{ "uniprot_canonical_ac": "O75897-1", "uniprot_ac": "O75897", "uniprot_id": "ST1C4_HUMAN", "mass": { "chemical_mass": 35520.0, "monoisotopic_mass": 35520.0 }, "refseq": { "ac": "NP_001308699", "name": "sulfotransferase 1C4 isoform 2", "summary": "Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that belongs to the SULT1 subfamily, responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308699" }, "gene_names": [ { "name": "SULT1C4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O75897", "id": "O75897" }, { "name": "SULT1C2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O75897", "id": "O75897" }, { "name": "SULT1C4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308699", "id": "NP_001308699" }, { "name": "SULT1C; SULT1C2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308699", "id": "NP_001308699" } ], "protein_names": [ { "name": "Sulfotransferase 1C4", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O75897" }, { "name": "2.8.2.1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75897" }, { "name": "ST1C4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75897" }, { "name": "SULT1C#2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75897" }, { "name": "Sulfotransferase 1C2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75897" }, { "name": "sulfotransferase 1C4 isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308699", "id": "NP_001308699" }, { "name": "sulfotransferase family, cytosolic, 1C, member C2; sulfotransferase family, cytosolic, 1C, member 2; sulfotransferase 1C4; sulfotransferase 1C2; ST1C4; SULT1C#2; sulfotransferase family, cytosolic, 1C, member 4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308699", "id": "NP_001308699" } ], "function": [ { "annotation": "Developmental Expression of SULT1C4 Transcript Variants in Human Liver: Implications for Discordance Between SULT1C4 mRNA and Protein Levels.", "evidence": [ { "database": "RefSeq", "id": "NP_001308699", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308699" }, { "database": "PubMed", "id": "32303576", "url": "https://glygen.org/publication/PubMed/32303576" } ] }, { "annotation": "Sulfation of hyperoside by the human cytosolic sulfotransferases (SULTs): impact of genetic polymorphisms on hyperoside-sulfating activity of SULT1C4 allozymes.", "evidence": [ { "database": "RefSeq", "id": "NP_001308699", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308699" }, { "database": "PubMed", "id": "35249434", "url": "https://glygen.org/publication/PubMed/35249434" } ] }, { "annotation": "Sulfotransferase 1C2 promotes hepatocellular carcinoma progression by enhancing glycolysis and fatty acid metabolism.", "evidence": [ { "database": "RefSeq", "id": "NP_001308699", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308699" }, { "database": "PubMed", "id": "36880364", "url": "https://glygen.org/publication/PubMed/36880364" } ] }, { "annotation": "Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that belongs to the SULT1 subfamily, responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001308699", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308699" } ] }, { "annotation": "Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of phenolic compounds. Can also sulfonate estrogenic compounds, however, the dietary flavonoids (phytoestrogen) and environmental estrogens, like bisphenol A are better substrates than 17beta-estradiol (E2) (PubMed:17425406, PubMed:28222028, PubMed:9852044, PubMed:26948952). Mediates the sulfation of doxorubicin and its analog epirubicin, two antitumor anthracyclines (PubMed:26948952).", "evidence": [ { "database": "UniProtKB", "id": "O75897", "url": "https://www.uniprot.org/uniprot/O75897#function" }, { "database": "PubMed", "id": "9852044", "url": "https://glygen.org/publication/PubMed/9852044" }, { "database": "PubMed", "id": "17425406", "url": "https://glygen.org/publication/PubMed/17425406" }, { "database": "PubMed", "id": "26948952", "url": "https://glygen.org/publication/PubMed/26948952" }, { "database": "PubMed", "id": "28222028", "url": "https://glygen.org/publication/PubMed/28222028" } ] }, { "annotation": "The current study aimed to identify the human cytosolic sulfotransferase(s) that is(are) capable of sulfating doxorubicin and its analog epirubicin, and to verify whether sulfation of doxorubicin and epirubicin may occur under metabolic conditions.", "evidence": [ { "database": "RefSeq", "id": "NP_001308699", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308699" }, { "database": "PubMed", "id": "26948952", "url": "https://glygen.org/publication/PubMed/26948952" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "O75897", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75897" } ], "glycoeffect": [], "start_pos": 194, "end_pos": 194, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "C", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "2", "chr_pos": "108383475", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "R194", "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] }, { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] }, { "disease_id": "DOID:4362", "recommended_name": { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervical cancer", "description": "A female reproductive organ cancer that is located_in the cervix." }, "synonyms": [ { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervical neoplasm", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervix cancer", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervix uteri cancer", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "neoplasm of uterine cervix", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "tumor of the Cervix Uteri", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "uterine cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical cancer", "description": "A primary or metastatic malignant neoplasm involving the cervix." }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "tumor of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "tumour of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "uterine cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cancer of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical cancer, somatic", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervix cancer", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervix uteri cancer", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "uterine cervix cancer", "description": "" }, { "id": "MIM:603956", "resource": "MIM", "url": "https://www.omim.org/entry/603956", "name": "Cervical cancer", "description": "Cervical cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "O75897", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75897" } ], "glycoeffect": [], "start_pos": 85, "end_pos": 85, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "Q", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "2", "chr_pos": "108381846", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "R85", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] }, { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "69.15", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000198075", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198075" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "41.27", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000198075", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198075" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "73.35", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000198075", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198075" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "76.78", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198075", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198075" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "72.63", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000198075", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198075" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "62.82", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000198075", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198075" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "70.97", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000198075", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198075" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "57.71", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000198075", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198075" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "74.27", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000198075", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198075" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "72.69", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000198075", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198075" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O75897", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75897" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O75897", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75897" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O75897", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75897" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O75897", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75897" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O75897", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75897" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O75897", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75897" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O75897", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75897" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O75897", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75897" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O75897", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75897" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O75897", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75897" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O75897", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75897" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O75897", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75897" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75897", "url": "https://www.uniprot.org/uniprot/O75897" } ], "common_name": "Human" } ], "gene": [ { "name": "SULT1C4", "url": "https://www.uniprot.org/uniprot/O75897", "locus": { "chromosome": "2", "start_pos": 108388989, "end_pos": 108377911, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000198075", "url": "https://www.ensembl.org/id/ENSG00000198075" } ] } } ], "crossref": [ { "id": "ENSG00000198075", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198075", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O75897", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75897", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "2.8.2.1", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.8.2.1&UniProtAcc=O75897", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "CHEMBL1743296", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL1743296", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "SULT1C4", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=SULT1C4", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "27233", "url": "https://www.ncbi.nlm.nih.gov/gene/27233", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "11457", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=11457", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O75897", "url": "https://www.ebi.ac.uk/intact/interactors/id:O75897*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000863", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000863", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:27233", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:27233", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "608357", "url": "http://www.omim.org/entry/608357", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O75897", "url": "https://www.nextprot.org/entry/NX_O75897", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "VAPHAFF", "url": "https://omabrowser.org/oma/group/VAPHAFF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3083090at2759", "url": "http://www.orthodb.org/?query=3083090at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11783", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11783", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11783:SF44", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11783:SF44", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2AD1", "url": "https://www.rcsb.org/structure/2AD1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2GWH", "url": "https://www.rcsb.org/structure/2GWH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00685", "url": "http://pfam.xfam.org/family/PF00685", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O75897", "url": "https://pharos.nih.gov/targets/O75897", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O75897", "url": "http://purl.obolibrary.org/obo/PR_O75897", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001308699", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308699", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "12164", "url": "https://www.rhea-db.org/rhea/12164", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "52372", "url": "https://www.rhea-db.org/rhea/52372", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "66580", "url": "https://www.rhea-db.org/rhea/66580", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "O75897", "url": "https://www.uniprot.org/uniprot/O75897", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O75897-1", "url": "https://www.uniprot.org/uniprot/O75897-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O75897-2", "url": "https://www.uniprot.org/uniprot/O75897-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MALHDMEDFTFDGTKRLSVNYVKGILQPTDTCDIWDKIWNFQAKPDDLLISTYPKAGTTWTQEIVELIQNEGDVEKSKRAPTHQRFPFLEMKIPSLGSGLEQAHAMPSPRILKTHLPFHLLPPSLLEKNCKIIYVARNPKDNMVSYYHFQRMNKALPAPGTWEEYFETFLAGKVCWGSWHEHVKGWWEAKDKHRILYLFYEDMKKNPKHEIQKLAEFIGKKLDDKVLDKIVHYTSFDVMKQNPMANYSSIPAEIMDHSISPFMRKGAVGDWKKHFTVAQNERFDEDYKKKMTDTRLTFHFQF", "length": 302, "header": "sp|O75897-1|ST1C4_HUMAN Isoform 1 of Sulfotransferase 1C4 OS=Homo sapiens OX=9606 GN=SULT1C4 PE=1 SV=2 CANONICAL=O75897-1" }, "isoforms": [ { "isoform_ac": "O75897-1", "url": "", "sequence": { "sequence": "MALHDMEDFTFDGTKRLSVNYVKGILQPTDTCDIWDKIWNFQAKPDDLLISTYPKAGTTWTQEIVELIQNEGDVEKSKRAPTHQRFPFLEMKIPSLGSGLEQAHAMPSPRILKTHLPFHLLPPSLLEKNCKIIYVARNPKDNMVSYYHFQRMNKALPAPGTWEEYFETFLAGKVCWGSWHEHVKGWWEAKDKHRILYLFYEDMKKNPKHEIQKLAEFIGKKLDDKVLDKIVHYTSFDVMKQNPMANYSSIPAEIMDHSISPFMRKGAVGDWKKHFTVAQNERFDEDYKKKMTDTRLTFHFQF", "length": 302, "header": "sp|O75897-1|ST1C4_HUMAN Isoform 1 of Sulfotransferase 1C4 OS=Homo sapiens OX=9606 GN=SULT1C4 PE=1 SV=2 CANONICAL=O75897-1" }, "locus": { "chromosome": "2", "start_pos": 108387429, "end_pos": 108378338, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000272452.7", "url": "https://www.ensembl.org/id/ENST00000272452.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000272452.2", "url": "https://www.ensembl.org/id/ENSP00000272452.2" } ] } }, { "isoform_ac": "O75897-2", "url": "", "sequence": { "sequence": "MALHDMEDFTFDGTKRLSVNYVKGILQPTDTCDIWDKIWNFQAKPDDLLISTYPKAGTTWTQEIVELIQNEGDVEKSKRAPTHQRFPFLEMKIPSLGSVCWGSWHEHVKGWWEAKDKHRILYLFYEDMKKNPKHEIQKLAEFIGKKLDDKVLDKIVHYTSFDVMKQNPMANYSSIPAEIMDHSISPFMRKGAVGDWKKHFTVAQNERFDEDYKKKMTDTRLTFHFQF", "length": 227, "header": "sp|O75897-2|ST1C4_HUMAN Isoform 2 of Sulfotransferase 1C4 OS=Homo sapiens OX=9606 GN=SULT1C4 PE=1 SV=2 CANONICAL=O75897-1" }, "locus": { "chromosome": "2", "start_pos": 108387429, "end_pos": 108378338, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000409309.3", "url": "https://www.ensembl.org/id/ENST00000409309.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000387225.3", "url": "https://www.ensembl.org/id/ENSP00000387225.3" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Characterization of human iodothyronine sulfotransferases.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1999", "authors": "Kester MH, Kaptein E, Roest TJ, van Dijk CH, Tibboel D, Meinl W, Glatt H, Coughtrie MW, Visser TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "10199779", "url": "https://glygen.org/publication/PubMed/10199779" } ] }, { "title": "Cloning and characterization of a mammalian lithium-sensitive bisphosphate 3'-nucleotidase inhibited by inositol 1,4-bisphosphate.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Spiegelberg BD, Xiong JP, Smith JJ, Gu RF, York JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "10224133", "url": "https://glygen.org/publication/PubMed/10224133" } ] }, { "title": "Sulfotransferase catalyzing sulfation of heterocyclic amines.", "journal": "Cancer letters", "date": "1999", "authors": "Yamazoe Y, Nagata K, Yoshinari K, Fujita K, Shiraga T, Iwasaki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "10503886", "url": "https://glygen.org/publication/PubMed/10503886" } ] }, { "title": "Sulfation of iodothyronines by recombinant human liver steroid sulfotransferases.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Li X, Anderson RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "10512730", "url": "https://glygen.org/publication/PubMed/10512730" } ] }, { "title": "Contribution of CYP2E1 and CYP3A to acetaminophen reactive metabolite formation.", "journal": "Clinical pharmacology and therapeutics", "date": "2000", "authors": "Manyike PT, Kharasch ED, Kalhorn TF, Slattery JT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "10741631", "url": "https://glygen.org/publication/PubMed/10741631" } ] }, { "title": "Human sulfotransferases SULT1C1 and SULT1C2: cDNA characterization, gene cloning, and chromosomal localization.", "journal": "Genomics", "date": "2000", "authors": "Freimuth R R, Raftogianis R B, Wood T C, Moon E, Kim U J, Xu J, Siciliano M J, Weinshilboum R M", "evidence": [ { "database": "UniProtKB", "id": "O75897", "url": "https://www.uniprot.org/uniprot/O75897" } ], "reference": [ { "type": "PubMed", "id": "10783263", "url": "https://glygen.org/publication/PubMed/10783263" } ] }, { "title": "Sulfation of iodothyronines by human sulfotransferase 1C1 (SULT1C1)*.", "journal": "Biochemical pharmacology", "date": "2000", "authors": "Li X, Clemens DL, Anderson RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "11077054", "url": "https://glygen.org/publication/PubMed/11077054" } ] }, { "title": "Sulfotransferases in the bioactivation of xenobiotics.", "journal": "Chemico-biological interactions", "date": "2000", "authors": "Glatt H", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "11154739", "url": "https://glygen.org/publication/PubMed/11154739" } ] }, { "title": "Expression and characterization of the human 3 beta-hydroxysteroid sulfotransferases (SULT2B1a and SULT2B1b).", "journal": "The Journal of steroid biochemistry and molecular biology", "date": "2001", "authors": "Meloche CA, Falany CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "11457664", "url": "https://glygen.org/publication/PubMed/11457664" } ] }, { "title": "Interindividual variability in acetaminophen glucuronidation by human liver microsomes: identification of relevant acetaminophen UDP-glucuronosyltransferase isoforms.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2001", "authors": "Court MH, Duan SX, von Moltke LL, Greenblatt DJ, Patten CJ, Miners JO, Mackenzie PI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "11714888", "url": "https://glygen.org/publication/PubMed/11714888" } ] }, { "title": "Characterization of human liver thermostable phenol sulfotransferase (SULT1A1) allozymes with 3,3',5-triiodothyronine as the substrate.", "journal": "The Journal of endocrinology", "date": "2001", "authors": "Li X, Clemens DL, Cole JR, Anderson RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "11739018", "url": "https://glygen.org/publication/PubMed/11739018" } ] }, { "title": "Highly conserved mouse and human brain sulfotransferases: molecular cloning, expression, and functional characterization.", "journal": "Gene", "date": "2002", "authors": "Sakakibara Y, Suiko M, Pai TG, Nakayama T, Takami Y, Katafuchi J, Liu MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "12039030", "url": "https://glygen.org/publication/PubMed/12039030" } ] }, { "title": "Mutational analysis of human hydroxysteroid sulfotransferase SULT2B1 isoforms reveals that exon 1B of the SULT2B1 gene produces cholesterol sulfotransferase, whereas exon 1A yields pregnenolone sulfotransferase.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Fuda H, Lee YC, Shimizu C, Javitt NB, Strott CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "12145317", "url": "https://glygen.org/publication/PubMed/12145317" } ] }, { "title": "Sulfonation and molecular action.", "journal": "Endocrine reviews", "date": "2002", "authors": "Strott CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "12372849", "url": "https://glygen.org/publication/PubMed/12372849" } ] }, { "title": "Sequence identification and characterization of human carnosinase and a closely related non-specific dipeptidase.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Teufel M, Saudek V, Ledig JP, Bernhardt A, Boularand S, Carreau A, Cairns NJ, Carter C, Cowley DJ, Duverger D, Ganzhorn AJ, Guenet C, Heintzelmann B, Laucher V, Sauvage C, Smirnova T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "12473676", "url": "https://glygen.org/publication/PubMed/12473676" } ] }, { "title": "Endoglycan, a member of the CD34 family, functions as an L-selectin ligand through modification with tyrosine sulfation and sialyl Lewis x.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Fieger CB, Sassetti CM, Rosen SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "12889478", "url": "https://glygen.org/publication/PubMed/12889478" } ] }, { "title": "Human catecholamine sulfotransferase (SULT1A3) pharmacogenetics: functional genetic polymorphism.", "journal": "Journal of neurochemistry", "date": "2003", "authors": "Thomae BA, Rifki OF, Theobald MA, Eckloff BW, Wieben ED, Weinshilboum RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "14622112", "url": "https://glygen.org/publication/PubMed/14622112" } ] }, { "title": "The crystal structure of CCG1/TAF(II)250-interacting factor B (CIB).", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Padmanabhan B, Kuzuhara T, Adachi N, Horikoshi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "14672934", "url": "https://glygen.org/publication/PubMed/14672934" } ] }, { "title": "Human SULT1A3 pharmacogenetics: gene duplication and functional genomic studies.", "journal": "Biochemical and biophysical research communications", "date": "2004", "authors": "Hildebrandt MA, Salavaggione OE, Martin YN, Flynn HC, Jalal S, Wieben ED, Weinshilboum RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "15358107", "url": "https://glygen.org/publication/PubMed/15358107" } ] }, { "title": "Kinetics of acetaminophen glucuronidation by UDP-glucuronosyltransferases 1A1, 1A6, 1A9 and 2B15. Potential implications in acetaminophen-induced hepatotoxicity.", "journal": "Chemical research in toxicology", "date": "2006", "authors": "Mutlib AE, Goosen TC, Bauman JN, Williams JA, Kulkarni S, Kostrubsky S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "16696573", "url": "https://glygen.org/publication/PubMed/16696573" } ] }, { "title": "Structural and chemical profiling of the human cytosolic sulfotransferases.", "journal": "PLoS biology", "date": "2007", "authors": "Allali-Hassani A, Pan PW, Dombrovski L, Najmanovich R, Tempel W, Dong A, Loppnau P, Martin F, Thornton J, Edwards AM, Bochkarev A, Plotnikov AN, Vedadi M, Arrowsmith CH", "evidence": [ { "database": "UniProtKB", "id": "O75897", "url": "https://www.uniprot.org/uniprot/O75897" } ], "reference": [ { "type": "PubMed", "id": "17425406", "url": "https://glygen.org/publication/PubMed/17425406" } ] }, { "title": "Induction of hepatobiliary efflux transporters in acetaminophen-induced acute liver failure cases.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2007", "authors": "Barnes SN, Aleksunes LM, Augustine L, Scheffer GL, Goedken MJ, Jakowski AB, Pruimboom-Brees IM, Cherrington NJ, Manautou JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "17627974", "url": "https://glygen.org/publication/PubMed/17627974" } ] }, { "title": "Kinetic characterization and identification of the acylation and glycosylation sites of recombinant human gamma-glutamyltranspeptidase.", "journal": "Biochemistry", "date": "2007", "authors": "Castonguay R, Halim D, Morin M, Furtos A, Lherbet C, Bonneil E, Thibault P, Keillor JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "17924658", "url": "https://glygen.org/publication/PubMed/17924658" } ] }, { "title": "Interindividual variability in acetaminophen sulfation by human fetal liver: implications for pharmacogenetic investigations of drug-induced birth defects.", "journal": "Birth defects research. Part A, Clinical and molecular teratology", "date": "2008", "authors": "Adjei AA, Gaedigk A, Simon SD, Weinshilboum RM, Leeder JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "18232020", "url": "https://glygen.org/publication/PubMed/18232020" } ] }, { "title": "The human gamma-glutamyltransferase gene family.", "journal": "Human genetics", "date": "2008", "authors": "Heisterkamp N, Groffen J, Warburton D, Sneddon TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "18357469", "url": "https://glygen.org/publication/PubMed/18357469" } ] }, { "title": "Endoglycan, a member of the CD34 family of sialomucins, is a ligand for the vascular selectins.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2008", "authors": "Kerr SC, Fieger CB, Snapp KR, Rosen SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "18606703", "url": "https://glygen.org/publication/PubMed/18606703" } ] }, { "title": "Mass spectrometric kinetic analysis of human tyrosylprotein sulfotransferase-1 and -2.", "journal": "Journal of the American Society for Mass Spectrometry", "date": "2008", "authors": "Danan LM, Yu Z, Hoffhines AJ, Moore KL, Leary JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "18672380", "url": "https://glygen.org/publication/PubMed/18672380" } ] }, { "title": "Human kidney gamma-glutamyl transpeptidase. Catalytic properties, subunit structure, and localization of the gamma-glutamyl binding site on the light subunit.", "journal": "The Journal of biological chemistry", "date": "1977", "authors": "Tate SS, Ross ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "19463", "url": "https://glygen.org/publication/PubMed/19463" } ] }, { "title": "Isoform-selective inactivation of human arylamine N-acetyltransferases by reactive metabolites of carcinogenic arylamines.", "journal": "Chemical research in toxicology", "date": "2009", "authors": "Liu L, Wagner CR, Hanna PE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "19842618", "url": "https://glygen.org/publication/PubMed/19842618" } ] }, { "title": "Membrane transporters in drug development.", "journal": "Nature reviews. Drug discovery", "date": "2010", "authors": "Giacomini KM, Huang SM, Tweedie DJ, Benet LZ, Brouwer KL, Chu X, Dahlin A, Evers R, Fischer V, Hillgren KM, Hoffmaster KA, Ishikawa T, Keppler D, Kim RB, Lee CA, Niemi M, Polli JW, Sugiyama Y, Swaan PW, Ware JA, Wright SH, Yee SW, Zamek-Gliszczynski MJ, Zhang L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "20190787", "url": "https://glygen.org/publication/PubMed/20190787" } ] }, { "title": "UGT1A6 and UGT2B15 polymorphisms and acetaminophen conjugation in response to a randomized, controlled diet of select fruits and vegetables.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2011", "authors": "Navarro SL, Chen Y, Li L, Li SS, Chang JL, Schwarz Y, King IB, Potter JD, Bigler J, Lampe JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "21666065", "url": "https://glygen.org/publication/PubMed/21666065" } ] }, { "title": "Autocatalytic cleavage of human gamma-glutamyl transpeptidase is highly dependent on N-glycosylation at asparagine 95.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "West MB, Wickham S, Quinalty LM, Pavlovicz RE, Li C, Hanigan MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "21712391", "url": "https://glygen.org/publication/PubMed/21712391" } ] }, { "title": "Aminoacylase 1-catalysed deacetylation of bioactives epoxides mycotoxin-derived mercapturates; 3,4-epoxyprecocenes as models of cytotoxic epoxides.", "journal": "Biochimie", "date": "2012", "authors": "Stocker P, Brunel JM, de Rezende L, do Amaral AT, Morelli X, Roche P, Vidal N, Giardina T, Perrier J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "22349737", "url": "https://glygen.org/publication/PubMed/22349737" } ] }, { "title": "Impact of probe compound in MRP2 vesicular transport assays.", "journal": "European journal of pharmaceutical sciences : official journal of the European Federation for Pharmaceutical Sciences", "date": "2012", "authors": "Kidron H, Wissel G, Manevski N, Hakli M, Ketola RA, Finel M, Yliperttula M, Xhaard H, Urtti A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "22406294", "url": "https://glygen.org/publication/PubMed/22406294" } ] }, { "title": "Human liver steroid sulphotransferase sulphates bile acids.", "journal": "The Biochemical journal", "date": "1990", "authors": "Radominska A, Comer KA, Zimniak P, Falany J, Iscan M, Falany CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "2268288", "url": "https://glygen.org/publication/PubMed/2268288" } ] }, { "title": "Role for cytoplasmic nucleotide hydrolysis in hepatic function and protein synthesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Hudson BH, Frederick JP, Drake LY, Megosh LC, Irving RP, York JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "23479625", "url": "https://glygen.org/publication/PubMed/23479625" } ] }, { "title": "Crystal structure of human tyrosylprotein sulfotransferase-2 reveals the mechanism of protein tyrosine sulfation reaction.", "journal": "Nature communications", "date": "2013", "authors": "Teramoto T, Fujikawa Y, Kawaguchi Y, Kurogi K, Soejima M, Adachi R, Nakanishi Y, Mishiro-Sato E, Liu MC, Sakakibara Y, Suiko M, Kimura M, Kakuta Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "23481380", "url": "https://glygen.org/publication/PubMed/23481380" } ] }, { "title": "Human GGT2 does not autocleave into a functional enzyme: A cautionary tale for interpretation of microarray data on redox signaling.", "journal": "Antioxidants & redox signaling", "date": "2013", "authors": "West MB, Wickham S, Parks EE, Sherry DM, Hanigan MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "23682772", "url": "https://glygen.org/publication/PubMed/23682772" } ] }, { "title": "Different gamma-glutamyl transpeptidase mRNAs are expressed in human liver and kidney.", "journal": "Biochemical and biophysical research communications", "date": "1989", "authors": "Pawlak A, Wu SJ, Bulle F, Suzuki A, Chikhi N, Ferry N, Baik JH, Siegrist S, Guellaen G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "2573352", "url": "https://glygen.org/publication/PubMed/2573352" } ] }, { "title": "PharmGKB summary: pathways of acetaminophen metabolism at the therapeutic versus toxic doses.", "journal": "Pharmacogenetics and genomics", "date": "2015", "authors": "Mazaleuskaya LL, Sangkuhl K, Thorn CF, FitzGerald GA, Altman RB, Klein TE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "26049587", "url": "https://glygen.org/publication/PubMed/26049587" } ] }, { "title": "Sulphation of acetaminophen by the human cytosolic sulfotransferases: a systematic analysis.", "journal": "Journal of biochemistry", "date": "2015", "authors": "Yamamoto A, Liu MY, Kurogi K, Sakakibara Y, Saeki Y, Suiko M, Liu MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "26067475", "url": "https://glygen.org/publication/PubMed/26067475" } ] }, { "title": "Human cytosolic sulfotransferase SULT1C4 mediates the sulfation of doxorubicin and epirubicin.", "journal": "Drug metabolism and pharmacokinetics", "date": "2016", "authors": "Luo L, Zhou C, Hui Y, Kurogi K, Sakakibara Y, Suiko M, Liu MC", "evidence": [ { "database": "UniProtKB", "id": "O75897", "url": "https://www.uniprot.org/uniprot/O75897" }, { "database": "RefSeq", "id": "NP_001308699", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308699" } ], "reference": [ { "type": "PubMed", "id": "26948952", "url": "https://glygen.org/publication/PubMed/26948952" } ] }, { "title": "Expression, purification and characterization of human cytosolic sulfotransferase (SULT) 1C4.", "journal": "Hormone molecular biology and clinical investigation", "date": "2017-01-01", "authors": "Guidry Amber L, Tibbs Zachary E, Runge-Morris Melissa, Falany Charles N", "evidence": [ { "database": "UniProtKB", "id": "O75897", "url": "https://www.uniprot.org/uniprot/O75897" } ], "reference": [ { "type": "PubMed", "id": "28222028", "url": "https://glygen.org/publication/PubMed/28222028" } ] }, { "title": "Developmental Expression of SULT1C4 Transcript Variants in Human Liver: Implications for Discordance Between SULT1C4 mRNA and Protein Levels.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2020", "authors": "Dubaisi S, Fang H, Caruso JA, Gaedigk R, Vyhlidal CA, Kocarek TA, Runge-Morris M", "evidence": [ { "database": "RefSeq", "id": "NP_001308699", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308699" } ], "reference": [ { "type": "PubMed", "id": "32303576", "url": "https://glygen.org/publication/PubMed/32303576" } ] }, { "title": "Human multidrug resistance protein 4 (MRP4) is a cellular efflux transporter for paracetamol glutathione and cysteine conjugates.", "journal": "Archives of toxicology", "date": "2020", "authors": "Koenderink JB, van den Heuvel JJMW, Bilos A, Vredenburg G, Vermeulen NPE, Russel FGM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "32472168", "url": "https://glygen.org/publication/PubMed/32472168" } ] }, { "title": "The spontaneous and enzymatic reaction of N-acetyl-p-benzoquinonimine with glutathione: a stopped-flow kinetic study.", "journal": "Archives of biochemistry and biophysics", "date": "1988", "authors": "Coles B, Wilson I, Wardman P, Hinson JA, Nelson SD, Ketterer B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "3395122", "url": "https://glygen.org/publication/PubMed/3395122" } ] }, { "title": "Sulfation of hyperoside by the human cytosolic sulfotransferases (SULTs): impact of genetic polymorphisms on hyperoside-sulfating activity of SULT1C4 allozymes.", "journal": "Journal of Asian natural products research", "date": "2022-03-07", "authors": "Mei Xue, Gohal Saud A, Zhou Chunyang, Liu Ming-Cheh", "evidence": [ { "database": "RefSeq", "id": "NP_001308699", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308699" } ], "reference": [ { "type": "PubMed", "id": "35249434", "url": "https://glygen.org/publication/PubMed/35249434" } ] }, { "title": "Sulfotransferase 1C2 promotes hepatocellular carcinoma progression by enhancing glycolysis and fatty acid metabolism.", "journal": "Cancer medicine", "date": "2023-03-07", "authors": "Jiang Liya, Xu Fang, Li Chenglong, Liu Ting, Zhao Qianwei, Liu Yixian, Zhao Ying, Li Yamei, Zhang Zhendong, Tang Xiaolei, Zhang Jintao", "evidence": [ { "database": "RefSeq", "id": "NP_001308699", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308699" } ], "reference": [ { "type": "PubMed", "id": "36880364", "url": "https://glygen.org/publication/PubMed/36880364" } ] }, { "title": "Thermolabile and thermostable human platelet phenol sulfotransferase. Substrate specificity and physical separation.", "journal": "Naunyn-Schmiedeberg's archives of pharmacology", "date": "1983", "authors": "Reiter C, Mwaluko G, Dunnette J, Van Loon J, Weinshilboum R", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "6139755", "url": "https://glygen.org/publication/PubMed/6139755" } ] }, { "title": "Radioenzymatic assay of sulfate conjugates of catecholamines and DOPA in plasma.", "journal": "Life sciences", "date": "1980", "authors": "Johnson GA, Baker CA, Smith RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "6770210", "url": "https://glygen.org/publication/PubMed/6770210" } ] }, { "title": "Acetaminophen and phenol: substrates for both a thermostable and a thermolabile form of human platelet phenol sulfotransferase.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "1982", "authors": "Reiter C, Weinshilboum RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "6950087", "url": "https://glygen.org/publication/PubMed/6950087" } ] }, { "title": "Treatment of paracetamol (acetaminophen) poisoning with N-acetylcysteine.", "journal": "Lancet (London, England)", "date": "1977", "authors": "Prescott LF, Park J, Ballantyne A, Adriaenssens P, Proudfoot AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "70646", "url": "https://glygen.org/publication/PubMed/70646" } ] }, { "title": "Treatment of severe acetaminophen poisoning with intravenous acetylcysteine.", "journal": "Archives of internal medicine", "date": "1981", "authors": "Prescott LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "7469630", "url": "https://glygen.org/publication/PubMed/7469630" } ] }, { "title": "Cloning and expression of human liver dehydroepiandrosterone sulphotransferase.", "journal": "The Biochemical journal", "date": "1993", "authors": "Comer KA, Falany JL, Falany CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "7678732", "url": "https://glygen.org/publication/PubMed/7678732" } ] }, { "title": "Bacterial expression and characterization of a cDNA for human liver estrogen sulfotransferase.", "journal": "The Journal of steroid biochemistry and molecular biology", "date": "1995", "authors": "Falany CN, Krasnykh V, Falany JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "7779757", "url": "https://glygen.org/publication/PubMed/7779757" } ] }, { "title": "Human liver estrogen sulfotransferase: identification by cDNA cloning and expression.", "journal": "Biochemical and biophysical research communications", "date": "1994", "authors": "Aksoy IA, Wood TC, Weinshilboum R", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "8185618", "url": "https://glygen.org/publication/PubMed/8185618" } ] }, { "title": "cDNA cloning and expression of a new form of human aryl sulfotransferase.", "journal": "The international journal of biochemistry & cell biology", "date": "1996", "authors": "Zhu X, Veronese ME, Iocco P, McManus ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "8697101", "url": "https://glygen.org/publication/PubMed/8697101" } ] }, { "title": "Immunohistochemical detection of gamma-glutamyl transpeptidase in normal human tissue.", "journal": "The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society", "date": "1996", "authors": "Hanigan MH, Frierson HF Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "8813074", "url": "https://glygen.org/publication/PubMed/8813074" } ] }, { "title": "Influence of polymorphic N-acetyltransferase phenotype on the inhibition and induction of acetaminophen bioactivation with long-term isoniazid.", "journal": "Clinical pharmacology and therapeutics", "date": "1997", "authors": "Chien JY, Peter RM, Nolan CM, Wartell C, Slattery JT, Nelson SD, Carithers RL Jr, Thummel KE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "9024171", "url": "https://glygen.org/publication/PubMed/9024171" } ] }, { "title": "Sulfation and sulfotransferases 1: Sulfotransferase molecular biology: cDNAs and genes.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "1997", "authors": "Weinshilboum RM, Otterness DM, Aksoy IA, Wood TC, Her C, Raftogianis RB", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "9034160", "url": "https://glygen.org/publication/PubMed/9034160" } ] }, { "title": "Hydrolysis and transfer reactions catalyzed by gamma-glutamyl transpeptidase; evidence for separate substrate sites and for high affinity of L-cystine.", "journal": "Biochemical and biophysical research communications", "date": "1976", "authors": "Thompson GA, Meister A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "9080", "url": "https://glygen.org/publication/PubMed/9080" } ] }, { "title": "Expression and characterization of a novel thyroid hormone-sulfating form of cytosolic sulfotransferase from human liver.", "journal": "Molecular pharmacology", "date": "1998", "authors": "Wang J, Falany JL, Falany CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "9463486", "url": "https://glygen.org/publication/PubMed/9463486" } ] }, { "title": "Tyrosylprotein sulfotransferase: purification and molecular cloning of an enzyme that catalyzes tyrosine O-sulfation, a common posttranslational modification of eukaryotic proteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Ouyang Yb, Lane WS, Moore KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "9501187", "url": "https://glygen.org/publication/PubMed/9501187" } ] }, { "title": "Structural and functional characterisation of human sulfotransferases.", "journal": "Chemico-biological interactions", "date": "1998", "authors": "Brix LA, Nicoll R, Zhu X, McManus ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "9566739", "url": "https://glygen.org/publication/PubMed/9566739" } ] }, { "title": "Molecular cloning, expression, and characterization of novel human SULT1C sulfotransferases that catalyze the sulfonation of N-hydroxy-2-acetylaminofluorene.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Sakakibara Y, Yanagisawa K, Katafuchi J, Ringer DP, Takami Y, Nakayama T, Suiko M, Liu MC", "evidence": [ { "database": "UniProtKB", "id": "O75897", "url": "https://www.uniprot.org/uniprot/O75897" }, { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "9852044", "url": "https://glygen.org/publication/PubMed/9852044" } ] } ], "pathway": [ { "id": "hsa:27233", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:27233", "resource": "KEGG Pathway" }, { "id": "R-HSA-156584", "name": "Cytosolic sulfonation of small molecules", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584", "resource": "Reactome", "description": "Cytosolic sulfonation of small molecules" }, { "id": "R-HSA-9753281", "name": "Paracetamol ADME", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281", "resource": "Reactome", "description": "Paracetamol ADME" } ], "orthologs": [ { "uniprot_canonical_ac": "P50237-1", "protein_name": "Sulfotransferase 1C1", "gene_name": "Sult1c1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSLEKMKDLHLGEQDLQPETREVNGILMSKLMSDNWDKIWNFQAKPDDLLIATYAKAGTTWTQEIVDMIQNDGDVQKCQRANTYDRHPFIEWTLPSPLNSGLDLANKMPSPRTLKTHLPVHMLPPSFWKENSKIIYVARNAKDCLVSYYYFSRMNKMLPDPGTLGEYIEQFKAGKVLWGSWYDHVKGWWDVKDQHRILYLFYEDMKEDPKREIKKIAKFLEKDISEEVLNKIIYHTSFDVMKENPMANYTTLPSSIMDHSISPFMRKGMPGDWKNYFTVAQSEDFDEDYRRKMAGSNITFRTEI", "length": 304 }, "evidence": [ { "id": "45919731", "url": "http://www.informatics.jax.org/homology/45919731", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q6IMI6-1", "protein_name": "Sulfotransferase 1C3", "gene_name": "SULT1C3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAKIEKNAPTMEKKPELFNIMEVDGVPTLILSKEWWEKVCNFQAKPDDLILATYPKSGTTWMHEILDMILNDGDVEKCKRAQTLDRHAFLELKFPHKEKPDLEFVLEMSSPQLIKTHLPSHLIPPSIWKENCKIVYVARNPKDCLVSYYHFHRMASFMPDPQNLEEFYEKFMSGKVVGGSWFDHVKGWWAAKDMHRILYLFYEDIKKDPKREIEKILKFLEKDISEEILNKIIYHTSFDVMKQNPMTNYTTLPTSIMDHSISPFMRKGMPGDWKNYFTVAQNEEFDKDYQKKMAGSTLTFRTEI", "length": 304 }, "evidence": [ { "id": "45919731", "url": "http://www.informatics.jax.org/homology/45919731", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q80VR3-1", "protein_name": "Sulfotransferase 1C1", "gene_name": "Sult1c1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MPLEKLKDLHLDEQNMQPETREVNGILMSKMMSENWDKIWNFQAKPDDLLIATYAKAGTTWTQEIVDMIQNDGDVQKCQRANTYDRHPFIEWTLPPPLNSGLDLANKMPSPRTLKTHLPVQMLPPSFWKENSKIIYVARNAKDCLVSYYYFSRMNKMLPDPGTLGEYIETFKAGKVLWGSWYDHVKGWWDVKDKHRILYLFYEDMKEDPKREIKKIVKFLEKDISEEVLNKIIHHTSFDVMKQNPMANYTTLPSSIMDHSISPFMRKGMPGDWKNYFTVAQSEDFDEDYRKKMAGSTITFRTEI", "length": 304 }, "evidence": [ { "id": "45919731", "url": "http://www.informatics.jax.org/homology/45919731", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "sulfotransferase activity", "id": "GO:0008146", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008146", "evidence": [ { "database": "UniProtKB", "id": "O75897", "url": "https://www.uniprot.org/uniprot/O75897" } ], "pmid": "" }, { "name": "aryl sulfotransferase activity", "id": "GO:0004062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004062", "evidence": [ { "database": "UniProtKB", "id": "O75897", "url": "https://www.uniprot.org/uniprot/O75897" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "sulfation", "id": "GO:0051923", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051923", "evidence": [ { "database": "UniProtKB", "id": "O75897", "url": "https://www.uniprot.org/uniprot/O75897" } ], "pmid": "" }, { "name": "ethanol catabolic process", "id": "GO:0006068", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006068", "evidence": [ { "database": "UniProtKB", "id": "O75897", "url": "https://www.uniprot.org/uniprot/O75897" } ], "pmid": "" }, { "name": "xenobiotic metabolic process", "id": "GO:0006805", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006805", "evidence": [ { "database": "UniProtKB", "id": "O75897", "url": "https://www.uniprot.org/uniprot/O75897" } ], "pmid": "" }, { "name": "3'-phosphoadenosine 5'-phosphosulfate metabolic process", "id": "GO:0050427", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050427", "evidence": [ { "database": "UniProtKB", "id": "O75897", "url": "https://www.uniprot.org/uniprot/O75897" } ], "pmid": "" }, { "name": "doxorubicin metabolic process", "id": "GO:0044598", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044598", "evidence": [ { "database": "UniProtKB", "id": "O75897", "url": "https://www.uniprot.org/uniprot/O75897" } ], "pmid": "" }, { "name": "flavonoid metabolic process", "id": "GO:0009812", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009812", "evidence": [ { "database": "UniProtKB", "id": "O75897", "url": "https://www.uniprot.org/uniprot/O75897" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O75897", "url": "https://www.uniprot.org/uniprot/O75897" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O75897", "url": "https://www.uniprot.org/uniprot/O75897" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 246, "end_pos": 248, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "12164", "name": "", "equation": "3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P17988-1", "Q9WUW8-1", "Q9WUW9-1", "P52847-1", "A0A0G2JZU5-1", "A0A8I5ZKG4-1", "P0DMN0-1", "P50225-1", "P50226-1", "P0DMM9-1", "Q6IMI6-1", "O43704-1", "O75897-1", "O00338-1", "P52840-1", "Q9D939-1", "Q9QWG7-1" ], "evidence": [ { "id": "12164", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/12164" } ] }, { "id": "52372", "name": "", "equation": "17beta-estradiol + 3'-phosphoadenylyl sulfate = 17beta-estradiol 3-sulfate + adenosine 3',5'-bisphosphate + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P52844-1", "P17988-1", "P49888-1", "P50225-1", "O75897-1", "P49891-1", "P52840-1" ], "evidence": [ { "id": "52372", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/52372" } ] }, { "id": "66580", "name": "", "equation": "3'-phosphoadenylyl sulfate + bisphenol A = adenosine 3',5'-bisphosphate + bisphenyl A sulfate + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O75897-1" ], "evidence": [ { "id": "66580", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/66580" } ] }, { "id": "R-HSA-176646", "name": "p-nitrophenol + PAPS => p-nitrophenol sulfate + PAP", "equation": "", "summary": "The sulfonation of the xenobiotic p-nitrophenol (4-nitrophenol) can be catalyzed by five well-characterized SULT enzymes, 1A1 (Brix et al. 1998), 1A2 (Brix et al. 1998; Zhu et al. 1996), 1C2 (Sakakibara et al. 1998), and 4A1 (Sakakibara et al. 2002).", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-5695950" ], "output_participant_list": [ "R-ALL-176600" ], "enzyme_list": [ "O75897-1", "P50225-1", "Q9BR01-1", "P50226-1" ], "evidence": [ { "id": "R-HSA-176646", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-176646" } ] }, { "id": "R-HSA-176669", "name": "N-hydroxy-2-acetylaminofluorene + PAPS => 2-acetylaminofluorene-N-sulfate + PAP", "equation": "", "summary": "Sulfonation of the xenobiotic N-hydroxy-2-acetylaminofluorene converts it to a potent carcinogen. SULT1A2 (Glatt 2000) and SULT1C1 and 1C2 (Sakakibara et al. 1998) catalyze this reaction.", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-176566" ], "output_participant_list": [ "R-ALL-176500" ], "enzyme_list": [ "O75897-1", "P50226-1", "O00338-1" ], "evidence": [ { "id": "R-HSA-176669", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-176669" } ] }, { "id": "R-HSA-9753277", "name": "SULT dimers sulfate APAP to APAP-SO3", "equation": "", "summary": "After a therapeutic dose, a large fraction (30-44%) of acetaminophen (APAP) can be converted to inactive sulfate conjugates. Cytosolic sulfotransferases (SULTs) carry out the sulfation conjugation of APAP. SULTs transfer a sulfo group from PAPS to APAP, making it more polar and therefore easier to eliminate. SULTs 1A1, 1A3, 1A4, 1C4, 1E1 and 2A1 are known to have sulfotransferase activity towards APAP (Reiter & Weinshilboum 1992, Adjei et al. 2008, Mazaleuskaya et al. 2015). SULTs are expressed in many tissues but Yamamoto et al. found higher sulfating activity in the liver and intestine than that found in the lung and kidney (Yamamoto et al. 2015).", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [ "R-ALL-9753448" ], "enzyme_list": [ "O75897-1", "P0DMN0-1", "P50225-1", "Q06520-1", "P0DMM9-1", "P49888-1" ], "evidence": [ { "id": "R-HSA-9753277", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753277" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-176500", "participant_name": "AAF-N-S [cytosol]", "crossref": [ { "id": "35424", "database": "ChEBI", "url": "" }, { "id": "11533684", "database": "PubChem Substance", "url": "" }, { "id": "000002018271", "database": "ZINC", "url": "" }, { "id": "11533684", "database": "PubChem Substance", "url": "" }, { "id": "000002018271", "database": "ZINC", "url": "" }, { "id": "35424", "database": "ChEBI", "url": "" }, { "id": "11533684", "database": "PubChem Substance", "url": "" }, { "id": "35424", "database": "ChEBI", "url": "" }, { "id": "000002018271", "database": "ZINC", "url": "" }, { "id": "35424", "database": "ChEBI", "url": "" }, { "id": "11533684", "database": "PubChem Substance", "url": "" }, { "id": "000002018271", "database": "ZINC", "url": "" }, { "id": "35424", "database": "ChEBI", "url": "" }, { "id": "11533684", "database": "PubChem Substance", "url": "" }, { "id": "000002018271", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-176566", "participant_name": "N-hydroxy-2-acetylaminofluorene [cytosol]", "crossref": [ { "id": "8145202", "database": "PubChem Substance", "url": "" }, { "id": "17931", "database": "ChEBI", "url": "" }, { "id": "000005196784", "database": "ZINC", "url": "" }, { "id": "HMDB0255151", "database": "HMDB Metabolite", "url": "" }, { "id": "17931", "database": "ChEBI", "url": "" }, { "id": "000005196784", "database": "ZINC", "url": "" }, { "id": "8145202", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0255151", "database": "HMDB Metabolite", "url": "" }, { "id": "17931", "database": "ChEBI", "url": "" }, { "id": "000005196784", "database": "ZINC", "url": "" }, { "id": "8145202", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0255151", "database": "HMDB Metabolite", "url": "" }, { "id": "17931", "database": "ChEBI", "url": "" }, { "id": "8145202", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0255151", "database": "HMDB Metabolite", "url": "" }, { "id": "000005196784", "database": "ZINC", "url": "" }, { "id": "8145202", "database": "PubChem Substance", "url": "" }, { "id": "17931", "database": "ChEBI", "url": "" }, { "id": "000005196784", "database": "ZINC", "url": "" }, { "id": "HMDB0255151", "database": "HMDB Metabolite", "url": "" } ] }, { "participant_id": "R-ALL-176600", "participant_name": "p-nitrophenol sulfate [cytosol]", "crossref": [ { "id": "35422", "database": "ChEBI", "url": "" }, { "id": "HMDB0006492", "database": "HMDB Metabolite", "url": "" }, { "id": "000001633996", "database": "ZINC", "url": "" }, { "id": "11533685", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0006492", "database": "HMDB Metabolite", "url": "" }, { "id": "11533685", "database": "PubChem Substance", "url": "" }, { "id": "35422", "database": "ChEBI", "url": "" }, { "id": "000001633996", "database": "ZINC", "url": "" }, { "id": "11533685", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0006492", "database": "HMDB Metabolite", "url": "" }, { "id": "35422", "database": "ChEBI", "url": "" }, { "id": "000001633996", "database": "ZINC", "url": "" }, { "id": "35422", "database": "ChEBI", "url": "" }, { "id": "HMDB0006492", "database": "HMDB Metabolite", "url": "" }, { "id": "000001633996", "database": "ZINC", "url": "" }, { "id": "11533685", "database": "PubChem Substance", "url": "" }, { "id": "35422", "database": "ChEBI", "url": "" }, { "id": "HMDB0006492", "database": "HMDB Metabolite", "url": "" }, { "id": "000001633996", "database": "ZINC", "url": "" }, { "id": "11533685", "database": "PubChem Substance", "url": "" } ] }, { "participant_id": "R-ALL-5695950", "participant_name": "PNP [cytosol]", "crossref": [ { "id": "16836", "database": "ChEBI", "url": "" }, { "id": "000034828682", "database": "ZINC", "url": "" }, { "id": "C00870", "database": "COMPOUND", "url": "" }, { "id": "HMDB0001232", "database": "HMDB Metabolite", "url": "" }, { "id": "8143627", "database": "PubChem Substance", "url": "" }, { "id": "16836", "database": "ChEBI", "url": "" }, { "id": "000034828682", "database": "ZINC", "url": "" }, { "id": "C00870", "database": "COMPOUND", "url": "" }, { "id": "HMDB0001232", "database": "HMDB Metabolite", "url": "" }, { "id": "8143627", "database": "PubChem Substance", "url": "" }, { "id": "16836", "database": "ChEBI", "url": "" }, { "id": "000034828682", "database": "ZINC", "url": "" }, { "id": "C00870", "database": "COMPOUND", "url": "" }, { "id": "HMDB0001232", "database": "HMDB Metabolite", "url": "" }, { "id": "8143627", "database": "PubChem Substance", "url": "" }, { "id": "C00870", "database": "COMPOUND", "url": "" }, { "id": "8143627", "database": "PubChem Substance", "url": "" }, { "id": "16836", "database": "ChEBI", "url": "" }, { "id": "000034828682", "database": "ZINC", "url": "" }, { "id": "HMDB0001232", "database": "HMDB Metabolite", "url": "" }, { "id": "C00870", "database": "COMPOUND", "url": "" }, { "id": "8143627", "database": "PubChem Substance", "url": "" }, { "id": "16836", "database": "ChEBI", "url": "" }, { "id": "HMDB0001232", "database": "HMDB Metabolite", "url": "" }, { "id": "000034828682", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-9753448", "participant_name": "APAP-SO3 [cytosol]", "crossref": [ { "id": "32635", "database": "ChEBI", "url": "" }, { "id": "8147600", "database": "PubChem Substance", "url": "" }, { "id": "000002382375", "database": "ZINC", "url": "" }, { "id": "HMDB0059911", "database": "HMDB Metabolite", "url": "" }, { "id": "000002382375", "database": "ZINC", "url": "" }, { "id": "32635", "database": "ChEBI", "url": "" }, { "id": "HMDB0059911", "database": "HMDB Metabolite", "url": "" }, { "id": "8147600", "database": "PubChem Substance", "url": "" }, { "id": "8147600", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0059911", "database": "HMDB Metabolite", "url": "" }, { "id": "32635", "database": "ChEBI", "url": "" }, { "id": "000002382375", "database": "ZINC", "url": "" }, { "id": "32635", "database": "ChEBI", "url": "" }, { "id": "8147600", "database": "PubChem Substance", "url": "" }, { "id": "000002382375", "database": "ZINC", "url": "" }, { "id": "HMDB0059911", "database": "HMDB Metabolite", "url": "" }, { "id": "32635", "database": "ChEBI", "url": "" }, { "id": "8147600", "database": "PubChem Substance", "url": "" }, { "id": "000002382375", "database": "ZINC", "url": "" }, { "id": "HMDB0059911", "database": "HMDB Metabolite", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2JZU5", "gene_name": "RGD1559960", "activity": [ { "ec_number": "2.8.2.-", "activity": "", "evidence": [ { "id": "A0A0G2JZU5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JZU5" } ] } ] }, { "uniprot_ac": "A0A8I5ZKG4", "gene_name": "LOC102551938", "activity": [ { "ec_number": "2.8.2.-", "activity": "", "evidence": [ { "id": "A0A8I5ZKG4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZKG4" } ] } ] }, { "uniprot_ac": "O00338", "gene_name": "SULT1C2", "activity": [ { "ec_number": "2.8.2.-", "activity": "", "evidence": [ { "id": "O00338", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00338" } ] }, { "ec_number": "2.8.2.1", "activity": "3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate + H(+).", "evidence": [ { "id": "O00338", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00338" } ] }, { "ec_number": "2.8.2.1", "activity": "", "evidence": [ { "id": "O00338", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00338" } ] } ] }, { "uniprot_ac": "O43704", "gene_name": "SULT1B1", "activity": [ { "ec_number": "2.8.2.-", "activity": "", "evidence": [ { "id": "O43704", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43704" } ] }, { "ec_number": "2.8.2.1", "activity": "3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate + H(+).", "evidence": [ { "id": "O43704", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43704" } ] }, { "ec_number": "2.8.2.1", "activity": "", "evidence": [ { "id": "O43704", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43704" } ] } ] }, { "uniprot_ac": "O75897", "gene_name": "SULT1C4", "activity": [ { "ec_number": "2.8.2.1", "activity": "3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate + H(+).", "evidence": [ { "id": "O75897", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75897" } ] }, { "ec_number": "2.8.2.1", "activity": "", "evidence": [ { "id": "O75897", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75897" } ] } ] }, { "uniprot_ac": "P0DMM9", "gene_name": "SULT1A3", "activity": [ { "ec_number": "2.8.2.-", "activity": "", "evidence": [ { "id": "P0DMM9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DMM9" } ] }, { "ec_number": "2.8.2.1", "activity": "3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate + H(+).", "evidence": [ { "id": "P0DMM9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DMM9" } ] }, { "ec_number": "2.8.2.1", "activity": "", "evidence": [ { "id": "P0DMM9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DMM9" } ] } ] }, { "uniprot_ac": "P0DMN0", "gene_name": "SULT1A4", "activity": [ { "ec_number": "2.8.2.1", "activity": "3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate + H(+).", "evidence": [ { "id": "P0DMN0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DMN0" } ] }, { "ec_number": "2.8.2.1", "activity": "", "evidence": [ { "id": "P0DMN0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DMN0" } ] } ] }, { "uniprot_ac": "P17988", "gene_name": "Sult1a1", "activity": [ { "ec_number": "2.8.2.1", "activity": "3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate + H(+).", "evidence": [ { "id": "P17988", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17988" } ] }, { "ec_number": "2.8.2.1", "activity": "", "evidence": [ { "id": "P17988", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17988" } ] } ] }, { "uniprot_ac": "P49888", "gene_name": "SULT1E1", "activity": [ { "ec_number": "2.8.2.4", "activity": "3'-phosphoadenylyl sulfate + estrone = adenosine 3',5'-bisphosphate + estrone 3-sulfate + H(+).", "evidence": [ { "id": "P49888", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49888" } ] }, { "ec_number": "2.8.2.4", "activity": "", "evidence": [ { "id": "P49888", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49888" } ] } ] }, { "uniprot_ac": "P49891", "gene_name": "Sult1e1", "activity": [ { "ec_number": "2.8.2.4", "activity": "3'-phosphoadenylyl sulfate + estrone = adenosine 3',5'-bisphosphate + estrone 3-sulfate + H(+).", "evidence": [ { "id": "P49891", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49891" } ] }, { "ec_number": "2.8.2.4", "activity": "", "evidence": [ { "id": "P49891", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49891" } ] }, { "ec_number": "2.8.2.-", "activity": "", "evidence": [ { "id": "P49891", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49891" } ] } ] }, { "uniprot_ac": "P50225", "gene_name": "SULT1A1", "activity": [ { "ec_number": "2.8.2.-", "activity": "", "evidence": [ { "id": "P50225", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50225" } ] }, { "ec_number": "2.8.2.1", "activity": "3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate + H(+).", "evidence": [ { "id": "P50225", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50225" } ] }, { "ec_number": "2.8.2.1", "activity": "", "evidence": [ { "id": "P50225", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50225" } ] } ] }, { "uniprot_ac": "P50226", "gene_name": "SULT1A2", "activity": [ { "ec_number": "2.8.2.-", "activity": "", "evidence": [ { "id": "P50226", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50226" } ] }, { "ec_number": "2.8.2.1", "activity": "3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate + H(+).", "evidence": [ { "id": "P50226", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50226" } ] }, { "ec_number": "2.8.2.1", "activity": "", "evidence": [ { "id": "P50226", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50226" } ] } ] }, { "uniprot_ac": "P52840", "gene_name": "Sult1a1", "activity": [ { "ec_number": "2.8.2.-", "activity": "", "evidence": [ { "id": "P52840", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52840" } ] }, { "ec_number": "2.8.2.1", "activity": "3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate + H(+).", "evidence": [ { "id": "P52840", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52840" } ] }, { "ec_number": "2.8.2.1", "activity": "", "evidence": [ { "id": "P52840", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52840" } ] } ] }, { "uniprot_ac": "P52844", "gene_name": "Sult1e1", "activity": [ { "ec_number": "2.8.2.-", "activity": "", "evidence": [ { "id": "P52844", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52844" } ] }, { "ec_number": "2.8.2.4", "activity": "3'-phosphoadenylyl sulfate + estrone = adenosine 3',5'-bisphosphate + estrone 3-sulfate + H(+).", "evidence": [ { "id": "P52844", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52844" } ] }, { "ec_number": "2.8.2.4", "activity": "", "evidence": [ { "id": "P52844", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52844" } ] } ] }, { "uniprot_ac": "P52847", "gene_name": "Sult1b1", "activity": [ { "ec_number": "2.8.2.1", "activity": "3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate + H(+).", "evidence": [ { "id": "P52847", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52847" } ] }, { "ec_number": "2.8.2.1", "activity": "", "evidence": [ { "id": "P52847", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52847" } ] } ] }, { "uniprot_ac": "Q06520", "gene_name": "SULT2A1", "activity": [ { "ec_number": "2.8.2.14", "activity": "3'-phosphoadenylyl sulfate + taurolithocholate = adenosine 3',5'-bisphosphate + H(+) + taurolithocholate 3-sulfate.", "evidence": [ { "id": "Q06520", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06520" } ] }, { "ec_number": "2.8.2.2", "activity": "3'-phosphoadenylyl sulfate + an alcohol = adenosine 3',5'-bisphosphate + an alkyl sulfate + H(+).", "evidence": [ { "id": "Q06520", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06520" } ] }, { "ec_number": "2.8.2.2", "activity": "", "evidence": [ { "id": "Q06520", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06520" } ] } ] }, { "uniprot_ac": "Q6IMI6", "gene_name": "SULT1C3", "activity": [ { "ec_number": "2.8.2.1", "activity": "3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate + H(+).", "evidence": [ { "id": "Q6IMI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IMI6" } ] }, { "ec_number": "2.8.2.2", "activity": "3'-phosphoadenylyl sulfate + an alcohol = adenosine 3',5'-bisphosphate + an alkyl sulfate + H(+).", "evidence": [ { "id": "Q6IMI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IMI6" } ] }, { "ec_number": "2.8.2.2", "activity": "", "evidence": [ { "id": "Q6IMI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IMI6" } ] }, { "ec_number": "2.8.2.1", "activity": "", "evidence": [ { "id": "Q6IMI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IMI6" } ] } ] }, { "uniprot_ac": "Q9BR01", "gene_name": "SULT4A1", "activity": [ { "ec_number": "2.8.2.-", "activity": "", "evidence": [ { "id": "Q9BR01", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BR01" } ] } ] }, { "uniprot_ac": "Q9D939", "gene_name": "Sult1c2", "activity": [ { "ec_number": "2.8.2.1", "activity": "3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate + H(+).", "evidence": [ { "id": "Q9D939", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D939" } ] }, { "ec_number": "2.8.2.1", "activity": "", "evidence": [ { "id": "Q9D939", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D939" } ] } ] }, { "uniprot_ac": "Q9QWG7", "gene_name": "Sult1b1", "activity": [ { "ec_number": "2.8.2.1", "activity": "3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate + H(+).", "evidence": [ { "id": "Q9QWG7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QWG7" } ] }, { "ec_number": "2.8.2.1", "activity": "", "evidence": [ { "id": "Q9QWG7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QWG7" } ] } ] }, { "uniprot_ac": "Q9WUW8", "gene_name": "Sult1c2", "activity": [ { "ec_number": "2.8.2.-", "activity": "", "evidence": [ { "id": "Q9WUW8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUW8" } ] }, { "ec_number": "2.8.2.1", "activity": "3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate + H(+).", "evidence": [ { "id": "Q9WUW8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUW8" } ] }, { "ec_number": "2.8.2.1", "activity": "", "evidence": [ { "id": "Q9WUW8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUW8" } ] } ] }, { "uniprot_ac": "Q9WUW9", "gene_name": "Sult1c2a", "activity": [ { "ec_number": "2.8.2.-", "activity": "", "evidence": [ { "id": "Q9WUW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUW9" } ] }, { "ec_number": "2.8.2.1", "activity": "3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate + H(+).", "evidence": [ { "id": "Q9WUW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUW9" } ] }, { "ec_number": "2.8.2.1", "activity": "", "evidence": [ { "id": "Q9WUW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUW9" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [ 85, 194 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 246, "end_pos": 248 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 65 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }