{ "uniprot_canonical_ac": "O77229-1", "uniprot_ac": "O77229", "uniprot_id": "CATA_DICDI", "mass": { "chemical_mass": 55680.0, "monoisotopic_mass": 55680.0 }, "refseq": { "ac": "XP_643894", "name": "hypothetical protein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_643894" }, "gene_names": [ { "name": "catA", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O77229", "id": "O77229" }, { "name": "DDB_G0274595", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O77229", "id": "O77229" }, { "name": "catA", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_643894", "id": "XP_643894" }, { "name": "cat", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O77229", "id": "O77229" } ], "protein_names": [ { "name": "Catalase-A", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O77229" }, { "name": "1.11.1.6", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O77229" }, { "name": "hypothetical protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_643894", "id": "XP_643894" } ], "function": [ { "annotation": "Occurs in almost all aerobically respiring organisms and serves to protect cells from the toxic effects of hydrogen peroxide.", "evidence": [ { "database": "UniProtKB", "id": "O77229", "url": "https://www.uniprot.org/uniprot/O77229#function" }, { "database": "PubMed", "id": "11782526", "url": "https://glygen.org/publication/PubMed/11782526" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Dictyostelium discoideum", "taxid": 44689, "evidence": [ { "database": "UniProtKB", "id": "O77229", "url": "https://www.uniprot.org/uniprot/O77229" } ], "common_name": "Cellular slime molds" } ], "gene": [ { "name": "catA", "url": "https://www.uniprot.org/uniprot/O77229", "locus": {} } ], "crossref": [ { "id": "cd08156", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd08156", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "DDB_G0274595", "url": "http://dictybase.org/gene/DDB_G0274595", "database": "dictyBase", "categories": [ "Organism-specific" ] }, { "id": "8619320", "url": "https://www.ncbi.nlm.nih.gov/gene/8619320", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR002226", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002226", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR010582", "url": "https://www.ebi.ac.uk/interpro/entry/IPR010582", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011614", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011614", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018028", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018028", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020835", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020835", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR024708", "url": "https://www.ebi.ac.uk/interpro/entry/IPR024708", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR024711", "url": "https://www.ebi.ac.uk/interpro/entry/IPR024711", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR040333", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040333", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ddi:DDB_G0274595", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0274595", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "NPSWTCY", "url": "https://omabrowser.org/oma/group/NPSWTCY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR11465", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11465", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11465:SF9", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11465:SF9", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00199", "url": "http://pfam.xfam.org/family/PF00199", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF06628", "url": "http://pfam.xfam.org/family/PF06628", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_O77229", "url": "http://purl.obolibrary.org/obo/PR_O77229", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-DDI-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-3299685", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-9033241", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_643894", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_643894", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "20309", "url": "https://www.rhea-db.org/rhea/20309", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "O77229", "url": "https://www.uniprot.org/uniprot/O77229", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O77229-1", "url": "https://www.uniprot.org/uniprot/O77229-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSAPVLTTSSGSPIDNNLNSMTAGVNGPILIQDFTLIDKLAHFDRERIPERVVHAKGAGAHGYFEVPSSDVPKWCKAKFLNKVGKRTPIFTRFSTVGGEKGSSDSERDPRGFAVKFYTEEGNFDMVGNNTPVFFIRDPSKFPDFIHTQKRNPQTNCKDPNMFWDFLGQTPESTHQVSILFSDRGTPKSYRHMHGFSSHTLKFVNAQGKPYWVKLHFTSETGIQNYTAEEAAKMSMNDPDSATRDLFETIAKGGEPAWKVSIQLMEFEDALKYRFNPFDVTKIWSHKDYPLIQIGRMVLNRNPENYFAEVEQAAFSPSHMVPGIEPSPDKMLQGRLFSYPDTHRHRLGVNYQQIPVNCPFAVKGGVKNYQRDGFMAVNGNGGKGPNYQPNSFGGPEPHPEFAQHKFDVSGFAARQPYNHPNDDFVQPGDLYRLMSEDAKSRFVSNLVGHMSGVTIKEIQVRAVSNFYKADKDLGARLCKGLGIDVNDVIKFAARSNL", "length": 496, "header": "sp|O77229-1|CATA_DICDI Isoform 1 of Catalase-A OS=Dictyostelium discoideum OX=44689 GN=catA PE=2 SV=2 CANONICAL=O77229-1" }, "isoforms": [ { "isoform_ac": "O77229-1", "url": "", "sequence": { "sequence": "MSAPVLTTSSGSPIDNNLNSMTAGVNGPILIQDFTLIDKLAHFDRERIPERVVHAKGAGAHGYFEVPSSDVPKWCKAKFLNKVGKRTPIFTRFSTVGGEKGSSDSERDPRGFAVKFYTEEGNFDMVGNNTPVFFIRDPSKFPDFIHTQKRNPQTNCKDPNMFWDFLGQTPESTHQVSILFSDRGTPKSYRHMHGFSSHTLKFVNAQGKPYWVKLHFTSETGIQNYTAEEAAKMSMNDPDSATRDLFETIAKGGEPAWKVSIQLMEFEDALKYRFNPFDVTKIWSHKDYPLIQIGRMVLNRNPENYFAEVEQAAFSPSHMVPGIEPSPDKMLQGRLFSYPDTHRHRLGVNYQQIPVNCPFAVKGGVKNYQRDGFMAVNGNGGKGPNYQPNSFGGPEPHPEFAQHKFDVSGFAARQPYNHPNDDFVQPGDLYRLMSEDAKSRFVSNLVGHMSGVTIKEIQVRAVSNFYKADKDLGARLCKGLGIDVNDVIKFAARSNL", "length": 496, "header": "sp|O77229-1|CATA_DICDI Isoform 1 of Catalase-A OS=Dictyostelium discoideum OX=44689 GN=catA PE=2 SV=2 CANONICAL=O77229-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Differential developmental expression and cell type specificity of Dictyostelium catalases and their response to oxidative stress and UV-light.", "journal": "Biochim. Biophys. Acta", "date": "2000", "authors": "Garcia M X, Foote C, van Es S, Devreotes P N, Alexander S, Alexander H", "evidence": [ { "database": "UniProtKB", "id": "O77229", "url": "https://www.uniprot.org/uniprot/O77229" } ], "reference": [ { "type": "PubMed", "id": "11004503", "url": "https://glygen.org/publication/PubMed/11004503" } ] }, { "title": "Methanol and acriflavine resistance in Dictyostelium are caused by loss of catalase.", "journal": "Microbiology (Reading, England)", "date": "2002-01", "authors": "Garcia Ma Xenia U, Roberts Catherine, Alexander Hannah, Stewart A Michael, Harwood Adrian, Alexander Stephen, Insall Robert H", "evidence": [ { "database": "UniProtKB", "id": "O77229", "url": "https://www.uniprot.org/uniprot/O77229" } ], "reference": [ { "type": "PubMed", "id": "11782526", "url": "https://glygen.org/publication/PubMed/11782526" } ] }, { "title": "Sequence and analysis of chromosome 2 of Dictyostelium discoideum.", "journal": "Nature", "date": "2002", "authors": "Gl\u00f6ckner Gernot, Eichinger Ludwig, Szafranski Karol, Pachebat Justin A, Bankier Alan T, Dear Paul H, Lehmann R\u00fcdiger, Baumgart Cornelia, Parra Gen\u00eds, Abril Josep F, Guig\u00f3 Roderic, Kumpf Kai, Tunggal Budi, Cox Edward, Quail Michael A, Platzer Matthias, Rosenthal Andr\u00e9, Noegel Angelika A,", "evidence": [ { "database": "UniProtKB", "id": "O77229", "url": "https://www.uniprot.org/uniprot/O77229" } ], "reference": [ { "type": "PubMed", "id": "12097910", "url": "https://glygen.org/publication/PubMed/12097910" } ] }, { "title": "The genome of the social amoeba Dictyostelium discoideum.", "journal": "Nature", "date": "2005", "authors": "Eichinger L, Pachebat J A, Gl\u00f6ckner G, Rajandream M-A, Sucgang R, Berriman M, Song J, Olsen R, Szafranski K, Xu Q, Tunggal B, Kummerfeld S, Madera M, Konfortov B A, Rivero F, Bankier A T, Lehmann R, Hamlin N, Davies R, Gaudet P, Fey P, Pilcher K, Chen G, Saunders D, Sodergren E, Davis P, Kerhornou A, Nie X, Hall N, Anjard C, Hemphill L, Bason N, Farbrother P, Desany B, Just E, Morio T, Rost R, Churcher C, Cooper J, Haydock S, van Driessche N, Cronin A, Goodhead I, Muzny D, Mourier T, Pain A, Lu M, Harper D, Lindsay R, Hauser H, James K, Quiles M, Madan Babu M, Saito T, Buchrieser C, Wardroper A, Felder M, Thangavelu M, Johnson D, Knights A, Loulseged H, Mungall K, Oliver K, Price C, Quail M A, Urushihara H, Hernandez J, Rabbinowitsch E, Steffen D, Sanders M, Ma J, Kohara Y, Sharp S, Simmonds M, Spiegler S, Tivey A, Sugano S, White B, Walker D, Woodward J, Winckler T, Tanaka Y, Shaulsky G, Schleicher M, Weinstock G, Rosenthal A, Cox E C, Chisholm R L, Gibbs R, Loomis W F, Platzer M, Kay R R, Williams J, Dear P H, Noegel A A, Barrell B, Kuspa A", "evidence": [ { "database": "UniProtKB", "id": "O77229", "url": "https://www.uniprot.org/uniprot/O77229" } ], "reference": [ { "type": "PubMed", "id": "15875012", "url": "https://glygen.org/publication/PubMed/15875012" } ] } ], "pathway": [ { "id": "ddi:DDB_G0274595", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0274595", "resource": "KEGG Pathway" }, { "id": "R-DDI-3299685", "name": "Detoxification of Reactive Oxygen Species", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-3299685", "resource": "Reactome", "description": "Detoxification of Reactive Oxygen Species" }, { "id": "R-DDI-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" }, { "id": "R-DDI-9033241", "name": "Peroxisomal protein import", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-9033241", "resource": "Reactome", "description": "Peroxisomal protein import" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "response to curcumin", "id": "GO:1904643", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904643", "evidence": [ { "database": "UniProtKB", "id": "O77229", "url": "https://www.uniprot.org/uniprot/O77229" } ], "pmid": "" }, { "name": "response to oxidative stress", "id": "GO:0006979", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006979", "evidence": [ { "database": "UniProtKB", "id": "O77229", "url": "https://www.uniprot.org/uniprot/O77229" } ], "pmid": "" }, { "name": "response to hydrogen peroxide", "id": "GO:0042542", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042542", "evidence": [ { "database": "UniProtKB", "id": "O77229", "url": "https://www.uniprot.org/uniprot/O77229" } ], "pmid": "" }, { "name": "hydrogen peroxide catabolic process", "id": "GO:0042744", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042744", "evidence": [ { "database": "UniProtKB", "id": "O77229", "url": "https://www.uniprot.org/uniprot/O77229" } ], "pmid": "" }, { "name": "response to methanol", "id": "GO:0033986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033986", "evidence": [ { "database": "UniProtKB", "id": "O77229", "url": "https://www.uniprot.org/uniprot/O77229" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O77229", "url": "https://www.uniprot.org/uniprot/O77229" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "O77229", "url": "https://www.uniprot.org/uniprot/O77229" } ], "pmid": "" }, { "name": "peroxisome", "id": "GO:0005777", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005777", "evidence": [ { "database": "UniProtKB", "id": "O77229", "url": "https://www.uniprot.org/uniprot/O77229" } ], "pmid": "" }, { "name": "phagocytic vesicle", "id": "GO:0045335", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045335", "evidence": [ { "database": "UniProtKB", "id": "O77229", "url": "https://www.uniprot.org/uniprot/O77229" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "O77229", "url": "https://www.uniprot.org/uniprot/O77229" } ], "pmid": "" }, { "name": "heme binding", "id": "GO:0020037", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0020037", "evidence": [ { "database": "UniProtKB", "id": "O77229", "url": "https://www.uniprot.org/uniprot/O77229" } ], "pmid": "" }, { "name": "catalase activity", "id": "GO:0004096", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004096", "evidence": [ { "database": "UniProtKB", "id": "O77229", "url": "https://www.uniprot.org/uniprot/O77229" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 128, "end_pos": 130, "annotation": "n_glycosylation_sequon" }, { "start_pos": 224, "end_pos": 226, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "20309", "name": "", "equation": "2 H2O2 = 2 H2O + O2", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P04762-1", "P04040-1", "P24270-1", "P15202-1", "P06115-1", "O77229-1", "Q55DH8-1", "P17336-1" ], "evidence": [ { "id": "20309", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/20309" } ] }, { "id": "R-DDI-6798748", "name": "Exocytosis of secretory granule lumen proteins", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "extracellular region, secretory granule lumen", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q54DN5-1", "Q54QV7-1", "C7G034-1", "Q54I82-1", "Q54QS3-1", "Q54RF5-1", "Q54UQ2-1", "Q54V35-1", "Q54V83-1", "Q54VI4-1", "Q55E06-1", "Q55FF3-1", "Q5V9E9-1", "Q86A67-1", "Q86IJ1-1", "Q86AU1-1", "O77229-1", "P0CT31-1", "P15112-1", "P22887-1", "P34093-1", "Q00766-1", "Q54DD0-1", "Q54DK3-1", "Q54LY5-1", "Q54MA9-1", "Q54NE6-1", "Q54QQ0-1", "Q54QR2-1", "Q555L5-1", "Q556G3-1", "Q55EK9-1", "Q6TMK4-1", "Q75JR2-1" ], "evidence": [ { "id": "R-DDI-6798748", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-6798748" } ] }, { "id": "R-DDI-6800434", "name": "Exocytosis of ficolin-rich granule lumen proteins", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "extracellular region, ficolin-1-rich granule lumen", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q54DN5-1", "Q54QV7-1", "Q54R55-1", "C7G034-1", "Q54GE1-1", "Q54I82-1", "Q54QD9-1", "Q54QS3-1", "Q54RF5-1", "Q54UQ2-1", "Q54V35-1", "Q54V83-1", "Q54VI4-1", "Q54Y06-1", "Q54YA0-1", "Q55E06-1", "Q55FF3-1", "Q5V9E9-1", "Q86A67-1", "Q86IJ1-1", "Q94503-1", "Q55GA9-1", "Q86AU1-1", "O76856-1", "O77229-1", "P04989-1", "P0CT31-1", "P15112-1", "P22887-1", "P34093-1", "P42525-1", "P52922-1", "P54639-1", "P54640-1", "Q00766-1", "Q23894-1", "Q23919-1", "Q54B14-1", "Q54DD0-1", "Q54DK3-1", "Q54MA9-1", "Q54NE6-1", "Q54QQ0-1", "Q54QR2-1", "Q555L5-1", "Q556G3-1", "Q75JR2-1", "Q8MUF9-1", "Q94504-1" ], "evidence": [ { "id": "R-DDI-6800434", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-6800434" } ] }, { "id": "R-DDI-76031", "name": "2 H2O2 => O2 + 2 H2O", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "peroxisomal matrix", "input_participant_list": [], "output_participant_list": [ "R-ALL-141343" ], "enzyme_list": [ "O77229-1" ], "evidence": [ { "id": "R-DDI-76031", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-76031" } ] }, { "id": "R-DDI-9033235", "name": "Cargo of PEX5S,L translocates from the cytosol to the peroxisomal matrix", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "peroxisomal membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q54QI7-1", "Q54E41-1", "Q54GT6-1", "Q54JQ2-1", "Q54SS0-1", "Q54XZ0-1", "Q556W1-1", "O77229-1", "Q54DA9-1", "Q54GQ6-1", "Q54S31-1", "Q55CT1-1", "Q75JR2-1" ], "evidence": [ { "id": "R-DDI-9033235", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-9033235" } ] }, { "id": "R-DDI-9033236", "name": "PEX5S,L:Cargo binds PEX13:PEX14:PEX2:PEX10:PEX12 (Docking and Translocation Module)", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "peroxisomal membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q54QI7-1", "Q54E41-1", "Q54GT6-1", "Q54JQ2-1", "Q54SS0-1", "Q54XZ0-1", "Q556W1-1", "O77229-1", "Q54DA9-1", "Q54GQ6-1", "Q54S31-1", "Q55CT1-1", "Q75JR2-1" ], "evidence": [ { "id": "R-DDI-9033236", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-9033236" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-141343", "participant_name": "H2O [peroxisomal matrix]", "crossref": [ { "id": "C00001", "database": "COMPOUND", "url": "" }, { "id": "HMDB0002111", "database": "HMDB Metabolite", "url": "" }, { "id": "15377", "database": "ChEBI", "url": "" }, { "id": "8145132", "database": "PubChem Substance", "url": "" }, { "id": "15377", "database": "ChEBI", "url": "" }, { "id": "C00001", "database": "COMPOUND", "url": "" }, { "id": "8145132", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0002111", "database": "HMDB Metabolite", "url": "" }, { "id": "15377", "database": "ChEBI", "url": "" }, { "id": "C00001", "database": "COMPOUND", "url": "" }, { "id": "8145132", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0002111", "database": "HMDB Metabolite", "url": "" }, { "id": "15377", "database": "ChEBI", "url": "" }, { "id": "C00001", "database": "COMPOUND", "url": "" }, { "id": "8145132", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0002111", "database": "HMDB Metabolite", "url": "" }, { "id": "C00001", "database": "COMPOUND", "url": "" }, { "id": "HMDB0002111", "database": "HMDB Metabolite", "url": "" }, { "id": "15377", "database": "ChEBI", "url": "" }, { "id": "8145132", "database": "PubChem Substance", "url": "" }, { "id": "15377", "database": "ChEBI", "url": "" }, { "id": "C00001", "database": "COMPOUND", "url": "" }, { "id": "8145132", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0002111", "database": "HMDB Metabolite", "url": "" }, { "id": "15377", "database": "ChEBI", "url": "" }, { "id": "C00001", "database": "COMPOUND", "url": "" }, { "id": "8145132", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0002111", "database": "HMDB Metabolite", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "C7G034", "gene_name": "", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "C7G034", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C7G034" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "C7G034", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C7G034" } ] } ] }, { "uniprot_ac": "O76856", "gene_name": "ctsD", "activity": [ { "ec_number": "3.4.23.5", "activity": "Specificity similar to, but narrower than, that of pepsin A. Does not cleave the 4-Gln-|-His-5 bond in B chain of insulin.", "evidence": [ { "id": "O76856", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O76856" } ] }, { "ec_number": "3.4.23.5", "activity": "", "evidence": [ { "id": "O76856", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O76856" } ] } ] }, { "uniprot_ac": "O77229", "gene_name": "catA", "activity": [ { "ec_number": "1.11.1.6", "activity": "2 H2O2 = 2 H2O + O2.", "evidence": [ { "id": "O77229", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O77229" } ] }, { "ec_number": "1.11.1.6", "activity": "", "evidence": [ { "id": "O77229", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O77229" } ] } ] }, { "uniprot_ac": "P04040", "gene_name": "CAT", "activity": [ { "ec_number": "1.11.1.6", "activity": "2 H2O2 = 2 H2O + O2.", "evidence": [ { "id": "P04040", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04040" } ] }, { "ec_number": "1.11.1.6", "activity": "", "evidence": [ { "id": "P04040", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04040" } ] } ] }, { "uniprot_ac": "P04762", "gene_name": "Cat", "activity": [ { "ec_number": "1.11.1.6", "activity": "2 H2O2 = 2 H2O + O2.", "evidence": [ { "id": "P04762", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04762" } ] }, { "ec_number": "1.11.1.6", "activity": "", "evidence": [ { "id": "P04762", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04762" } ] } ] }, { "uniprot_ac": "P04989", "gene_name": "cprB", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "P04989", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04989" } ] } ] }, { "uniprot_ac": "P06115", "gene_name": "CTT1", "activity": [ { "ec_number": "1.11.1.6", "activity": "2 H2O2 = 2 H2O + O2.", "evidence": [ { "id": "P06115", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06115" } ] }, { "ec_number": "1.11.1.6", "activity": "", "evidence": [ { "id": "P06115", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06115" } ] } ] }, { "uniprot_ac": "P0CT31", "gene_name": "eef1a1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P0CT31", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CT31" } ] } ] }, { "uniprot_ac": "P15112", "gene_name": "efbA", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P15112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15112" } ] } ] }, { "uniprot_ac": "P15202", "gene_name": "CTA1", "activity": [ { "ec_number": "1.11.1.6", "activity": "2 H2O2 = 2 H2O + O2.", "evidence": [ { "id": "P15202", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15202" } ] }, { "ec_number": "1.11.1.6", "activity": "", "evidence": [ { "id": "P15202", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15202" } ] } ] }, { "uniprot_ac": "P17336", "gene_name": "Cat", "activity": [ { "ec_number": "1.11.1.6", "activity": "2 H2O2 = 2 H2O + O2.", "evidence": [ { "id": "P17336", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17336" } ] }, { "ec_number": "1.11.1.6", "activity": "", "evidence": [ { "id": "P17336", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17336" } ] } ] }, { "uniprot_ac": "P22887", "gene_name": "ndkC-1", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P22887", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22887" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P22887", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22887" } ] } ] }, { "uniprot_ac": "P24270", "gene_name": "Cat", "activity": [ { "ec_number": "1.11.1.6", "activity": "2 H2O2 = 2 H2O + O2.", "evidence": [ { "id": "P24270", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24270" } ] }, { "ec_number": "1.11.1.6", "activity": "", "evidence": [ { "id": "P24270", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24270" } ] } ] }, { "uniprot_ac": "P34093", "gene_name": "ndkM", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P34093", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34093" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P34093", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34093" } ] } ] }, { "uniprot_ac": "P42525", "gene_name": "erkA", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P42525", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42525" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P42525", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42525" } ] } ] }, { "uniprot_ac": "P52922", "gene_name": "lkhA", "activity": [ { "ec_number": "3.4.11.-", "activity": "", "evidence": [ { "id": "P52922", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52922" } ] }, { "ec_number": "3.3.2.10", "activity": "an epoxide + H2O = an ethanediol.", "evidence": [ { "id": "P52922", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52922" } ] } ] }, { "uniprot_ac": "P54639", "gene_name": "cprD", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "P54639", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54639" } ] } ] }, { "uniprot_ac": "P54640", "gene_name": "cprE", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "P54640", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54640" } ] } ] }, { "uniprot_ac": "Q00766", "gene_name": "glpV", "activity": [ { "ec_number": "2.4.1.1", "activity": "[(1->4)-alpha-D-glucosyl](n) + phosphate = [(1->4)-alpha-D-glucosyl](n-1) + alpha-D-glucose 1-phosphate.", "evidence": [ { "id": "Q00766", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00766" } ] }, { "ec_number": "2.4.1.1", "activity": "", "evidence": [ { "id": "Q00766", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00766" } ] } ] }, { "uniprot_ac": "Q23894", "gene_name": "cprC", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "Q23894", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q23894" } ] } ] }, { "uniprot_ac": "Q23919", "gene_name": "pgmA", "activity": [ { "ec_number": "5.4.2.2", "activity": "alpha-D-glucose 1-phosphate = alpha-D-glucose 6-phosphate.", "evidence": [ { "id": "Q23919", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q23919" } ] }, { "ec_number": "5.4.2.2", "activity": "", "evidence": [ { "id": "Q23919", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q23919" } ] } ] }, { "uniprot_ac": "Q54B14", "gene_name": "qpct", "activity": [ { "ec_number": "2.3.2.5", "activity": "N-terminal L-glutaminyl-[peptide] = N-terminal 5-oxo-L-prolyl-[peptide] + NH4(+).", "evidence": [ { "id": "Q54B14", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54B14" } ] }, { "ec_number": "2.3.2.5", "activity": "", "evidence": [ { "id": "Q54B14", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54B14" } ] } ] }, { "uniprot_ac": "Q54DA9", "gene_name": "hacl1", "activity": [ { "ec_number": "4.1.2.63", "activity": "2-hydroxy-3-methylhexadecanoyl-CoA = 2-methylpentadecanal + formyl-CoA.", "evidence": [ { "id": "Q54DA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54DA9" } ] }, { "ec_number": "4.1.2.63", "activity": "", "evidence": [ { "id": "Q54DA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54DA9" } ] } ] }, { "uniprot_ac": "Q54DD0", "gene_name": "amdA", "activity": [ { "ec_number": "3.5.4.6", "activity": "AMP + H(+) + H2O = IMP + NH4(+).", "evidence": [ { "id": "Q54DD0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54DD0" } ] }, { "ec_number": "3.5.4.6", "activity": "", "evidence": [ { "id": "Q54DD0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54DD0" } ] } ] }, { "uniprot_ac": "Q54DK3", "gene_name": "cdc7", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54DK3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54DK3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54DK3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54DK3" } ] } ] }, { "uniprot_ac": "Q54DN5", "gene_name": "", "activity": [ { "ec_number": "3.5.1.2", "activity": "H2O + L-glutamine = L-glutamate + NH4(+).", "evidence": [ { "id": "Q54DN5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54DN5" } ] }, { "ec_number": "3.5.1.2", "activity": "", "evidence": [ { "id": "Q54DN5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54DN5" } ] } ] }, { "uniprot_ac": "Q54E41", "gene_name": "haox", "activity": [ { "ec_number": "1.1.3.15", "activity": "glycolate + O2 = glyoxylate + H2O2.", "evidence": [ { "id": "Q54E41", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54E41" } ] }, { "ec_number": "1.1.3.15", "activity": "", "evidence": [ { "id": "Q54E41", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54E41" } ] } ] }, { "uniprot_ac": "Q54GE1", "gene_name": "glb1", "activity": [ { "ec_number": "3.2.1.23", "activity": "Hydrolysis of terminal non-reducing beta-D-galactose residues in beta-D-galactosides.", "evidence": [ { "id": "Q54GE1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54GE1" } ] }, { "ec_number": "3.2.1.23", "activity": "", "evidence": [ { "id": "Q54GE1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54GE1" } ] } ] }, { "uniprot_ac": "Q54GQ6", "gene_name": "acox1", "activity": [ { "ec_number": "1.3.3.6", "activity": "a 2,3-saturated acyl-CoA + O2 = a (2E)-enoyl-CoA + H2O2.", "evidence": [ { "id": "Q54GQ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54GQ6" } ] }, { "ec_number": "1.3.3.6", "activity": "", "evidence": [ { "id": "Q54GQ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54GQ6" } ] } ] }, { "uniprot_ac": "Q54GT6", "gene_name": "agxt", "activity": [ { "ec_number": "2.6.1.51", "activity": "L-serine + pyruvate = 3-hydroxypyruvate + L-alanine.", "evidence": [ { "id": "Q54GT6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54GT6" } ] }, { "ec_number": "2.6.1.44", "activity": "2-oxobutanoate + L-alanine = (2S)-2-aminobutanoate + pyruvate.", "evidence": [ { "id": "Q54GT6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54GT6" } ] }, { "ec_number": "2.6.1.51", "activity": "", "evidence": [ { "id": "Q54GT6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54GT6" } ] } ] }, { "uniprot_ac": "Q54I82", "gene_name": "cda", "activity": [ { "ec_number": "3.5.4.5", "activity": "2'-deoxycytidine + H(+) + H2O = 2'-deoxyuridine + NH4(+).", "evidence": [ { "id": "Q54I82", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54I82" } ] }, { "ec_number": "3.5.4.5", "activity": "", "evidence": [ { "id": "Q54I82", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54I82" } ] } ] }, { "uniprot_ac": "Q54JQ2", "gene_name": "", "activity": [ { "ec_number": "3.4.24.-", "activity": "", "evidence": [ { "id": "Q54JQ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54JQ2" } ] } ] }, { "uniprot_ac": "Q54LY5", "gene_name": "ku80", "activity": [ { "ec_number": "3.6.4.-", "activity": "", "evidence": [ { "id": "Q54LY5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54LY5" } ] } ] }, { "uniprot_ac": "Q54MA9", "gene_name": "ku70", "activity": [ { "ec_number": "3.6.4.12", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "Q54MA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54MA9" } ] }, { "ec_number": "3.6.4.12", "activity": "", "evidence": [ { "id": "Q54MA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54MA9" } ] } ] }, { "uniprot_ac": "Q54NE6", "gene_name": "gpmA", "activity": [ { "ec_number": "5.4.2.11", "activity": "(2R)-2-phosphoglycerate = (2R)-3-phosphoglycerate.", "evidence": [ { "id": "Q54NE6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54NE6" } ] }, { "ec_number": "5.4.2.4", "activity": "(2R)-3-phospho-glyceroyl phosphate = (2R)-2,3-bisphosphoglycerate + H(+).", "evidence": [ { "id": "Q54NE6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54NE6" } ] }, { "ec_number": "5.4.2.11", "activity": "", "evidence": [ { "id": "Q54NE6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54NE6" } ] }, { "ec_number": "5.4.2.4", "activity": "", "evidence": [ { "id": "Q54NE6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54NE6" } ] } ] }, { "uniprot_ac": "Q54QD9", "gene_name": "ctsB", "activity": [ { "ec_number": "3.4.22.1", "activity": "Hydrolysis of proteins with broad specificity for peptide bonds. Preferentially cleaves -Arg-Arg-|-Xaa bonds in small molecule substrates (thus differing from cathepsin L). In addition to being an endopeptidase, shows peptidyl-dipeptidase activity, liberating C-terminal dipeptides.", "evidence": [ { "id": "Q54QD9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QD9" } ] }, { "ec_number": "3.4.22.1", "activity": "", "evidence": [ { "id": "Q54QD9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QD9" } ] } ] }, { "uniprot_ac": "Q54QI7", "gene_name": "hmgL", "activity": [ { "ec_number": "4.1.3.4", "activity": "(3S)-hydroxy-3-methylglutaryl-CoA = acetoacetate + acetyl-CoA.", "evidence": [ { "id": "Q54QI7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QI7" } ] }, { "ec_number": "4.1.3.4", "activity": "", "evidence": [ { "id": "Q54QI7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QI7" } ] } ] }, { "uniprot_ac": "Q54QQ0", "gene_name": "impdh", "activity": [ { "ec_number": "1.1.1.205", "activity": "H2O + IMP + NAD(+) = H(+) + NADH + XMP.", "evidence": [ { "id": "Q54QQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QQ0" } ] }, { "ec_number": "1.1.1.205", "activity": "", "evidence": [ { "id": "Q54QQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QQ0" } ] } ] }, { "uniprot_ac": "Q54QR2", "gene_name": "psmB7", "activity": [ { "ec_number": "3.4.25.1", "activity": "Cleavage of peptide bonds with very broad specificity.", "evidence": [ { "id": "Q54QR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QR2" } ] }, { "ec_number": "3.4.25.1", "activity": "", "evidence": [ { "id": "Q54QR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QR2" } ] } ] }, { "uniprot_ac": "Q54QS3", "gene_name": "ddx3", "activity": [ { "ec_number": "3.6.4.13", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "Q54QS3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QS3" } ] }, { "ec_number": "3.6.4.13", "activity": "", "evidence": [ { "id": "Q54QS3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QS3" } ] } ] }, { "uniprot_ac": "Q54QV7", "gene_name": "gsta5", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q54QV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QV7" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q54QV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QV7" } ] } ] }, { "uniprot_ac": "Q54R55", "gene_name": "ctsZ", "activity": [ { "ec_number": "3.4.18.1", "activity": "Release of C-terminal amino acid residues with broad specificity, but lacks action on C-terminal proline. Shows weak endopeptidase activity.", "evidence": [ { "id": "Q54R55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54R55" } ] }, { "ec_number": "3.4.18.1", "activity": "", "evidence": [ { "id": "Q54R55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54R55" } ] } ] }, { "uniprot_ac": "Q54RF5", "gene_name": "pyk", "activity": [ { "ec_number": "2.7.1.40", "activity": "CTP + pyruvate = CDP + H(+) + phosphoenolpyruvate.", "evidence": [ { "id": "Q54RF5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54RF5" } ] }, { "ec_number": "2.7.1.40", "activity": "", "evidence": [ { "id": "Q54RF5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54RF5" } ] } ] }, { "uniprot_ac": "Q54S31", "gene_name": "pex10", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q54S31", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54S31" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q54S31", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54S31" } ] } ] }, { "uniprot_ac": "Q54SS0", "gene_name": "ech1", "activity": [ { "ec_number": "5.3.3.-", "activity": "", "evidence": [ { "id": "Q54SS0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54SS0" } ] } ] }, { "uniprot_ac": "Q54UQ2", "gene_name": "pgmB", "activity": [ { "ec_number": "5.4.2.2", "activity": "alpha-D-glucose 1-phosphate = alpha-D-glucose 6-phosphate.", "evidence": [ { "id": "Q54UQ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54UQ2" } ] }, { "ec_number": "5.4.2.2", "activity": "", "evidence": [ { "id": "Q54UQ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54UQ2" } ] } ] }, { "uniprot_ac": "Q54V35", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54V35", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54V35" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54V35", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54V35" } ] } ] }, { "uniprot_ac": "Q54V83", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54V83", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54V83" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54V83", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54V83" } ] } ] }, { "uniprot_ac": "Q54VI4", "gene_name": "gsta3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q54VI4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54VI4" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q54VI4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54VI4" } ] } ] }, { "uniprot_ac": "Q54XZ0", "gene_name": "mfeB", "activity": [ { "ec_number": "4.2.1.119", "activity": "a (3R)-3-hydroxyacyl-CoA = a (2E)-enoyl-CoA + H2O.", "evidence": [ { "id": "Q54XZ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54XZ0" } ] }, { "ec_number": "4.2.1.119", "activity": "", "evidence": [ { "id": "Q54XZ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54XZ0" } ] } ] }, { "uniprot_ac": "Q54Y06", "gene_name": "", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54Y06", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54Y06" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q54Y06", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54Y06" } ] } ] }, { "uniprot_ac": "Q54YA0", "gene_name": "acly", "activity": [ { "ec_number": "2.3.3.8", "activity": "acetyl-CoA + ADP + oxaloacetate + phosphate = ATP + citrate + CoA.", "evidence": [ { "id": "Q54YA0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54YA0" } ] }, { "ec_number": "2.3.3.8", "activity": "", "evidence": [ { "id": "Q54YA0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54YA0" } ] } ] }, { "uniprot_ac": "Q555L5", "gene_name": "prdx4", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "Q555L5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q555L5" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "Q555L5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q555L5" } ] } ] }, { "uniprot_ac": "Q556G3", "gene_name": "gsta2-2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q556G3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q556G3" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q556G3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q556G3" } ] } ] }, { "uniprot_ac": "Q556W1", "gene_name": "ddo-2", "activity": [ { "ec_number": "1.4.3.1", "activity": "D-aspartate + H2O + O2 = H2O2 + NH4(+) + oxaloacetate.", "evidence": [ { "id": "Q556W1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q556W1" } ] }, { "ec_number": "1.4.3.1", "activity": "", "evidence": [ { "id": "Q556W1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q556W1" } ] } ] }, { "uniprot_ac": "Q55CT1", "gene_name": "redB", "activity": [ { "ec_number": "1.6.2.4", "activity": "2 Fe(III)-[cytochrome c] + NADPH = 2 Fe(II)-[cytochrome c] + H(+) + NADP(+).", "evidence": [ { "id": "Q55CT1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CT1" } ] }, { "ec_number": "1.6.2.4", "activity": "", "evidence": [ { "id": "Q55CT1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CT1" } ] } ] }, { "uniprot_ac": "Q55DH8", "gene_name": "catB", "activity": [ { "ec_number": "1.11.1.6", "activity": "2 H2O2 = 2 H2O + O2.", "evidence": [ { "id": "Q55DH8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55DH8" } ] }, { "ec_number": "1.11.1.6", "activity": "", "evidence": [ { "id": "Q55DH8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55DH8" } ] } ] }, { "uniprot_ac": "Q55E06", "gene_name": "alad", "activity": [ { "ec_number": "4.2.1.24", "activity": "2 5-aminolevulinate = H(+) + 2 H2O + porphobilinogen.", "evidence": [ { "id": "Q55E06", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55E06" } ] }, { "ec_number": "4.2.1.24", "activity": "", "evidence": [ { "id": "Q55E06", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55E06" } ] } ] }, { "uniprot_ac": "Q55EK9", "gene_name": "pykA", "activity": [ { "ec_number": "2.7.1.35", "activity": "ATP + pyridoxal = ADP + H(+) + pyridoxal 5'-phosphate.", "evidence": [ { "id": "Q55EK9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55EK9" } ] }, { "ec_number": "2.7.1.35", "activity": "", "evidence": [ { "id": "Q55EK9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55EK9" } ] } ] }, { "uniprot_ac": "Q55FF3", "gene_name": "gsta1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q55FF3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55FF3" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q55FF3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55FF3" } ] } ] }, { "uniprot_ac": "Q55GA9", "gene_name": "", "activity": [ { "ec_number": "3.4.19.1", "activity": "Internal cleavage of oxidized and glycated proteins.", "evidence": [ { "id": "Q55GA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55GA9" } ] }, { "ec_number": "3.4.19.1", "activity": "", "evidence": [ { "id": "Q55GA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55GA9" } ] } ] }, { "uniprot_ac": "Q5V9E9", "gene_name": "gpi", "activity": [ { "ec_number": "5.3.1.9", "activity": "alpha-D-glucose 6-phosphate = beta-D-fructose 6-phosphate.", "evidence": [ { "id": "Q5V9E9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5V9E9" } ] }, { "ec_number": "5.3.1.9", "activity": "", "evidence": [ { "id": "Q5V9E9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5V9E9" } ] } ] }, { "uniprot_ac": "Q6TMK4", "gene_name": "poxA", "activity": [ { "ec_number": "1.11.1.7", "activity": "2 a phenolic donor + H2O2 = 2 a phenolic radical donor + 2 H2O.", "evidence": [ { "id": "Q6TMK4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6TMK4" } ] }, { "ec_number": "1.11.1.7", "activity": "", "evidence": [ { "id": "Q6TMK4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6TMK4" } ] } ] }, { "uniprot_ac": "Q75JR2", "gene_name": "idhM", "activity": [ { "ec_number": "1.1.1.42", "activity": "D-threo-isocitrate + NADP(+) = 2-oxoglutarate + CO2 + NADPH.", "evidence": [ { "id": "Q75JR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q75JR2" } ] }, { "ec_number": "1.1.1.42", "activity": "", "evidence": [ { "id": "Q75JR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q75JR2" } ] } ] }, { "uniprot_ac": "Q86A67", "gene_name": "fba", "activity": [ { "ec_number": "4.1.2.13", "activity": "beta-D-fructose 1,6-bisphosphate = D-glyceraldehyde 3-phosphate + dihydroxyacetone phosphate.", "evidence": [ { "id": "Q86A67", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86A67" } ] }, { "ec_number": "4.1.2.13", "activity": "", "evidence": [ { "id": "Q86A67", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86A67" } ] } ] }, { "uniprot_ac": "Q86AU1", "gene_name": "gsta4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q86AU1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86AU1" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q86AU1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86AU1" } ] } ] }, { "uniprot_ac": "Q86IJ1", "gene_name": "psmD14", "activity": [ { "ec_number": "3.4.19.-", "activity": "", "evidence": [ { "id": "Q86IJ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86IJ1" } ] } ] }, { "uniprot_ac": "Q8MUF9", "gene_name": "cplA", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "Q8MUF9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8MUF9" } ] } ] }, { "uniprot_ac": "Q94503", "gene_name": "cprF", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "Q94503", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q94503" } ] } ] }, { "uniprot_ac": "Q94504", "gene_name": "cprG", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "Q94504", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q94504" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 128, "end_pos": 130 }, { "start_pos": 224, "end_pos": 226 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }