{ "uniprot_canonical_ac": "O76087-1", "uniprot_ac": "O76087", "uniprot_id": "GAGE7_HUMAN", "mass": { "chemical_mass": 12978.0, "monoisotopic_mass": 12978.0 }, "refseq": { "ac": "NP_001091875", "name": "G antigen 12F", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091875" }, "gene_names": [ { "name": "GAGE7", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O76087", "id": "O76087" }, { "name": "GAGE12I", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O76087", "id": "O76087" }, { "name": "GAGE7B", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O76087", "id": "O76087" } ], "protein_names": [ { "name": "G antigen 7", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O76087" }, { "name": "AL4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O76087" }, { "name": "CT4.7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O76087" }, { "name": "Cancer/testis antigen 4.7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O76087" }, { "name": "G antigen 12F", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091875", "id": "NP_001091875" }, { "name": "GAGE-12I", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O76087" }, { "name": "GAGE-7B", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O76087" }, { "name": "GAGE-7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O76087" }, { "name": "GAGE-8", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O76087" }, { "name": "g antigen 12F/G/I; GAGE-12F; G antigen 7; G antigen 12G; G antigen 12I; Cancer/testis antigen 4.7", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091875", "id": "NP_001091875" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O76087", "url": "https://www.uniprot.org/uniprot/O76087" } ], "common_name": "Human" } ], "gene": [ { "name": "GAGE7", "url": "https://www.uniprot.org/uniprot/O76087", "locus": {} } ], "crossref": [ { "id": "GAGE7", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=GAGE7", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "100008586", "url": "https://www.ncbi.nlm.nih.gov/gene/100008586", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "2579", "url": "https://www.ncbi.nlm.nih.gov/gene/2579", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "26748", "url": "https://www.ncbi.nlm.nih.gov/gene/26748", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "645073", "url": "https://www.ncbi.nlm.nih.gov/gene/645073", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "729428", "url": "https://www.ncbi.nlm.nih.gov/gene/729428", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "4104", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=4104", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "IPR008625", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008625", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR031320", "url": "https://www.ebi.ac.uk/interpro/entry/IPR031320", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:100008586", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:100008586", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "hsa:2579", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2579", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "hsa:26748", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:26748", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "hsa:645073", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:645073", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "hsa:729428", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:729428", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "300601", "url": "http://www.omim.org/entry/300601", "database": "MIM", "categories": [ "Other" ] }, { "id": "300637", "url": "http://www.omim.org/entry/300637", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O76087", "url": "https://www.nextprot.org/entry/NX_O76087", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "4660048at2759", "url": "http://www.orthodb.org/?query=4660048at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR14047", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14047", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR14047:SF30", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14047:SF30", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF05831", "url": "http://pfam.xfam.org/family/PF05831", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O76087", "url": "https://pharos.nih.gov/targets/O76087", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O76087", "url": "http://purl.obolibrary.org/obo/PR_O76087", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001091875", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091875", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "O76087", "url": "https://www.uniprot.org/uniprot/O76087", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O76087-1", "url": "https://www.uniprot.org/uniprot/O76087-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC", "length": 117, "header": "sp|O76087-1|GAGE7_HUMAN Isoform 1 of G antigen 7 OS=Homo sapiens OX=9606 GN=GAGE7 PE=2 SV=1 CANONICAL=O76087-1" }, "isoforms": [ { "isoform_ac": "O76087-1", "url": "", "sequence": { "sequence": "MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC", "length": 117, "header": "sp|O76087-1|GAGE7_HUMAN Isoform 1 of G antigen 7 OS=Homo sapiens OX=9606 GN=GAGE7 PE=2 SV=1 CANONICAL=O76087-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 10, "end_pos": 10, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O76087", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O76087" }, { "database": "PubMed", "id": "18707149", "url": "https://glygen.org/publication/PubMed/18707149" } ], "site_lbl": "Tyr10" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Characterization of the GAGE genes that are expressed in various human cancers and in normal testis.", "journal": "Cancer Res.", "date": "1999", "authors": "De Backer O, Arden KC, Boretti M, Vantomme V, De Smet C, Czekay S, Viars CS, De Plaen E, Brasseur F, Chomez P, Van den Eynde B, Boon T, van der Bruggen P", "evidence": [ { "database": "UniProtKB", "id": "O76087", "url": "https://www.uniprot.org/uniprot/O76087" } ], "reference": [ { "type": "PubMed", "id": "10397259", "url": "https://glygen.org/publication/PubMed/10397259" } ] }, { "title": "An overview of the GAGE cancer/testis antigen family with the inclusion of newly identified members.", "journal": "Tissue Antigens", "date": "2008", "authors": "Gjerstorff M F, Ditzel H J", "evidence": [ { "database": "UniProtKB", "id": "O76087", "url": "https://www.uniprot.org/uniprot/O76087" } ], "reference": [ { "type": "PubMed", "id": "18179644", "url": "https://glygen.org/publication/PubMed/18179644" } ] }, { "title": "Immobilized metal affinity chromatography revisited: pH/acid control toward high selectivity in phosphoproteomics.", "journal": "Journal of proteome research", "date": "2008", "authors": "Tsai CF, Wang YT, Chen YR, Lai CY, Lin PY, Pan KT, Chen JY, Khoo KH, Chen YJ", "evidence": [ { "database": "iPTMnet", "id": "O76087", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O76087" } ], "reference": [ { "type": "PubMed", "id": "18707149", "url": "https://glygen.org/publication/PubMed/18707149" } ] }, { "title": "Isolation and characterization of PAGE-1 and GAGE-7: new genes expressed in the LNCaP prostate cancer progression model that share homology with melanoma-associated antigens.", "journal": "J. Biol. Chem.", "date": "1998", "authors": "Chen ME, Lin SH, Chung LW, Sikes RA", "evidence": [ { "database": "UniProtKB", "id": "O76087", "url": "https://www.uniprot.org/uniprot/O76087" } ], "reference": [ { "type": "PubMed", "id": "9651357", "url": "https://glygen.org/publication/PubMed/9651357" } ] } ], "pathway": [ { "id": "hsa:100008586", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:100008586", "resource": "KEGG Pathway" }, { "id": "hsa:2579", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2579", "resource": "KEGG Pathway" }, { "id": "hsa:26748", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:26748", "resource": "KEGG Pathway" }, { "id": "hsa:645073", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:645073", "resource": "KEGG Pathway" }, { "id": "hsa:729428", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:729428", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 10 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }