expression is increased under tBHP-induced oxidative stress regulates nitric oxide production in PCa cells attenuates mitochondrial ROS-mediated apoptosis.", "journal": "Nitric oxide : biology and chemistry", "date": "2023-09-01", "authors": "Asha Parveen Sakkarai Mohamed, Kami Reddy Karthik Reddy, Ummanni Ramesh", "evidence": [ { "database": "RefSeq", "id": "NP_001127917", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127917" } ], "reference": [ { "type": "PubMed", "id": "37423418", "url": "https://glygen.org/publication/PubMed/37423418" } ] }, { "title": "Identification of covalently bound amino-terminal myristic acid in endothelial nitric oxide synthase.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Liu J, Sessa WC", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "7512951", "url": "https://glygen.org/publication/PubMed/7512951" } ] }, { "title": "Targeting of nitric oxide synthase to endothelial cell caveolae via palmitoylation: implications for nitric oxide signaling.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Garcia-Cardena G, Oh P, Liu J, Schnitzer JE, Sessa WC", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "8692835", "url": "https://glygen.org/publication/PubMed/8692835" } ] }, { "title": "Endothelial nitric oxide synthase targeting to caveolae. Specific interactions with caveolin isoforms in cardiac myocytes and endothelial cells.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Feron O, Belhassen L, Kobzik L, Smith TW, Kelly RA, Michel T", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "8798458", "url": "https://glygen.org/publication/PubMed/8798458" } ] }, { "title": "Reciprocal regulation of endothelial nitric-oxide synthase by Ca2+-calmodulin and caveolin.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Michel JB, Feron O, Sacks D, Michel T", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "9188442", "url": "https://glygen.org/publication/PubMed/9188442" } ] }, { "title": "Dissecting the interaction between nitric oxide synthase (NOS) and caveolin. Functional significance of the nos caveolin binding domain in vivo.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Garcia-Cardena G, Martasek P, Masters BS, Skidd PM, Couet J, Li S, Lisanti MP, Sessa WC", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "9325253", "url": "https://glygen.org/publication/PubMed/9325253" } ] }, { "title": "Dynamic activation of endothelial nitric oxide synthase by Hsp90.", "journal": "Nature", "date": "1998", "authors": "Garcia-Cardena G, Fan R, Shah V, Sorrentino R, Cirino G, Papapetropoulos A, Sessa WC", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "9580552", "url": "https://glygen.org/publication/PubMed/9580552" } ] }, { "title": "Interaction between caveolin-1 and the reductase domain of endothelial nitric-oxide synthase. Consequences for catalysis.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Ghosh S, Gachhui R, Crooks C, Wu C, Lisanti MP, Stuehr DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "9712842", "url": "https://glygen.org/publication/PubMed/9712842" } ] }, { "title": "Purification, cDNA cloning and expression of human NG,NG-dimethylarginine dimethylaminohydrolase.", "journal": "European journal of biochemistry", "date": "1998", "authors": "Kimoto M, Miyatake S, Sasagawa T, Yamashita H, Okita M, Oka T, Ogawa T, Tsuji H", "evidence": [ { "database": "UniProtKB", "id": "O94760", "url": "https://www.uniprot.org/uniprot/O94760" } ], "reference": [ { "type": "PubMed", "id": "9874257", "url": "https://glygen.org/publication/PubMed/9874257" } ] } ], "pathway": [ { "id": "hsa:23576", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:23576", "resource": "KEGG Pathway" }, { "id": "R-HSA-203615", "name": "eNOS activation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615", "resource": "Reactome", "description": "eNOS activation" } ], "orthologs": [ { "uniprot_canonical_ac": "O08557-1", "protein_name": "N(G),N(G)-dimethylarginine dimethylaminohydrolase 1", "gene_name": "Ddah1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAGLSHPSVFGRATHAVVRAPPESLCRHALRRSQGEEVDFARAERQHQLYVGVLGSKLGLQVVQLPADESLPDCVFVEDVAVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADTFKDYAVSTVPVADSLHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDMAANCIYLNIPSKGHVLLHRTPEEYPESAKVYEKLKDHLLIPVSNSEMEKVDGLLTCCSVFINKKTDS", "length": 285 }, "evidence": [ { "id": "45932090", "url": "http://www.informatics.jax.org/homology/45932090", "database": "MGI" }, { "id": "O94760", "url": "https://omabrowser.org/oma/group/O94760/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9CWS0-1", "protein_name": "N(G),N(G)-dimethylarginine dimethylaminohydrolase 1", "gene_name": "Ddah1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAGLGHPSAFGRATHAVVRAPPESLCRHALRRSQGEEVDFARAERQHELYVGVLGSKLGLQVVQLPADESLPDCVFVEDVAVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADTFKDYAVSTVPVADSLHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDMAANCIYLNIPSKGHVLLHRTPEEYPESAKVYEKLKDHLLIPVSNSEMEKVDGLLTCCSVFINKKIDS", "length": 285 }, "evidence": [ { "id": "45932090", "url": "http://www.informatics.jax.org/homology/45932090", "database": "MGI" }, { "id": "O94760", "url": "https://omabrowser.org/oma/group/O94760/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9VYF0-1", "protein_name": "dimethylargininase", "gene_name": "Dmel\\CG1764", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MSPKYTHAIVARISDALLENGKFDVQLAKQQHEQYCTLLRTIGLDVIELPPDDQLPEGVFVENSAVICNGVALIGRSEHPKRQLEAESMAIILKKELDIPVIEIEDPNAQLDGGDVLFTGREFFVGISSFTNEEGARAVAMAYPEYPVTPIRVNGTKRLKYYVTMAGPEVLCVSSSPTCQEIVKRMEREAICTYQKLTLPEESAANMLYINGTIVHRSPTEIPEAYKTLKEKIDIPTRNINISEFSQYSSGLTSSCLLLRRWKSIRSL", "length": 268 }, "evidence": [ { "id": "O94760", "url": "https://omabrowser.org/oma/group/O94760/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "dimethylargininase activity", "id": "GO:0016403", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016403", "evidence": [ { "database": "UniProtKB", "id": "O94760", "url": "https://www.uniprot.org/uniprot/O94760" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "O94760", "url": "https://www.uniprot.org/uniprot/O94760" } ], "pmid": "" }, { "name": "catalytic activity", "id": "GO:0003824", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003824", "evidence": [ { "database": "UniProtKB", "id": "O94760", "url": "https://www.uniprot.org/uniprot/O94760" } ], "pmid": "" }, { "name": "amino acid binding", "id": "GO:0016597", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016597", "evidence": [ { "database": "UniProtKB", "id": "O94760", "url": "https://www.uniprot.org/uniprot/O94760" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 11, "go_terms": [ { "name": "nitric oxide metabolic process", "id": "GO:0046209", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046209", "evidence": [ { "database": "UniProtKB", "id": "O94760", "url": "https://www.uniprot.org/uniprot/O94760" } ], "pmid": "" }, { "name": "negative regulation of cell population proliferation", "id": "GO:0008285", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008285", "evidence": [ { "database": "UniProtKB", "id": "O94760", "url": "https://www.uniprot.org/uniprot/O94760" } ], "pmid": "" }, { "name": "positive regulation of nitric oxide biosynthetic process", "id": "GO:0045429", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045429", "evidence": [ { "database": "UniProtKB", "id": "O94760", "url": "https://www.uniprot.org/uniprot/O94760" } ], "pmid": "" }, { "name": "negative regulation of vascular permeability", "id": "GO:0043116", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043116", "evidence": [ { "database": "UniProtKB", "id": "O94760", "url": "https://www.uniprot.org/uniprot/O94760" } ], "pmid": "" }, { "name": "positive regulation of angiogenesis", "id": "GO:0045766", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045766", "evidence": [ { "database": "UniProtKB", "id": "O94760", "url": "https://www.uniprot.org/uniprot/O94760" } ], "pmid": "" }, { "name": "nitric oxide mediated signal transduction", "id": "GO:0007263", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007263", "evidence": [ { "database": "UniProtKB", "id": "O94760", "url": "https://www.uniprot.org/uniprot/O94760" } ], "pmid": "" }, { "name": "regulation of systemic arterial blood pressure", "id": "GO:0003073", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003073", "evidence": [ { "database": "UniProtKB", "id": "O94760", "url": "https://www.uniprot.org/uniprot/O94760" } ], "pmid": "" }, { "name": "citrulline metabolic process", "id": "GO:0000052", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000052", "evidence": [ { "database": "UniProtKB", "id": "O94760", "url": "https://www.uniprot.org/uniprot/O94760" } ], "pmid": "" }, { "name": "arginine metabolic process", "id": "GO:0006525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006525", "evidence": [ { "database": "UniProtKB", "id": "O94760", "url": "https://www.uniprot.org/uniprot/O94760" } ], "pmid": "" }, { "name": "arginine catabolic process", "id": "GO:0006527", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006527", "evidence": [ { "database": "UniProtKB", "id": "O94760", "url": "https://www.uniprot.org/uniprot/O94760" } ], "pmid": "" }, { "name": "negative regulation of cellular response to hypoxia", "id": "GO:1900038", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900038", "evidence": [ { "database": "UniProtKB", "id": "O94760", "url": "https://www.uniprot.org/uniprot/O94760" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O94760", "url": "https://www.uniprot.org/uniprot/O94760" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "O94760", "url": "https://www.uniprot.org/uniprot/O94760" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 123, "end_pos": 125, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "17305", "name": "", "equation": "H2O + N(omega),N(omega)-dimethyl-L-arginine = dimethylamine + L-citrulline", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O08557-1", "O94760-1", "O95865-1", "Q9CWS0-1", "Q99LD8-1", "Q9VYF0-1" ], "evidence": [ { "id": "17305", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/17305" } ] }, { "id": "25173", "name": "", "equation": "H2O + N(omega)-methyl-L-arginine = L-citrulline + methylamine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O08557-1", "O94760-1", "O95865-1", "Q9CWS0-1", "Q99LD8-1", "Q9VYF0-1" ], "evidence": [ { "id": "25173", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/25173" } ] }, { "id": "R-HSA-5693373", "name": "DDAH1,2 hydrolyses ADMA to DMA and L-Cit", "equation": "", "summary": "N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 (DDAH1) plays a role in the regulation of nitric oxide generation by catalyzing the hydrolysis an endogenous inhibitor of nitric oxide synthase (NOS), N(omega),N(omega)-dimethyl-L-arginine (ADMA) to dimethylamine (DMA) and L-citrulline (L-Cit) (Forbes et al. 2008, Wang et al. 2009). DDAH2, an isoform of DDAH1 previously thought to catalyze this reaction (Cillero-Pastor et al. 2012) has recently been shown to have no detectable catalytic activity against ADMA under conditions in which DDAH1 is active (Ragavan et al. 2023).", "cellular_location": "cytosol, plasma membrane", "input_participant_list": [ "R-ALL-5693375" ], "output_participant_list": [ "R-ALL-5693410" ], "enzyme_list": [ "O94760-1" ], "evidence": [ { "id": "R-HSA-5693373", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693373" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-5693375", "participant_name": "ADMA [cytosol]", "crossref": [ { "id": "58326", "database": "ChEBI", "url": "" }, { "id": "000001529718", "database": "ZINC", "url": "" }, { "id": "58326", "database": "ChEBI", "url": "" }, { "id": "000001529718", "database": "ZINC", "url": "" }, { "id": "58326", "database": "ChEBI", "url": "" }, { "id": "000001529718", "database": "ZINC", "url": "" }, { "id": "58326", "database": "ChEBI", "url": "" }, { "id": "000001529718", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-5693410", "participant_name": "DMA [cytosol]", "crossref": [ { "id": "5177", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "17170", "database": "ChEBI", "url": "" }, { "id": "C00543", "database": "COMPOUND", "url": "" }, { "id": "HMDB0000087", "database": "HMDB Metabolite", "url": "" }, { "id": "17170", "database": "ChEBI", "url": "" }, { "id": "5177", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C00543", "database": "COMPOUND", "url": "" }, { "id": "HMDB0000087", "database": "HMDB Metabolite", "url": "" }, { "id": "17170", "database": "ChEBI", "url": "" }, { "id": "HMDB0000087", "database": "HMDB Metabolite", "url": "" }, { "id": "5177", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C00543", "database": "COMPOUND", "url": "" }, { "id": "17170", "database": "ChEBI", "url": "" }, { "id": "HMDB0000087", "database": "HMDB Metabolite", "url": "" }, { "id": "5177", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C00543", "database": "COMPOUND", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "O08557", "gene_name": "Ddah1", "activity": [ { "ec_number": "3.5.3.18", "activity": "H2O + N(omega),N(omega)-dimethyl-L-arginine = dimethylamine + L-citrulline.", "evidence": [ { "id": "O08557", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08557" } ] }, { "ec_number": "3.5.3.18", "activity": "", "evidence": [ { "id": "O08557", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08557" } ] } ] }, { "uniprot_ac": "O94760", "gene_name": "DDAH1", "activity": [ { "ec_number": "3.5.3.18", "activity": "H2O + N(omega),N(omega)-dimethyl-L-arginine = dimethylamine + L-citrulline.", "evidence": [ { "id": "O94760", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O94760" } ] }, { "ec_number": "3.5.3.18", "activity": "", "evidence": [ { "id": "O94760", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O94760" } ] } ] }, { "uniprot_ac": "O95865", "gene_name": "DDAH2", "activity": [ { "ec_number": "3.5.3.18", "activity": "H2O + N(omega),N(omega)-dimethyl-L-arginine = dimethylamine + L-citrulline.", "evidence": [ { "id": "O95865", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95865" } ] }, { "ec_number": "3.5.3.18", "activity": "", "evidence": [ { "id": "O95865", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95865" } ] }, { "ec_number": "3.-.-.-", "activity": "", "evidence": [ { "id": "O95865", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95865" } ] } ] }, { "uniprot_ac": "Q99LD8", "gene_name": "Ddah2", "activity": [ { "ec_number": "3.5.3.18", "activity": "H2O + N(omega),N(omega)-dimethyl-L-arginine = dimethylamine + L-citrulline.", "evidence": [ { "id": "Q99LD8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99LD8" } ] }, { "ec_number": "3.5.3.18", "activity": "", "evidence": [ { "id": "Q99LD8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99LD8" } ] }, { "ec_number": "3.-.-.-", "activity": "", "evidence": [ { "id": "Q99LD8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99LD8" } ] } ] }, { "uniprot_ac": "Q9CWS0", "gene_name": "Ddah1", "activity": [ { "ec_number": "3.5.3.18", "activity": "H2O + N(omega),N(omega)-dimethyl-L-arginine = dimethylamine + L-citrulline.", "evidence": [ { "id": "Q9CWS0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CWS0" } ] }, { "ec_number": "3.5.3.18", "activity": "", "evidence": [ { "id": "Q9CWS0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CWS0" } ] } ] }, { "uniprot_ac": "Q9VYF0", "gene_name": "Dmel\\CG1764", "activity": [ { "ec_number": "3.5.3.18", "activity": "H2O + N(omega),N(omega)-dimethyl-L-arginine = dimethylamine + L-citrulline.", "evidence": [ { "id": "Q9VYF0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VYF0" } ] }, { "ec_number": "3.5.3.18", "activity": "", "evidence": [ { "id": "Q9VYF0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VYF0" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 261 ], "sequon_annotation_sites": [ { "start_pos": 123, "end_pos": 125 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 40 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }