{ "uniprot_canonical_ac": "O75791-1", "uniprot_ac": "O75791", "uniprot_id": "GRAP2_HUMAN", "mass": { "chemical_mass": 37909.0, "monoisotopic_mass": 37909.0 }, "refseq": { "ac": "NP_001278753", "name": "GRB2-related adapter protein 2 isoform 1", "summary": "This gene encodes a member of the GRB2/Sem5/Drk family. This member is an adaptor-like protein involved in leukocyte-specific protein-tyrosine kinase signaling. Like its related family member, GRB2-related adaptor protein (GRAP), this protein contains an SH2 domain flanked by two SH3 domains. This protein interacts with other proteins, such as GRB2-associated binding protein 1 (GAB1) and the SLP-76 leukocyte protein (LCP2), through its SH3 domains. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Apr 2014].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278753" }, "gene_names": [ { "name": "GRAP2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O75791", "id": "O75791" }, { "name": "GADS; GRAP-2; GRB2L; GRBLG; GrbX; Grf40; GRID; GRPL; Mona; P38", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278753", "id": "NP_001278753" }, { "name": "GADS", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O75791", "id": "O75791" }, { "name": "GRAP2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278753", "id": "NP_001278753" }, { "name": "GRB2L", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O75791", "id": "O75791" }, { "name": "GRID", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O75791", "id": "O75791" } ], "protein_names": [ { "name": "GRB2-related adapter protein 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O75791" }, { "name": "Adapter protein GRID", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75791" }, { "name": "GRB-2-like protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75791" }, { "name": "GRB2-related adapter protein 2 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278753", "id": "NP_001278753" }, { "name": "GRB2L", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75791" }, { "name": "GRBLG", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75791" }, { "name": "GRBX", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75791" }, { "name": "Grf-40", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75791" }, { "name": "Grf40 adapter protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75791" }, { "name": "Growth factor receptor-binding protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75791" }, { "name": "Hematopoietic cell-associated adapter protein GrpL", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75791" }, { "name": "P38", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75791" }, { "name": "Protein GADS", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75791" }, { "name": "SH3-SH2-SH3 adapter Mona", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75791" }, { "name": "growth factor receptor-bound protein 2-related adaptor protein 2; GRB-2-like protein; hematopoietic cell-associated adaptor protein GRPL; GRB2-related protein with insert domain; SH3-SH2-SH3 adaptor molecule; GRB2-related adapter protein 2; growth factor receptor-binding protein; grf-40; adapter protein GRID; grf40 adapter protein; SH3-SH2-SH3 adapter Mona; hematopoietic cell-associated adapter protein GrpL", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278753", "id": "NP_001278753" } ], "function": [ { "annotation": "Interacts with SLP-76 to regulate NF-AT activation. Binds to tyrosine-phosphorylated shc.", "evidence": [ { "database": "UniProtKB", "id": "O75791", "url": "https://www.uniprot.org/uniprot/O75791#function" } ] }, { "annotation": "This gene encodes a member of the GRB2/Sem5/Drk family. This member is an adaptor-like protein involved in leukocyte-specific protein-tyrosine kinase signaling. Like its related family member, GRB2-related adaptor protein (GRAP), this protein contains an SH2 domain flanked by two SH3 domains. This protein interacts with other proteins, such as GRB2-associated binding protein 1 (GAB1) and the SLP-76 leukocyte protein (LCP2), through its SH3 domains. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Apr 2014].", "evidence": [ { "database": "RefSeq", "id": "NP_001278753", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278753" } ] }, { "annotation": "Upstream open reading frames regulate translation of this protein's mRNA in megakaryocytes.", "evidence": [ { "database": "RefSeq", "id": "NP_001278753", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278753" }, { "database": "PubMed", "id": "12487779", "url": "https://glygen.org/publication/PubMed/12487779" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "O75791", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75791" } ], "glycoeffect": [], "start_pos": 312, "end_pos": 312, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "22", "chr_pos": "39971026", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "R312", "disease": [ { "disease_id": "DOID:1793", "recommended_name": { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic cancer", "description": "An endocrine gland cancer located_in the pancreas." }, "synonyms": [ { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca body of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca head of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca tail of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of body of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of head of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of tail of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreas neoplasm", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic neoplasm", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic tumor", "description": "" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "O75791", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75791" } ], "glycoeffect": [], "start_pos": 69, "end_pos": 69, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "E", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "22", "chr_pos": "39960091", "ref_nt": "G", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "E69", "disease": [ { "disease_id": "DOID:1319", "recommended_name": { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain." }, "synonyms": [ { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "BT - Brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult malignant brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm, adult", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of Brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of adult brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary malignant neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "tumor of the Brain", "description": "" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "54.38", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000100351", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100351" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "53.61", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000100351", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100351" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "67.33", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000100351", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100351" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "63.25", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000100351", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100351" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "62.21", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000100351", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100351" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "74.44", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000100351", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100351" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000100351", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100351" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "65.34", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000100351", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100351" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "62.19", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000100351", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100351" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000100351", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100351" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "62.66", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000100351", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100351" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "72.42", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000100351", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100351" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "69.92", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000100351", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100351" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O75791", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75791" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O75791", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75791" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O75791", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75791" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O75791", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75791" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O75791", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75791" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O75791", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75791" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O75791", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75791" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O75791", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75791" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O75791", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75791" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O75791", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75791" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O75791", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75791" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O75791", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75791" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75791", "url": "https://www.uniprot.org/uniprot/O75791" } ], "common_name": "Human" } ], "gene": [ { "name": "GRAP2", "url": "https://www.uniprot.org/uniprot/O75791", "locus": { "chromosome": "22", "start_pos": 39973721, "end_pos": 39901084, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000100351", "url": "https://www.ensembl.org/id/ENSG00000100351" } ] } } ], "crossref": [ { "id": "ENSG00000100351", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100351", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O75791", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75791", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd09941", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd09941", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd11947", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd11947", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd11950", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd11950", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "GRAP2", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=GRAP2", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "9402", "url": "https://www.ncbi.nlm.nih.gov/gene/9402", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "4563", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=4563", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O75791", "url": "https://www.ebi.ac.uk/intact/interactors/id:O75791*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000980", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000980", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035646", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035646", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036028", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036028", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036860", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036860", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043539", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043539", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:9402", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9402", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "604518", "url": "http://www.omim.org/entry/604518", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O75791", "url": "https://www.nextprot.org/entry/NX_O75791", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "VAKFDFM", "url": "https://omabrowser.org/oma/group/VAKFDFM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "25371at2759", "url": "http://www.orthodb.org/?query=25371at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR46037", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46037", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46037:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46037:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "5GJH", "url": "https://www.rcsb.org/structure/5GJH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00017", "url": "http://pfam.xfam.org/family/PF00017", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00018", "url": "http://pfam.xfam.org/family/PF00018", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O75791", "url": "https://pharos.nih.gov/targets/O75791", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O75791", "url": "http://purl.obolibrary.org/obo/PR_O75791", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2424491", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2424491", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-389356", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389356", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9680350", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001278753", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278753", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "B1AH86", "url": "https://www.uniprot.org/uniprot/B1AH86", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B1AH86-1", "url": "https://www.uniprot.org/uniprot/B1AH86-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O75791", "url": "https://www.uniprot.org/uniprot/O75791", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O75791-1", "url": "https://www.uniprot.org/uniprot/O75791-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O75791-2", "url": "https://www.uniprot.org/uniprot/O75791-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMTR", "length": 330, "header": "sp|O75791-1|GRAP2_HUMAN Isoform 1 of GRB2-related adapter protein 2 OS=Homo sapiens OX=9606 GN=GRAP2 PE=1 SV=1 CANONICAL=O75791-1" }, "isoforms": [ { "isoform_ac": "B1AH86-1", "url": "", "sequence": { "sequence": "MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVR", "length": 97, "header": "tr|B1AH86-1|GRAP2_HUMAN Computationally mapped isoform of GRB2-related adapter protein 2 OS=Homo sapiens OX=9606 GN=GRAP2 PE=1 SV=1 CANONICAL=O75791-1" }, "locus": { "chromosome": "22", "start_pos": 39960175, "end_pos": 39947107, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000420971.5", "url": "https://www.ensembl.org/id/ENST00000420971.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000396355.1", "url": "https://www.ensembl.org/id/ENSP00000396355.1" } ] } }, { "isoform_ac": "O75791-1", "url": "", "sequence": { "sequence": "MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMTR", "length": 330, "header": "sp|O75791-1|GRAP2_HUMAN Isoform 1 of GRB2-related adapter protein 2 OS=Homo sapiens OX=9606 GN=GRAP2 PE=1 SV=1 CANONICAL=O75791-1" }, "locus": { "chromosome": "22", "start_pos": 39971081, "end_pos": 39947107, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000344138.9", "url": "https://www.ensembl.org/id/ENST00000344138.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000339186.4", "url": "https://www.ensembl.org/id/ENSP00000339186.4" } ] } }, { "isoform_ac": "O75791-2", "url": "", "sequence": { "sequence": "MVSRRPLSTPGRELTHGQGGWLLHHPGQPELPRGLLHLCQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMTR", "length": 217, "header": "sp|O75791-2|GRAP2_HUMAN Isoform 2 of GRB2-related adapter protein 2 OS=Homo sapiens OX=9606 GN=GRAP2 PE=1 SV=1 CANONICAL=O75791-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 187, "end_pos": 187, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75791", "url": "https://www.uniprot.org/uniprot/O75791" } ], "site_lbl": "Ser187" }, { "start_pos": 236, "end_pos": 236, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75791", "url": "https://www.uniprot.org/uniprot/O75791" } ], "site_lbl": "Ser236" }, { "start_pos": 262, "end_pos": 262, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O75791", "url": "https://www.uniprot.org/uniprot/O75791" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "15144186", "url": "https://glygen.org/publication/PubMed/15144186" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "18088087", "url": "https://glygen.org/publication/PubMed/18088087" }, { "database": "PubMed", "id": "12522270", "url": "https://glygen.org/publication/PubMed/12522270" }, { "database": "iPTMnet", "id": "O75791", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75791" }, { "database": "phospho.ELM", "id": "O75791", "url": "http://phospho.elm.eu.org/byAccession/O75791.html" }, { "database": "PubMed", "id": "25452106", "url": "https://glygen.org/publication/PubMed/25452106" } ], "site_lbl": "Thr262" }, { "start_pos": 45, "end_pos": 45, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "O75791", "url": "https://www.uniprot.org/uniprot/O75791" }, { "database": "PubMed", "id": "15144186", "url": "https://glygen.org/publication/PubMed/15144186" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "O75791", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75791" }, { "database": "phospho.ELM", "id": "O75791", "url": "http://phospho.elm.eu.org/byAccession/O75791.html" } ], "site_lbl": "Tyr45" } ], "glycation": [], "keywords": [], "publication": [ { "title": "The hematopoietic-specific adaptor protein gads functions in T-cell signaling via interactions with the SLP-76 and LAT adaptors.", "journal": "Current biology : CB", "date": "1999", "authors": "Liu SK, Fang N, Koretzky GA, McGlade CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2424491", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2424491" } ], "reference": [ { "type": "PubMed", "id": "10021361", "url": "https://glygen.org/publication/PubMed/10021361" } ] }, { "title": "Tyrosine phosphorylation of SLP-76 is downstream of Syk following stimulation of the collagen receptor in platelets.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Gross BS, Lee JR, Clements JL, Turner M, Tybulewicz VL, Findell PR, Koretzky GA, Watson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-2424491", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2424491" } ], "reference": [ { "type": "PubMed", "id": "10026222", "url": "https://glygen.org/publication/PubMed/10026222" } ] }, { "title": "Cutting edge: a role for the adaptor protein LAT in human NK cell-mediated cytotoxicity.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Jevremovic D, Billadeau DD, Schoon RA, Dick CJ, Irvin BJ, Zhang W, Samelson LE, Abraham RT, Leibson PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2424491", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2424491" } ], "reference": [ { "type": "PubMed", "id": "10072481", "url": "https://glygen.org/publication/PubMed/10072481" } ] }, { "title": "Akt promotes cell survival by phosphorylating and inhibiting a Forkhead transcription factor.", "journal": "Cell", "date": "1999", "authors": "Brunet A, Bonni A, Zigmond MJ, Lin MZ, Juo P, Hu LS, Anderson MJ, Arden KC, Blenis J, Greenberg ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "10102273", "url": "https://glygen.org/publication/PubMed/10102273" } ] }, { "title": "GrpL, a Grb2-related adaptor protein, interacts with SLP-76 to regulate nuclear factor of activated T cell activation.", "journal": "J. Exp. Med.", "date": "1999", "authors": "Law CL, Ewings MK, Chaudhary PM, Solow SA, Yun TJ, Marshall AJ, Hood L, Clark EA", "evidence": [ { "database": "UniProtKB", "id": "O75791", "url": "https://www.uniprot.org/uniprot/O75791" } ], "reference": [ { "type": "PubMed", "id": "10209041", "url": "https://glygen.org/publication/PubMed/10209041" } ] }, { "title": "Grf40, A novel Grb2 family member, is involved in T cell signaling through interaction with SLP-76 and LAT.", "journal": "J. Exp. Med.", "date": "1999", "authors": "Asada H, Ishii N, Sasaki Y, Endo K, Kasai H, Tanaka N, Takeshita T, Tsuchiya S, Konno T, Sugamura K", "evidence": [ { "database": "UniProtKB", "id": "O75791", "url": "https://www.uniprot.org/uniprot/O75791" }, { "database": "Reactome", "id": "R-HSA-2424491", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2424491" } ], "reference": [ { "type": "PubMed", "id": "10224278", "url": "https://glygen.org/publication/PubMed/10224278" } ] }, { "title": "Ubiquitination of p27 is regulated by Cdk-dependent phosphorylation and trimeric complex formation.", "journal": "Genes & development", "date": "1999", "authors": "Montagnoli A, Fiore F, Eytan E, Carrano AC, Draetta GF, Hershko A, Pagano M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "10323868", "url": "https://glygen.org/publication/PubMed/10323868" } ] }, { "title": "STAT protein recruitment and activation in c-Kit deletion mutants.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Brizzi MF, Dentelli P, Rosso A, Yarden Y, Pegoraro L", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "10358045", "url": "https://glygen.org/publication/PubMed/10358045" } ] }, { "title": "Identification of Tyr-703 and Tyr-936 as the primary association sites for Grb2 and Grb7 in the c-Kit/stem cell factor receptor.", "journal": "The Biochemical journal", "date": "1999", "authors": "Thommes K, Lennartsson J, Carlberg M, Ronnstrand L", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "10377264", "url": "https://glygen.org/publication/PubMed/10377264" } ] }, { "title": "Tyrosine phosphorylation of Vav stimulates IL-6 production in mast cells by a Rac/c-Jun N-terminal kinase-dependent pathway.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Song JS, Haleem-Smith H, Arudchandran R, Gomez J, Scott PM, Mill JF, Tan TH, Rivera J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "10395673", "url": "https://glygen.org/publication/PubMed/10395673" } ] }, { "title": "The receptor protein tyrosine phosphatase, PTP-RO, is upregulated during megakaryocyte differentiation and Is associated with the c-Kit receptor.", "journal": "Blood", "date": "1999", "authors": "Taniguchi Y, London R, Schinkmann K, Jiang S, Avraham H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "10397721", "url": "https://glygen.org/publication/PubMed/10397721" } ] }, { "title": "Phosphorylation of Shc by Src family kinases is necessary for stem cell factor receptor/c-kit mediated activation of the Ras/MAP kinase pathway and c-fos induction.", "journal": "Oncogene", "date": "1999", "authors": "Lennartsson J, Blume-Jensen P, Hermanson M, Ponten E, Carlberg M, Ronnstrand L", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "10523831", "url": "https://glygen.org/publication/PubMed/10523831" } ] }, { "title": "Isoforms of c-KIT differ in activation of signalling pathways and transformation of NIH3T3 fibroblasts.", "journal": "Oncogene", "date": "1999", "authors": "Caruana G, Cambareri AC, Ashman LK", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "10523834", "url": "https://glygen.org/publication/PubMed/10523834" } ] }, { "title": "Functional association between SLAP-130 and SLP-76 in Jurkat T cells.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Boerth NJ, Judd BA, Koretzky GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "10671560", "url": "https://glygen.org/publication/PubMed/10671560" } ] }, { "title": "Molecular cloning of murine STAP-1, the stem-cell-specific adaptor protein containing PH and SH2 domains.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Masuhara M, Nagao K, Nishikawa M, Sasaki M, Yoshimura A, Osawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "10679268", "url": "https://glygen.org/publication/PubMed/10679268" } ] }, { "title": "Vav2 is an activator of Cdc42, Rac1, and RhoA.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Abe K, Rossman KL, Liu B, Ritola KD, Chiang D, Campbell SL, Burridge K, Der CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2424491", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2424491" } ], "reference": [ { "type": "PubMed", "id": "10744696", "url": "https://glygen.org/publication/PubMed/10744696" } ] }, { "title": "Fyn-binding protein (Fyb)/SLP-76-associated protein (SLAP), Ena/vasodilator-stimulated phosphoprotein (VASP) proteins and the Arp2/3 complex link T cell receptor (TCR) signaling to the actin cytoskeleton.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Krause M, Sechi AS, Konradt M, Monner D, Gertler FB, Wehland J", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "10747096", "url": "https://glygen.org/publication/PubMed/10747096" } ] }, { "title": "AFX-like Forkhead transcription factors mediate cell-cycle regulation by Ras and PKB through p27kip1.", "journal": "Nature", "date": "2000", "authors": "Medema RH, Kops GJ, Bos JL, Burgering BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "10783894", "url": "https://glygen.org/publication/PubMed/10783894" } ] }, { "title": "Association of Grb2, Gads, and phospholipase C-gamma 1 with phosphorylated LAT tyrosine residues. Effect of LAT tyrosine mutations on T cell antigen receptor-mediated signaling.", "journal": "J. Biol. Chem.", "date": "2000", "authors": "Zhang W, Trible RP, Zhu M, Liu SK, McGlade CJ, Samelson LE", "evidence": [ { "database": "UniProtKB", "id": "O75791", "url": "https://www.uniprot.org/uniprot/O75791" }, { "database": "Reactome", "id": "R-HSA-2424491", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2424491" } ], "reference": [ { "type": "PubMed", "id": "10811803", "url": "https://glygen.org/publication/PubMed/10811803" } ] }, { "title": "GRID: a novel Grb-2-related adapter protein that interacts with the activated T cell costimulatory receptor CD28.", "journal": "J. Immunol.", "date": "2000", "authors": "Ellis JH, Ashman C, Burden MN, Kilpatrick KE, Morse MA, Hamblin PA", "evidence": [ { "database": "UniProtKB", "id": "O75791", "url": "https://www.uniprot.org/uniprot/O75791" } ], "reference": [ { "type": "PubMed", "id": "10820259", "url": "https://glygen.org/publication/PubMed/10820259" } ] }, { "title": "A second calcineurin binding site on the NFAT regulatory domain.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Park S, Uesugi M, Verdine GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "10860980", "url": "https://glygen.org/publication/PubMed/10860980" } ] }, { "title": "Crystal structure of human stem cell factor: implication for stem cell factor receptor dimerization and activation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Zhang Z, Zhang R, Joachimiak A, Schlessinger J, Kong XP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "10884405", "url": "https://glygen.org/publication/PubMed/10884405" } ] }, { "title": "Structural basis for relief of autoinhibition of the Dbl homology domain of proto-oncogene Vav by tyrosine phosphorylation.", "journal": "Cell", "date": "2000", "authors": "Aghazadeh B, Lowry WE, Huang XY, Rosen MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "11007481", "url": "https://glygen.org/publication/PubMed/11007481" } ] }, { "title": "Calcineurin: form and function.", "journal": "Physiological reviews", "date": "2000", "authors": "Rusnak F, Mertz P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "11015619", "url": "https://glygen.org/publication/PubMed/11015619" } ] }, { "title": "Flt3 ligand induces tyrosine phosphorylation of gab1 and gab2 and their association with shp-2, grb2, and PI3 kinase.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Zhang S, Broxmeyer HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "11027663", "url": "https://glygen.org/publication/PubMed/11027663" } ] }, { "title": "Concerted dephosphorylation of the transcription factor NFAT1 induces a conformational switch that regulates transcriptional activity.", "journal": "Molecular cell", "date": "2000", "authors": "Okamura H, Aramburu J, Garcia-Rodriguez C, Viola JP, Raghavan A, Tahiliani M, Zhang X, Qin J, Hogan PG, Rao A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "11030334", "url": "https://glygen.org/publication/PubMed/11030334" } ] }, { "title": "The mechanism of phospholipase C-gamma1 regulation.", "journal": "Experimental & molecular medicine", "date": "2000", "authors": "Kim MJ, Kim E, Ryu SH, Suh PG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2424491", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2424491" } ], "reference": [ { "type": "PubMed", "id": "11048639", "url": "https://glygen.org/publication/PubMed/11048639" } ] }, { "title": "Forkhead transcription factor FKHR-L1 modulates cytokine-dependent transcriptional regulation of p27(KIP1).", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Dijkers PF, Medema RH, Pals C, Banerji L, Thomas NS, Lam EW, Burgering BM, Raaijmakers JA, Lammers JW, Koenderman L, Coffer PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "11094066", "url": "https://glygen.org/publication/PubMed/11094066" } ] }, { "title": "Vav3 mediates receptor protein tyrosine kinase signaling, regulates GTPase activity, modulates cell morphology, and induces cell transformation.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Zeng L, Sachdev P, Yan L, Chan JL, Trenkle T, McClelland M, Welsh J, Wang LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2424491", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2424491" } ], "reference": [ { "type": "PubMed", "id": "11094073", "url": "https://glygen.org/publication/PubMed/11094073" } ] }, { "title": "The mechanism of PAK activation. Autophosphorylation events in both regulatory and kinase domains control activity.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Chong C, Tan L, Lim L, Manser E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "11278486", "url": "https://glygen.org/publication/PubMed/11278486" } ] }, { "title": "Mitogen-activated protein kinase kinase 4 metastasis suppressor gene expression is inversely related to histological pattern in advancing human prostatic cancers.", "journal": "Cancer research", "date": "2001", "authors": "Kim HL, Vander Griend DJ, Yang X, Benson DA, Dubauskas Z, Yoshida BA, Chekmareva MA, Ichikawa Y, Sokoloff MH, Zhan P, Karrison T, Lin A, Stadler WM, Ichikawa T, Rubin MA, Rinker-Schaeffer CW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "11306453", "url": "https://glygen.org/publication/PubMed/11306453" } ] }, { "title": "Vav1 regulates phospholipase cgamma activation and calcium responses in mast cells.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Manetz TS, Gonzalez-Espinosa C, Arudchandran R, Xirasagar S, Tybulewicz V, Rivera J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "11340169", "url": "https://glygen.org/publication/PubMed/11340169" } ] }, { "title": "Mapping the Zap-70 phosphorylation sites on LAT (linker for activation of T cells) required for recruitment and activation of signalling proteins in T cells.", "journal": "The Biochemical journal", "date": "2001", "authors": "Paz PE, Wang S, Clarke H, Lu X, Stokoe D, Abo A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2424491", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2424491" } ], "reference": [ { "type": "PubMed", "id": "11368773", "url": "https://glygen.org/publication/PubMed/11368773" } ] }, { "title": "Identification of a phospholipase C-gamma1 (PLC-gamma1) SH3 domain-binding site in SLP-76 required for T-cell receptor-mediated activation of PLC-gamma1 and NFAT.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Yablonski D, Kadlecek T, Weiss A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2424491", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2424491" } ], "reference": [ { "type": "PubMed", "id": "11390650", "url": "https://glygen.org/publication/PubMed/11390650" } ] }, { "title": "Regulation of phosphoinositide-specific phospholipase C.", "journal": "Annual review of biochemistry", "date": "2001", "authors": "Rhee SG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "11395409", "url": "https://glygen.org/publication/PubMed/11395409" } ] }, { "title": "Synthesis and function of 3-phosphorylated inositol lipids.", "journal": "Annual review of biochemistry", "date": "2001", "authors": "Vanhaesebroeck B, Leevers SJ, Ahmadi K, Timms J, Katso R, Driscoll PC, Woscholski R, Parker PJ, Waterfield MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "11395417", "url": "https://glygen.org/publication/PubMed/11395417" } ] }, { "title": "STAT3 activation is required for Asp(816) mutant c-Kit induced tumorigenicity.", "journal": "Oncogene", "date": "2001", "authors": "Ning ZQ, Li J, McGuinness M, Arceci RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "11494148", "url": "https://glygen.org/publication/PubMed/11494148" } ] }, { "title": "Phosphatidylinositol 3 kinase contributes to the transformation of hematopoietic cells by the D816V c-Kit mutant.", "journal": "Blood", "date": "2001", "authors": "Chian R, Young S, Danilkovitch-Miagkova A, Ronnstrand L, Leonard E, Ferrao P, Ashman L, Linnekin D", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "11520784", "url": "https://glygen.org/publication/PubMed/11520784" } ] }, { "title": "The role of Gads in hematopoietic cell signalling.", "journal": "Oncogene", "date": "2001", "authors": "Liu SK, Berry DM, McGlade CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "11607830", "url": "https://glygen.org/publication/PubMed/11607830" } ] }, { "title": "ShcA tyrosine phosphorylation sites can replace ShcA binding in signalling by middle T-antigen.", "journal": "The EMBO journal", "date": "2001", "authors": "Nicholson PR, Empereur S, Glover HR, Dilworth SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "11707405", "url": "https://glygen.org/publication/PubMed/11707405" } ] }, { "title": "LAT, the linker for activation of T cells: a bridge between T cell-specific and general signaling pathways.", "journal": "Science's STKE : signal transduction knowledge environment", "date": "2000", "authors": "Wange RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "11752630", "url": "https://glygen.org/publication/PubMed/11752630" } ] }, { "title": "Pak1 kinase homodimers are autoinhibited in trans and dissociated upon activation by Cdc42 and Rac1.", "journal": "Molecular cell", "date": "2002", "authors": "Parrini MC, Lei M, Harrison SC, Mayer BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "11804587", "url": "https://glygen.org/publication/PubMed/11804587" } ] }, { "title": "Role for the adaptor protein Grb10 in the activation of Akt.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Jahn T, Seipel P, Urschel S, Peschel C, Duyster J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "11809791", "url": "https://glygen.org/publication/PubMed/11809791" } ] }, { "title": "Syk regulation of phosphoinositide 3-kinase-dependent NK cell function.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2002", "authors": "Jiang K, Zhong B, Gilvary DL, Corliss BC, Vivier E, Hong-Geller E, Wei S, Djeu JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-2424491", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2424491" } ], "reference": [ { "type": "PubMed", "id": "11907067", "url": "https://glygen.org/publication/PubMed/11907067" } ] }, { "title": "Recruitment of stem and progenitor cells from the bone marrow niche requires MMP-9 mediated release of kit-ligand.", "journal": "Cell", "date": "2002", "authors": "Heissig B, Hattori K, Dias S, Friedrich M, Ferris B, Hackett NR, Crystal RG, Besmer P, Lyden D, Moore MA, Werb Z, Rafii S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "12062105", "url": "https://glygen.org/publication/PubMed/12062105" } ] }, { "title": "Genomic organization and restricted expression of the human Mona/Gads gene suggests regulation by two specific promoters.", "journal": "Gene", "date": "2002", "authors": "Guyot B, Arnaud S, Phothirath P, Bourette R P, Grasset M-F, Rigal D, Mouchiroud G", "evidence": [ { "database": "UniProtKB", "id": "O75791", "url": "https://www.uniprot.org/uniprot/O75791" } ], "reference": [ { "type": "PubMed", "id": "12062812", "url": "https://glygen.org/publication/PubMed/12062812" } ] }, { "title": "Shb links SLP-76 and Vav with the CD3 complex in Jurkat T cells.", "journal": "Eur. J. Biochem.", "date": "2002", "authors": "Lindholm Cecilia K, Henriksson Maria L, Hallberg Bengt, Welsh Michael", "evidence": [ { "database": "UniProtKB", "id": "O75791", "url": "https://www.uniprot.org/uniprot/O75791" } ], "reference": [ { "type": "PubMed", "id": "12084069", "url": "https://glygen.org/publication/PubMed/12084069" } ] }, { "title": "Fer kinase is required for sustained p38 kinase activation and maximal chemotaxis of activated mast cells.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Craig AW, Greer PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "12192036", "url": "https://glygen.org/publication/PubMed/12192036" } ] }, { "title": "Molecular cloning of a novel gene encoding a membrane-associated adaptor protein (LAX) in lymphocyte signaling.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Zhu M, Janssen E, Leung K, Zhang W", "evidence": [ { "database": "UniProtKB", "id": "O75791", "url": "https://www.uniprot.org/uniprot/O75791" } ], "reference": [ { "type": "PubMed", "id": "12359715", "url": "https://glygen.org/publication/PubMed/12359715" } ] }, { "title": "Phospholipase C gamma 2 is essential for specific functions of Fc epsilon R and Fc gamma R.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2002", "authors": "Wen R, Jou ST, Chen Y, Hoffmeyer A, Wang D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2424491", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2424491" } ], "reference": [ { "type": "PubMed", "id": "12471105", "url": "https://glygen.org/publication/PubMed/12471105" } ] }, { "title": "Upstream open reading frames regulate translation of Mona/Gads adapter mRNA in the megakaryocytic lineage.", "journal": "Platelets", "date": "2002", "authors": "Guyot B, Arnaud S, Phothirath P, Rigal D, Mouchiroud G", "evidence": [ { "database": "RefSeq", "id": "NP_001278753", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278753" } ], "reference": [ { "type": "PubMed", "id": "12487779", "url": "https://glygen.org/publication/PubMed/12487779" } ] }, { "title": "Profiling of tyrosine phosphorylation pathways in human cells using mass spectrometry.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Salomon AR, Ficarro SB, Brill LM, Brinker A, Phung QT, Ericson C, Sauer K, Brock A, Horn DM, Schultz PG, Peters EC", "evidence": [ { "database": "UniProtKB", "id": "O75791", "url": "https://www.uniprot.org/uniprot/O75791" }, { "database": "iPTMnet", "id": "O75791-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75791-1" } ], "reference": [ { "type": "PubMed", "id": "12522270", "url": "https://glygen.org/publication/PubMed/12522270" } ] }, { "title": "Identification of phosphorylation sites within the SH3 domains of Tec family tyrosine kinases.", "journal": "Biochimica et biophysica acta", "date": "2003", "authors": "Nore BF, Mattsson PT, Antonsson P, Backesjo CM, Westlund A, Lennartsson J, Hansson H, Low P, Ronnstrand L, Smith CI", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "12573241", "url": "https://glygen.org/publication/PubMed/12573241" } ] }, { "title": "The role of PI3K in immune cells.", "journal": "Nature immunology", "date": "2003", "authors": "Koyasu S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "12660731", "url": "https://glygen.org/publication/PubMed/12660731" } ] }, { "title": "Vav1: a key signal transducer downstream of the TCR.", "journal": "Immunological reviews", "date": "2003", "authors": "Tybulewicz VL, Ardouin L, Prisco A, Reynolds LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "12670394", "url": "https://glygen.org/publication/PubMed/12670394" } ] }, { "title": "Structure of a c-kit product complex reveals the basis for kinase transactivation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Mol CD, Lim KB, Sridhar V, Zou H, Chien EY, Sang BC, Nowakowski J, Kassel DB, Cronin CN, McRee DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "12824176", "url": "https://glygen.org/publication/PubMed/12824176" } ] }, { "title": "Identification of Tyr900 in the kinase domain of c-Kit as a Src-dependent phosphorylation site mediating interaction with c-Crk.", "journal": "Experimental cell research", "date": "2003", "authors": "Lennartsson J, Wernstedt C, Engstrom U, Hellman U, Ronnstrand L", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "12878163", "url": "https://glygen.org/publication/PubMed/12878163" } ] }, { "title": "The inositol 5'-phosphatase SHIP-1 and the Src kinase Lyn negatively regulate macrophage colony-stimulating factor-induced Akt activity.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Baran CP, Tridandapani S, Helgason CD, Humphries RK, Krystal G, Marsh CB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9680350", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350" } ], "reference": [ { "type": "PubMed", "id": "12882960", "url": "https://glygen.org/publication/PubMed/12882960" } ] }, { "title": "Regulation of EGF-induced phospholipase C-gamma1 translocation and activation by its SH2 and PH domains.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2003", "authors": "Wang Y, Wang Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-2424491", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2424491" } ], "reference": [ { "type": "PubMed", "id": "12911816", "url": "https://glygen.org/publication/PubMed/12911816" } ] }, { "title": "Transcriptional regulation by calcium, calcineurin, and NFAT.", "journal": "Genes & development", "date": "2003", "authors": "Hogan PG, Chen L, Nardone J, Rao A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "12975316", "url": "https://glygen.org/publication/PubMed/12975316" } ] }, { "title": "Macrophage colony stimulating factor activates phosphatidylcholine hydrolysis by cytoplasmic phospholipase A2.", "journal": "The EMBO journal", "date": "1992", "authors": "Nakamura T, Lin LL, Kharbanda S, Knopf J, Kufe D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9680350", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350" } ], "reference": [ { "type": "PubMed", "id": "1334462", "url": "https://glygen.org/publication/PubMed/1334462" } ] }, { "title": "p21ras activation via hemopoietin receptors and c-kit requires tyrosine kinase activity but not tyrosine phosphorylation of p21ras GTPase-activating protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1992", "authors": "Duronio V, Welham MJ, Abraham S, Dryden P, Schrader JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "1371879", "url": "https://glygen.org/publication/PubMed/1371879" } ] }, { "title": "A recombinant ectodomain of the receptor for the stem cell factor (SCF) retains ligand-induced receptor dimerization and antagonizes SCF-stimulated cellular responses.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Lev S, Yarden Y, Givol D", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "1375232", "url": "https://glygen.org/publication/PubMed/1375232" } ] }, { "title": "Steel factor stimulates the tyrosine phosphorylation of the proto-oncogene product, p95vav, in human hemopoietic cells.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Alai M, Mui AL, Cutler RL, Bustelo XR, Barbacid M, Krystal G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "1381360", "url": "https://glygen.org/publication/PubMed/1381360" } ] }, { "title": "Hematopoietic adaptors in T-cell signaling: potential applications to transplantation.", "journal": "American journal of transplantation : official journal of the American Society of Transplantation and the American Society of Transplant Surgeons", "date": "2003", "authors": "Rudd CE, Wang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "14510693", "url": "https://glygen.org/publication/PubMed/14510693" } ] }, { "title": "FLT3 receptors with internal tandem duplications promote cell viability and proliferation by signaling through Foxo proteins.", "journal": "Oncogene", "date": "2004", "authors": "Scheijen B, Ngo HT, Kang H, Griffin JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "14981546", "url": "https://glygen.org/publication/PubMed/14981546" } ] }, { "title": "Autophosphorylation of JAK2 on tyrosines 221 and 570 regulates its activity.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Argetsinger LS, Kouadio JL, Steen H, Stensballe A, Jensen ON, Carter-Su C", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "15143187", "url": "https://glygen.org/publication/PubMed/15143187" } ] }, { "title": "Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.", "journal": "Analytical chemistry", "date": "2004", "authors": "Brill LM, Salomon AR, Ficarro SB, Mukherji M, Stettler-Gill M, Peters EC", "evidence": [ { "database": "UniProtKB", "id": "O75791", "url": "https://www.uniprot.org/uniprot/O75791" }, { "database": "iPTMnet", "id": "O75791-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75791-1" } ], "reference": [ { "type": "PubMed", "id": "15144186", "url": "https://glygen.org/publication/PubMed/15144186" } ] }, { "title": "Tec kinases mediate sustained calcium influx via site-specific tyrosine phosphorylation of the phospholipase Cgamma Src homology 2-Src homology 3 linker.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Humphries LA, Dangelmaier C, Sommer K, Kipp K, Kato RM, Griffith N, Bakman I, Turk CW, Daniel JL, Rawlings DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2424491", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2424491" } ], "reference": [ { "type": "PubMed", "id": "15184383", "url": "https://glygen.org/publication/PubMed/15184383" } ] }, { "title": "Differential requirements for Vav proteins in DAP10- and ITAM-mediated NK cell cytotoxicity.", "journal": "The Journal of experimental medicine", "date": "2004", "authors": "Cella M, Fujikawa K, Tassi I, Kim S, Latinis K, Nishi S, Yokoyama W, Colonna M, Swat W", "evidence": [ { "database": "Reactome", "id": "R-HSA-2424491", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2424491" } ], "reference": [ { "type": "PubMed", "id": "15365099", "url": "https://glygen.org/publication/PubMed/15365099" } ] }, { "title": "Signal transduction via the stem cell factor receptor/c-Kit.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2004", "authors": "Ronnstrand L", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "15526160", "url": "https://glygen.org/publication/PubMed/15526160" } ] }, { "title": "Molecular basis for a direct interaction between the Syk protein-tyrosine kinase and phosphoinositide 3-kinase.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Moon KD, Post CB, Durden DL, Zhou Q, De P, Harrison ML, Geahlen RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2424491", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2424491" } ], "reference": [ { "type": "PubMed", "id": "15536084", "url": "https://glygen.org/publication/PubMed/15536084" } ] }, { "title": "PAK and other Rho-associated kinases--effectors with surprisingly diverse mechanisms of regulation.", "journal": "The Biochemical journal", "date": "2005", "authors": "Zhao ZS, Manser E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "15548136", "url": "https://glygen.org/publication/PubMed/15548136" } ] }, { "title": "Signaling by Kit protein-tyrosine kinase--the stem cell factor receptor.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Roskoski R Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "16129412", "url": "https://glygen.org/publication/PubMed/16129412" } ] }, { "title": "Constitutive activation of Akt by Flt3 internal tandem duplications is necessary for increased survival, proliferation, and myeloid transformation.", "journal": "Cancer research", "date": "2005", "authors": "Brandts CH, Sargin B, Rode M, Biermann C, Lindtner B, Schwable J, Buerger H, Muller-Tidow C, Choudhary C, McMahon M, Berdel WE, Serve H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "16266983", "url": "https://glygen.org/publication/PubMed/16266983" } ] }, { "title": "Stem cell factor and its receptor c-Kit as targets for inflammatory diseases.", "journal": "European journal of pharmacology", "date": "2006", "authors": "Reber L, Da Silva CA, Frossard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "16483568", "url": "https://glygen.org/publication/PubMed/16483568" } ] }, { "title": "Identification of Y589 and Y599 in the juxtamembrane domain of Flt3 as ligand-induced autophosphorylation sites involved in binding of Src family kinases and the protein tyrosine phosphatase SHP2.", "journal": "Blood", "date": "2006", "authors": "Heiss E, Masson K, Sundberg C, Pedersen M, Sun J, Bengtsson S, Ronnstrand L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "16684964", "url": "https://glygen.org/publication/PubMed/16684964" } ] }, { "title": "Signalling and functional diversity within the Axl subfamily of receptor tyrosine kinases.", "journal": "Cytokine & growth factor reviews", "date": "2006", "authors": "Hafizi S, Dahlback B", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "16737840", "url": "https://glygen.org/publication/PubMed/16737840" } ] }, { "title": "Grb2 and Gads exhibit different interactions with CD28 and play distinct roles in CD28-mediated costimulation.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2006", "authors": "Watanabe R, Harada Y, Takeda K, Takahashi J, Ohnuki K, Ogawa S, Ohgai D, Kaibara N, Koiwai O, Tanabe K, Toma H, Sugamura K, Abe R", "evidence": [ { "database": "Reactome", "id": "R-HSA-389356", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389356" } ], "reference": [ { "type": "PubMed", "id": "16818765", "url": "https://glygen.org/publication/PubMed/16818765" } ] }, { "title": "The scaffolding adapter Gab2, via Shp-2, regulates kit-evoked mast cell proliferation by activating the Rac/JNK pathway.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Yu M, Luo J, Yang W, Wang Y, Mizuki M, Kanakura Y, Besmer P, Neel BG, Gu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "16873377", "url": "https://glygen.org/publication/PubMed/16873377" } ] }, { "title": "Evidence of LAT as a dual substrate for Lck and Syk in T lymphocytes.", "journal": "Leukemia research", "date": "2007", "authors": "Jiang Y, Cheng H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2424491", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2424491" } ], "reference": [ { "type": "PubMed", "id": "16938345", "url": "https://glygen.org/publication/PubMed/16938345" } ] }, { "title": "Comparative analysis of signaling pathways between mast cell growth factor (c-kit ligand) and granulocyte-macrophage colony-stimulating factor in a human factor-dependent myeloid cell line involves phosphorylation of Raf-1, GTPase-activating protein and mitogen-activated protein kinase.", "journal": "Experimental hematology", "date": "1991", "authors": "Miyazawa K, Hendrie PC, Mantel C, Wood K, Ashman LK, Broxmeyer HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "1721591", "url": "https://glygen.org/publication/PubMed/1721591" } ] }, { "title": "Cdk-inhibitory activity and stability of p27Kip1 are directly regulated by oncogenic tyrosine kinases.", "journal": "Cell", "date": "2007", "authors": "Grimmler M, Wang Y, Mund T, Cilensek Z, Keidel EM, Waddell MB, Jakel H, Kullmann M, Kriwacki RW, Hengst L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "17254966", "url": "https://glygen.org/publication/PubMed/17254966" } ] }, { "title": "Structural basis for stem cell factor-KIT signaling and activation of class III receptor tyrosine kinases.", "journal": "The EMBO journal", "date": "2007", "authors": "Liu H, Chen X, Focia PJ, He X", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "17255936", "url": "https://glygen.org/publication/PubMed/17255936" } ] }, { "title": "Different ADAMs have distinct influences on Kit ligand processing: phorbol-ester-stimulated ectodomain shedding of Kitl1 by ADAM17 is reduced by ADAM19.", "journal": "Journal of cell science", "date": "2007", "authors": "Kawaguchi N, Horiuchi K, Becherer JD, Toyama Y, Besmer P, Blobel CP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "17344430", "url": "https://glygen.org/publication/PubMed/17344430" } ] }, { "title": "Structure of the calcineurin-NFAT complex: defining a T cell activation switch using solution NMR and crystal coordinates.", "journal": "Structure (London, England : 1993)", "date": "2007", "authors": "Takeuchi K, Roehrl MH, Sun ZY, Wagner G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "17502104", "url": "https://glygen.org/publication/PubMed/17502104" } ] }, { "title": "GEFs and GAPs: critical elements in the control of small G proteins.", "journal": "Cell", "date": "2007", "authors": "Bos JL, Rehmann H, Wittinghofer A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "17540168", "url": "https://glygen.org/publication/PubMed/17540168" } ] }, { "title": "Keeping the (kinase) party going: SLP-76 and ITK dance to the beat.", "journal": "Science's STKE : signal transduction knowledge environment", "date": "2007", "authors": "Qi Q, August A", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "17652306", "url": "https://glygen.org/publication/PubMed/17652306" } ] }, { "title": "Structural basis for activation of the receptor tyrosine kinase KIT by stem cell factor.", "journal": "Cell", "date": "2007", "authors": "Yuzawa S, Opatowsky Y, Zhang Z, Mandiyan V, Lax I, Schlessinger J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "17662946", "url": "https://glygen.org/publication/PubMed/17662946" } ] }, { "title": "Phosphoproteome of resting human platelets.", "journal": "Journal of proteome research", "date": "2008", "authors": "Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A", "evidence": [ { "database": "UniProtKB", "id": "O75791", "url": "https://www.uniprot.org/uniprot/O75791" }, { "database": "iPTMnet", "id": "O75791-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75791-1" } ], "reference": [ { "type": "PubMed", "id": "18088087", "url": "https://glygen.org/publication/PubMed/18088087" } ] }, { "title": "The secondary structure of calcineurin regulatory region and conformational change induced by calcium/calmodulin binding.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Shen X, Li H, Ou Y, Tao W, Dong A, Kong J, Ji C, Yu S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "18296442", "url": "https://glygen.org/publication/PubMed/18296442" } ] }, { "title": "A brief introduction to FOXOlogy.", "journal": "Oncogene", "date": "2008", "authors": "Burgering BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "18391968", "url": "https://glygen.org/publication/PubMed/18391968" } ] }, { "title": "Discovery of a cytokine and its receptor by functional screening of the extracellular proteome.", "journal": "Science (New York, N.Y.)", "date": "2008", "authors": "Lin H, Lee E, Hestir K, Leo C, Huang M, Bosch E, Halenbeck R, Wu G, Zhou A, Behrens D, Hollenbaugh D, Linnemann T, Qin M, Wong J, Chu K, Doberstein SK, Williams LT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9680350", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350" } ], "reference": [ { "type": "PubMed", "id": "18467591", "url": "https://glygen.org/publication/PubMed/18467591" } ] }, { "title": "DAP12 couples c-Fms activation to the osteoclast cytoskeleton by recruitment of Syk.", "journal": "Molecular cell", "date": "2008", "authors": "Zou W, Reeve JL, Liu Y, Teitelbaum SL, Ross FP", "evidence": [ { "database": "Reactome", "id": "R-HSA-2424491", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2424491" } ], "reference": [ { "type": "PubMed", "id": "18691974", "url": "https://glygen.org/publication/PubMed/18691974" } ] }, { "title": "Gab2 is involved in differential phosphoinositide 3-kinase signaling by two splice forms of c-Kit.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Sun J, Pedersen M, Ronnstrand L", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "18697750", "url": "https://glygen.org/publication/PubMed/18697750" } ] }, { "title": "Age-dependent FOXO regulation of p27Kip1 expression via a conserved binding motif in rat muscle precursor cells.", "journal": "American journal of physiology. Cell physiology", "date": "2008", "authors": "Lees SJ, Childs TE, Booth FW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "18787071", "url": "https://glygen.org/publication/PubMed/18787071" } ] }, { "title": "BH3-only protein Bim more critical than Puma in tyrosine kinase inhibitor-induced apoptosis of human leukemic cells and transduced hematopoietic progenitors carrying oncogenic FLT3.", "journal": "Blood", "date": "2009", "authors": "Nordigarden A, Kraft M, Eliasson P, Labi V, Lam EW, Villunger A, Jonsson JI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "19064725", "url": "https://glygen.org/publication/PubMed/19064725" } ] }, { "title": "p27Kip1 inhibits cyclin D-cyclin-dependent kinase 4 by two independent modes.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Ray A, James MK, Larochelle S, Fisher RP, Blain SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "19075005", "url": "https://glygen.org/publication/PubMed/19075005" } ] }, { "title": "p21-activated kinase regulates mast cell degranulation via effects on calcium mobilization and cytoskeletal dynamics.", "journal": "Blood", "date": "2009", "authors": "Allen JD, Jaffer ZM, Park SJ, Burgin S, Hofmann C, Sells MA, Chen S, Derr-Yellin E, Michels EG, McDaniel A, Bessler WK, Ingram DA, Atkinson SJ, Travers JB, Chernoff J, Clapp DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "19124833", "url": "https://glygen.org/publication/PubMed/19124833" } ] }, { "title": "A role of Gab2 association in Flt3 ITD mediated Stat5 phosphorylation and cell survival.", "journal": "British journal of haematology", "date": "2009", "authors": "Masson K, Liu T, Khan R, Sun J, Ronnstrand L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "19438505", "url": "https://glygen.org/publication/PubMed/19438505" } ] }, { "title": "Oncogenic Flt3 receptors display different specificity and kinetics of autophosphorylation.", "journal": "Experimental hematology", "date": "2009", "authors": "Razumovskaya E, Masson K, Khan R, Bengtsson S, Ronnstrand L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "19477218", "url": "https://glygen.org/publication/PubMed/19477218" } ] }, { "title": "Dissecting activation of the PAK1 kinase at protrusions in living cells.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Parrini MC, Camonis J, Matsuda M, de Gunzburg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "19574218", "url": "https://glygen.org/publication/PubMed/19574218" } ] }, { "title": "SLP-76 couples Syk to the osteoclast cytoskeleton.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2009", "authors": "Reeve JL, Zou W, Liu Y, Maltzman JS, Ross FP, Teitelbaum SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2424491", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2424491" } ], "reference": [ { "type": "PubMed", "id": "19592646", "url": "https://glygen.org/publication/PubMed/19592646" } ] }, { "title": "Lysine acetylation targets protein complexes and co-regulates major cellular functions.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O75791", "url": "https://www.uniprot.org/uniprot/O75791" } ], "reference": [ { "type": "PubMed", "id": "19608861", "url": "https://glygen.org/publication/PubMed/19608861" } ] }, { "title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.", "journal": "Science signaling", "date": "2009", "authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK", "evidence": [ { "database": "UniProtKB", "id": "O75791", "url": "https://www.uniprot.org/uniprot/O75791" }, { "database": "iPTMnet", "id": "O75791", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75791" } ], "reference": [ { "type": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" } ] }, { "title": "A frequent kinase domain mutation that changes the interaction between PI3Kalpha and the membrane.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Mandelker D, Gabelli SB, Schmidt-Kittler O, Zhu J, Cheong I, Huang CH, Kinzler KW, Vogelstein B, Amzel LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "19805105", "url": "https://glygen.org/publication/PubMed/19805105" } ] }, { "title": "Adapters in the organization of mast cell signaling.", "journal": "Immunological reviews", "date": "2009", "authors": "Alvarez-Errico D, Lessmann E, Rivera J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "19909365", "url": "https://glygen.org/publication/PubMed/19909365" } ] }, { "title": "Tyrosines 868, 966, and 972 in the kinase domain of JAK2 are autophosphorylated and required for maximal JAK2 kinase activity.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2010", "authors": "Argetsinger LS, Stuckey JA, Robertson SA, Koleva RI, Cline JM, Marto JA, Myers MG Jr, Carter-Su C", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "20304997", "url": "https://glygen.org/publication/PubMed/20304997" } ] }, { "title": "TREM2- and DAP12-dependent activation of PI3K requires DAP10 and is inhibited by SHIP1.", "journal": "Science signaling", "date": "2010", "authors": "Peng Q, Malhotra S, Torchia JA, Kerr WG, Coggeshall KM, Humphrey MB", "evidence": [ { "database": "Reactome", "id": "R-HSA-2424491", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2424491" } ], "reference": [ { "type": "PubMed", "id": "20484116", "url": "https://glygen.org/publication/PubMed/20484116" } ] }, { "title": "IL-34 and M-CSF share the receptor Fms but are not identical in biological activity and signal activation.", "journal": "Cell death and differentiation", "date": "2010", "authors": "Chihara T, Suzu S, Hassan R, Chutiwitoonchai N, Hiyoshi M, Motoyoshi K, Kimura F, Okada S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9680350", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350" } ], "reference": [ { "type": "PubMed", "id": "20489731", "url": "https://glygen.org/publication/PubMed/20489731" } ] }, { "title": "Profiling Y561-dependent and -independent substrates of CSF-1R in epithelial cells.", "journal": "PloS one", "date": "2010", "authors": "Knowlton ML, Selfors LM, Wrobel CN, Gu TL, Ballif BA, Gygi SP, Polakiewicz R, Brugge JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9680350", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350" } ], "reference": [ { "type": "PubMed", "id": "21049007", "url": "https://glygen.org/publication/PubMed/21049007" } ] }, { "title": "Histidine domain-protein tyrosine phosphatase interacts with Grb2 and GrpL.", "journal": "PLoS ONE", "date": "2010", "authors": "Tanase Carmen-Alexandra", "evidence": [ { "database": "UniProtKB", "id": "O75791", "url": "https://www.uniprot.org/uniprot/O75791" } ], "reference": [ { "type": "PubMed", "id": "21179510", "url": "https://glygen.org/publication/PubMed/21179510" } ] }, { "title": "Structural insights into the extracellular assembly of the hematopoietic Flt3 signaling complex.", "journal": "Blood", "date": "2011", "authors": "Verstraete K, Vandriessche G, Januar M, Elegheert J, Shkumatov AV, Desfosses A, Van Craenenbroeck K, Svergun DI, Gutsche I, Vergauwen B, Savvides SN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "21389326", "url": "https://glygen.org/publication/PubMed/21389326" } ] }, { "title": "Btk is a positive regulator in the TREM-1/DAP12 signaling pathway.", "journal": "Blood", "date": "2011", "authors": "Ormsby T, Schlecker E, Ferdin J, Tessarz AS, Angelisova P, Koprulu AD, Borte M, Warnatz K, Schulze I, Ellmeier W, Horejsi V, Cerwenka A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2424491", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2424491" } ], "reference": [ { "type": "PubMed", "id": "21659545", "url": "https://glygen.org/publication/PubMed/21659545" } ] }, { "title": "Dynamics of the phosphoinositide 3-kinase p110delta interaction with p85alpha and membranes reveals aspects of regulation distinct from p110alpha.", "journal": "Structure (London, England : 1993)", "date": "2011", "authors": "Burke JE, Vadas O, Berndt A, Finegan T, Perisic O, Williams RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "21827948", "url": "https://glygen.org/publication/PubMed/21827948" } ] }, { "title": "Colony-stimulating factor 1 activates protein kinase C in human monocytes.", "journal": "The EMBO journal", "date": "1990", "authors": "Imamura K, Dianoux A, Nakamura T, Kufe D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9680350", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350" } ], "reference": [ { "type": "PubMed", "id": "2196173", "url": "https://glygen.org/publication/PubMed/2196173" } ] }, { "title": "Extracellular complexes of the hematopoietic human and mouse CSF-1 receptor are driven by common assembly principles.", "journal": "Structure (London, England : 1993)", "date": "2011", "authors": "Elegheert J, Desfosses A, Shkumatov AV, Wu X, Bracke N, Verstraete K, Van Craenenbroeck K, Brooks BR, Svergun DI, Vergauwen B, Gutsche I, Savvides SN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9680350", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350" } ], "reference": [ { "type": "PubMed", "id": "22153499", "url": "https://glygen.org/publication/PubMed/22153499" } ] }, { "title": "Structural basis for the dual recognition of helical cytokines IL-34 and CSF-1 by CSF-1R.", "journal": "Structure (London, England : 1993)", "date": "2012", "authors": "Ma X, Lin WY, Chen Y, Stawicki S, Mukhyala K, Wu Y, Martin F, Bazan JF, Starovasnik MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9680350", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350" } ], "reference": [ { "type": "PubMed", "id": "22483114", "url": "https://glygen.org/publication/PubMed/22483114" } ] }, { "title": "Direct binding of Grb2 has an important role in the development of myeloproliferative disease induced by ETV6/FLT3.", "journal": "Leukemia", "date": "2013", "authors": "Chonabayashi K, Hishizawa M, Kawamata S, Nagai Y, Ohno T, Ishikawa T, Uchiyama T, Takaori-Kondo A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "23168613", "url": "https://glygen.org/publication/PubMed/23168613" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "O75791", "url": "https://www.uniprot.org/uniprot/O75791" }, { "database": "iPTMnet", "id": "O75791", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75791" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "FLT3 signals via the adapter protein Grb10 and overexpression of Grb10 leads to aberrant cell proliferation in acute myeloid leukemia.", "journal": "Molecular oncology", "date": "2013", "authors": "Kazi JU, Ronnstrand L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "23246379", "url": "https://glygen.org/publication/PubMed/23246379" } ] }, { "title": "Stimulation of phospholipase C-gamma 1 membrane association by epidermal growth factor.", "journal": "Science (New York, N.Y.)", "date": "1990", "authors": "Todderud G, Wahl MI, Rhee SG, Carpenter G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2424491", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2424491" } ], "reference": [ { "type": "PubMed", "id": "2374928", "url": "https://glygen.org/publication/PubMed/2374928" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "UniProtKB", "id": "O75791", "url": "https://www.uniprot.org/uniprot/O75791" }, { "database": "iPTMnet", "id": "O75791", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75791" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "CSF-1 receptor signaling in myeloid cells.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2014", "authors": "Stanley ER, Chitu V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9680350", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350" } ], "reference": [ { "type": "PubMed", "id": "24890514", "url": "https://glygen.org/publication/PubMed/24890514" } ] }, { "title": "Modulation of TCR responsiveness by the Grb2-family adaptor, Gads.", "journal": "Cellular signalling", "date": "2015", "authors": "Lugassy J, Corso J, Beach D, Petrik T, Oellerich T, Urlaub H, Yablonski D", "evidence": [ { "database": "iPTMnet", "id": "O75791", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75791" } ], "reference": [ { "type": "PubMed", "id": "25452106", "url": "https://glygen.org/publication/PubMed/25452106" } ] }, { "title": "The PRKAA1/AMPKalpha1 pathway triggers autophagy during CSF1-induced human monocyte differentiation and is a potential target in CMML.", "journal": "Autophagy", "date": "2015", "authors": "Obba S, Hizir Z, Boyer L, Selimoglu-Buet D, Pfeifer A, Michel G, Hamouda MA, Goncalves D, Cerezo M, Marchetti S, Rocchi S, Droin N, Cluzeau T, Robert G, Luciano F, Robaye B, Foretz M, Viollet B, Legros L, Solary E, Auberger P, Jacquel A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9680350", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350" } ], "reference": [ { "type": "PubMed", "id": "26029847", "url": "https://glygen.org/publication/PubMed/26029847" } ] }, { "title": "Structure and Assembly Mechanism of the Signaling Complex Mediated by Human CSF-1.", "journal": "Structure (London, England : 1993)", "date": "2015", "authors": "Felix J, De Munck S, Verstraete K, Meuris L, Callewaert N, Elegheert J, Savvides SN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9680350", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350" } ], "reference": [ { "type": "PubMed", "id": "26235028", "url": "https://glygen.org/publication/PubMed/26235028" } ] }, { "title": "Expression of GADS enhances FLT3-induced mitogenic signaling.", "journal": "Oncotarget", "date": "2016", "authors": "Chougule RA, Cordero E, Moharram SA, Pietras K, Ronnstrand L, Kazi JU", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "26895103", "url": "https://glygen.org/publication/PubMed/26895103" } ] }, { "title": "Receptor tyrosine kinase (c-Kit) inhibitors: a potential therapeutic target in cancer cells.", "journal": "Drug design, development and therapy", "date": "2016", "authors": "Abbaspour Babaei M, Kamalidehghan B, Saleem M, Huri HZ, Ahmadipour F", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "27536065", "url": "https://glygen.org/publication/PubMed/27536065" } ] }, { "title": "FLT3 and FLT3-ITD phosphorylate and inactivate the cyclin-dependent kinase inhibitor p27(Kip1) in acute myeloid leukemia.", "journal": "Haematologica", "date": "2017", "authors": "Peschel I, Podmirseg SR, Taschler M, Duyster J, Gotze KS, Sill H, Nachbaur D, Jakel H, Hengst L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "28522571", "url": "https://glygen.org/publication/PubMed/28522571" } ] }, { "title": "FLT3 Inhibitors in Acute Myeloid Leukemia: Current Status and Future Directions.", "journal": "Molecular cancer therapeutics", "date": "2017", "authors": "Larrosa-Garcia M, Baer MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "28576946", "url": "https://glygen.org/publication/PubMed/28576946" } ] }, { "title": "Molecular targeting in acute myeloid leukemia.", "journal": "Journal of translational medicine", "date": "2017", "authors": "Lim SH, Dubielecka PM, Raghunathan VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "28851395", "url": "https://glygen.org/publication/PubMed/28851395" } ] }, { "title": "FoxO transcription factors in cancer metabolism.", "journal": "Seminars in cancer biology", "date": "2018", "authors": "Yadav RK, Chauhan AS, Zhuang L, Gan B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "29309929", "url": "https://glygen.org/publication/PubMed/29309929" } ] }, { "title": "The role of small molecule Kit protein-tyrosine kinase inhibitors in the treatment of neoplastic disorders.", "journal": "Pharmacological research", "date": "2018", "authors": "Roskoski R Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "29704617", "url": "https://glygen.org/publication/PubMed/29704617" } ] }, { "title": "Structural and clinical consequences of activation loop mutations in class III receptor tyrosine kinases.", "journal": "Pharmacology & therapeutics", "date": "2018", "authors": "Klug LR, Kent JD, Heinrich MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "29964125", "url": "https://glygen.org/publication/PubMed/29964125" } ] }, { "title": "FMS-like Tyrosine Kinase 3/FLT3: From Basic Science to Clinical Implications.", "journal": "Physiological reviews", "date": "2019", "authors": "Kazi JU, Ronnstrand L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "31066629", "url": "https://glygen.org/publication/PubMed/31066629" } ] }, { "title": "Ripretinib (DCC-2618) Is a Switch Control Kinase Inhibitor of a Broad Spectrum of Oncogenic and Drug-Resistant KIT and PDGFRA Variants.", "journal": "Cancer cell", "date": "2019", "authors": "Smith BD, Kaufman MD, Lu WP, Gupta A, Leary CB, Wise SC, Rutkoski TJ, Ahn YM, Al-Ani G, Bulfer SL, Caldwell TM, Chun L, Ensinger CL, Hood MM, McKinley A, Patt WC, Ruiz-Soto R, Su Y, Telikepalli H, Town A, Turner BA, Vogeti L, Vogeti S, Yates K, Janku F, Abdul Razak AR, Rosen O, Heinrich MC, Flynn DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "31085175", "url": "https://glygen.org/publication/PubMed/31085175" } ] }, { "title": "Expression of the Kit and KitA receptor isoforms in human acute myelogenous leukemia.", "journal": "Blood", "date": "1994", "authors": "Piao X, Curtis JE, Minkin S, Minden MD, Bernstein A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "7506952", "url": "https://glygen.org/publication/PubMed/7506952" } ] }, { "title": "Tyrosine residue 719 of the c-kit receptor is essential for binding of the P85 subunit of phosphatidylinositol (PI) 3-kinase and for c-kit-associated PI 3-kinase activity in COS-1 cells.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Serve H, Hsu YC, Besmer P", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "7509796", "url": "https://glygen.org/publication/PubMed/7509796" } ] }, { "title": "Tyrosine phosphorylation and activation of Bruton tyrosine kinase upon Fc epsilon RI cross-linking.", "journal": "Molecular and cellular biology", "date": "1994", "authors": "Kawakami Y, Yao L, Miura T, Tsukada S, Witte ON, Kawakami T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "7518558", "url": "https://glygen.org/publication/PubMed/7518558" } ] }, { "title": "The ubiquitously expressed Syp phosphatase interacts with c-kit and Grb2 in hematopoietic cells.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Tauchi T, Feng GS, Marshall MS, Shen R, Mantel C, Pawson T, Broxmeyer HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "7523381", "url": "https://glygen.org/publication/PubMed/7523381" } ] }, { "title": "Tec kinase associates with c-kit and is tyrosine phosphorylated and activated following stem cell factor binding.", "journal": "Molecular and cellular biology", "date": "1994", "authors": "Tang B, Mano H, Yi T, Ihle JN", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "7526158", "url": "https://glygen.org/publication/PubMed/7526158" } ] }, { "title": "The MATK tyrosine kinase interacts in a specific and SH2-dependent manner with c-Kit.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Jhun BH, Rivnay B, Price D, Avraham H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "7536744", "url": "https://glygen.org/publication/PubMed/7536744" } ] }, { "title": "Wiskott-Aldrich syndrome protein physically associates with Nck through Src homology 3 domains.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "Rivero-Lezcano OM, Marcilla A, Sameshima JH, Robbins KC", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "7565724", "url": "https://glygen.org/publication/PubMed/7565724" } ] }, { "title": "Stimulation of human monocytes with macrophage colony-stimulating factor induces a Grb2-mediated association of the focal adhesion kinase pp125FAK and dynamin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Kharbanda S, Saleem A, Yuan Z, Emoto Y, Prasad KV, Kufe D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9680350", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350" } ], "reference": [ { "type": "PubMed", "id": "7597091", "url": "https://glygen.org/publication/PubMed/7597091" } ] }, { "title": "Soluble c-kit proteins and antireceptor monoclonal antibodies confine the binding site of the stem cell factor.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Blechman JM, Lev S, Brizzi MF, Leitner O, Pegoraro L, Givol D, Yarden Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "7680037", "url": "https://glygen.org/publication/PubMed/7680037" } ] }, { "title": "Activation of Src family kinases by colony stimulating factor-1, and their association with its receptor.", "journal": "The EMBO journal", "date": "1993", "authors": "Courtneidge SA, Dhand R, Pilat D, Twamley GM, Waterfield MD, Roussel MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9680350", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350" } ], "reference": [ { "type": "PubMed", "id": "7681396", "url": "https://glygen.org/publication/PubMed/7681396" } ] }, { "title": "Monocyte colony-stimulating factor stimulates binding of phosphatidylinositol 3-kinase to Grb2.Sos complexes in human monocytes.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Saleem A, Kharbanda S, Yuan ZM, Kufe D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9680350", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350" } ], "reference": [ { "type": "PubMed", "id": "7737969", "url": "https://glygen.org/publication/PubMed/7737969" } ] }, { "title": "MAPKs: new JNK expands the group.", "journal": "Trends in biochemical sciences", "date": "1994", "authors": "Davis RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "7855889", "url": "https://glygen.org/publication/PubMed/7855889" } ] }, { "title": "Activation of stress-activated protein kinase by MEKK1 phosphorylation of its activator SEK1.", "journal": "Nature", "date": "1994", "authors": "Yan M, Dai T, Deak JC, Kyriakis JM, Zon LI, Woodgett JR, Templeton DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "7997270", "url": "https://glygen.org/publication/PubMed/7997270" } ] }, { "title": "Ligand for FLT3/FLK2 receptor tyrosine kinase regulates growth of haematopoietic stem cells and is encoded by variant RNAs.", "journal": "Nature", "date": "1994", "authors": "Hannum C, Culpepper J, Campbell D, McClanahan T, Zurawski S, Bazan JF, Kastelein R, Hudak S, Wagner J, Mattson J, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "8145851", "url": "https://glygen.org/publication/PubMed/8145851" } ] }, { "title": "Identification of the ligand-binding regions in the macrophage colony-stimulating factor receptor extracellular domain.", "journal": "Molecular and cellular biology", "date": "1993", "authors": "Wang ZE, Myles GM, Brandt CS, Lioubin MN, Rohrschneider L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9680350", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350" } ], "reference": [ { "type": "PubMed", "id": "8355686", "url": "https://glygen.org/publication/PubMed/8355686" } ] }, { "title": "Guanine-nucleotide-releasing factor hSos1 binds to Grb2 and links receptor tyrosine kinases to Ras signalling.", "journal": "Nature", "date": "1993", "authors": "Li N, Batzer A, Daly R, Yajnik V, Skolnik E, Chardin P, Bar-Sagi D, Margolis B, Schlessinger J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "8479541", "url": "https://glygen.org/publication/PubMed/8479541" } ] }, { "title": "Human Sos1: a guanine nucleotide exchange factor for Ras that binds to GRB2.", "journal": "Science (New York, N.Y.)", "date": "1993", "authors": "Chardin P, Camonis JH, Gale NW, van Aelst L, Schlessinger J, Wigler MH, Bar-Sagi D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "8493579", "url": "https://glygen.org/publication/PubMed/8493579" } ] }, { "title": "Interactions of CD80 and CD86 with CD28 and CTLA4.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1996", "authors": "Ellis JH, Burden MN, Vinogradov DV, Linge C, Crowe JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-389356", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389356" } ], "reference": [ { "type": "PubMed", "id": "8609386", "url": "https://glygen.org/publication/PubMed/8609386" } ] }, { "title": "JAK2 is associated with the c-kit proto-oncogene product and is phosphorylated in response to stem cell factor.", "journal": "Blood", "date": "1996", "authors": "Weiler SR, Mou S, DeBerry CS, Keller JR, Ruscetti FW, Ferris DK, Longo DL, Linnekin D", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "8611693", "url": "https://glygen.org/publication/PubMed/8611693" } ] }, { "title": "Activation of BTK by a phosphorylation mechanism initiated by SRC family kinases.", "journal": "Science (New York, N.Y.)", "date": "1996", "authors": "Rawlings DJ, Scharenberg AM, Park H, Wahl MI, Lin S, Kato RM, Fluckiger AC, Witte ON, Kinet JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "8629002", "url": "https://glygen.org/publication/PubMed/8629002" } ] }, { "title": "Regulation of Btk function by a major autophosphorylation site within the SH3 domain.", "journal": "Immunity", "date": "1996", "authors": "Park H, Wahl MI, Afar DE, Turck CW, Rawlings DJ, Tam C, Scharenberg AM, Kinet JP, Witte ON", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "8630736", "url": "https://glygen.org/publication/PubMed/8630736" } ] }, { "title": "Calcineurin binds the transcription factor NFAT1 and reversibly regulates its activity.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Loh C, Shaw KT, Carew J, Viola JP, Luo C, Perrino BA, Rao A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "8631904", "url": "https://glygen.org/publication/PubMed/8631904" } ] }, { "title": "Human stem cell factor dimer forms a complex with two molecules of the extracellular domain of its receptor, Kit.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Philo JS, Wen J, Wypych J, Schwartz MG, Mendiaz EA, Langley KE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "8636116", "url": "https://glygen.org/publication/PubMed/8636116" } ] }, { "title": "Grap is a novel SH3-SH2-SH3 adaptor protein that couples tyrosine kinases to the Ras pathway.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Feng GS, Ouyang YB, Hu DP, Shi ZQ, Gentz R, Ni J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "8647802", "url": "https://glygen.org/publication/PubMed/8647802" } ] }, { "title": "Differential recognition by CD28 of its cognate counter receptors CD80 (B7.1) and B70 (B7.2): analysis by site directed mutagenesis.", "journal": "Molecular immunology", "date": "1996", "authors": "Truneh A, Reddy M, Ryan P, Lyn SD, Eichman C, Couez D, Hurle MR, Sekaly RP, Olive D, Sweet R", "evidence": [ { "database": "Reactome", "id": "R-HSA-389356", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389356" } ], "reference": [ { "type": "PubMed", "id": "8649453", "url": "https://glygen.org/publication/PubMed/8649453" } ] }, { "title": "Syk-dependent phosphorylation of Shc. A potential link between FcepsilonRI and the Ras/mitogen-activated protein kinase signaling pathway through SOS and Grb2.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Jabril-Cuenod B, Zhang C, Scharenberg AM, Paolini R, Numerof R, Beaven MA, Kinet JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-2424491", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2424491" } ], "reference": [ { "type": "PubMed", "id": "8663278", "url": "https://glygen.org/publication/PubMed/8663278" } ] }, { "title": "Vav and SLP-76 interact and functionally cooperate in IL-2 gene activation.", "journal": "Immunity", "date": "1996", "authors": "Wu J, Motto DG, Koretzky GA, Weiss A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "8673706", "url": "https://glygen.org/publication/PubMed/8673706" } ] }, { "title": "Structure-function relationships of stem cell factor: an analysis based on a series of human-murine stem cell factor chimera and the mapping of a neutralizing monoclonal antibody.", "journal": "Blood", "date": "1996", "authors": "Matous JV, Langley K, Kaushansky K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "8695790", "url": "https://glygen.org/publication/PubMed/8695790" } ] }, { "title": "Phosphorylation of SLP-76 by the ZAP-70 protein-tyrosine kinase is required for T-cell receptor function.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Bubeck Wardenburg J, Fu C, Jackman JK, Flotow H, Wilkinson SE, Williams DH, Johnson R, Kong G, Chan AC, Findell PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2424491", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2424491" } ], "reference": [ { "type": "PubMed", "id": "8702662", "url": "https://glygen.org/publication/PubMed/8702662" } ] }, { "title": "Epitope mapping and immunoneutralization of recombinant human stem-cell factor.", "journal": "European journal of biochemistry", "date": "1996", "authors": "Mendiaz EA, Chang DG, Boone TC, Grant JR, Wypych J, Aguero B, Egrie JC, Langley KE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "8774734", "url": "https://glygen.org/publication/PubMed/8774734" } ] }, { "title": "The adaptor protein Nck links receptor tyrosine kinases with the serine-threonine kinase Pak1.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Galisteo ML, Chernoff J, Su YC, Skolnik EY, Schlessinger J", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "8798379", "url": "https://glygen.org/publication/PubMed/8798379" } ] }, { "title": "Interaction of calcineurin with a domain of the transcription factor NFAT1 that controls nuclear import.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Luo C, Shaw KT, Raghavan A, Aramburu J, Garcia-Cozar F, Perrino BA, Hogan PG, Rao A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "8799126", "url": "https://glygen.org/publication/PubMed/8799126" } ] }, { "title": "Interaction of the Nck adapter protein with p21-activated kinase (PAK1).", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Bokoch GM, Wang Y, Bohl BP, Sells MA, Quilliam LA, Knaus UG", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "8824201", "url": "https://glygen.org/publication/PubMed/8824201" } ] }, { "title": "Phosphorylation of each of the distal three tyrosines of the CD28 cytoplasmic tail is required for CD28-induced T cell IL-2 secretion.", "journal": "Tissue antigens", "date": "1996", "authors": "Teng JM, King PD, Sadra A, Liu X, Han A, Selvakumar A, August A, Dupont B", "evidence": [ { "database": "Reactome", "id": "R-HSA-389356", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389356" } ], "reference": [ { "type": "PubMed", "id": "8946678", "url": "https://glygen.org/publication/PubMed/8946678" } ] }, { "title": "Discrete protein interactions with the Grb2/c-Cbl complex in SCF- and TPO-mediated myeloid cell proliferation.", "journal": "Oncogene", "date": "1996", "authors": "Brizzi MF, Dentelli P, Lanfrancone L, Rosso A, Pelicci PG, Pegoraro L", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "8950973", "url": "https://glygen.org/publication/PubMed/8950973" } ] }, { "title": "Growth and differentiation signals regulated by the M-CSF receptor.", "journal": "Molecular reproduction and development", "date": "1997", "authors": "Rohrschneider LR, Bourette RP, Lioubin MN, Algate PA, Myles GM, Carlberg K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9680350", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350" } ], "reference": [ { "type": "PubMed", "id": "8981370", "url": "https://glygen.org/publication/PubMed/8981370" } ] }, { "title": "Functional and physical interactions of Syk family kinases with the Vav proto-oncogene product.", "journal": "Immunity", "date": "1996", "authors": "Deckert M, Tartare-Deckert S, Couture C, Mustelin T, Altman A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2424491", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2424491" } ], "reference": [ { "type": "PubMed", "id": "8986718", "url": "https://glygen.org/publication/PubMed/8986718" } ] }, { "title": "Phosphotyrosine-dependent activation of Rac-1 GDP/GTP exchange by the vav proto-oncogene product.", "journal": "Nature", "date": "1997", "authors": "Crespo P, Schuebel KE, Ostrom AA, Gutkind JS, Bustelo XR", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "8990121", "url": "https://glygen.org/publication/PubMed/8990121" } ] }, { "title": "SLP-76 is a substrate of the high affinity IgE receptor-stimulated protein tyrosine kinases in rat basophilic leukemia cells.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Hendricks-Taylor LR, Motto DG, Zhang J, Siraganian RP, Koretzky GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "8995445", "url": "https://glygen.org/publication/PubMed/8995445" } ] }, { "title": "Direct association of Csk homologous kinase (CHK) with the diphosphorylated site Tyr568/570 of the activated c-KIT in megakaryocytes.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Price DJ, Rivnay B, Fu Y, Jiang S, Avraham S, Avraham H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "9038210", "url": "https://glygen.org/publication/PubMed/9038210" } ] }, { "title": "Kit receptor dimerization is driven by bivalent binding of stem cell factor.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Lemmon MA, Pinchasi D, Zhou M, Lax I, Schlessinger J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "9045650", "url": "https://glygen.org/publication/PubMed/9045650" } ] }, { "title": "Tyrosine phosphorylation of the vav proto-oncogene product links FcepsilonRI to the Rac1-JNK pathway.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Teramoto H, Salem P, Robbins KC, Bustelo XR, Gutkind JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "9099726", "url": "https://glygen.org/publication/PubMed/9099726" } ] }, { "title": "Activation of Jak2 catalytic activity requires phosphorylation of Y1007 in the kinase activation loop.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Feng J, Witthuhn BA, Matsuda T, Kohlhuber F, Kerr IM, Ihle JN", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "9111318", "url": "https://glygen.org/publication/PubMed/9111318" } ] }, { "title": "Molecular cloning of SLAP-130, an SLP-76-associated substrate of the T cell antigen receptor-stimulated protein tyrosine kinases.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Musci MA, Hendricks-Taylor LR, Motto DG, Paskind M, Kamens J, Turck CW, Koretzky GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "9115214", "url": "https://glygen.org/publication/PubMed/9115214" } ] }, { "title": "Shc contains two Grb2 binding sites needed for efficient formation of complexes with SOS in B lymphocytes.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Harmer SL, DeFranco AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "9199344", "url": "https://glygen.org/publication/PubMed/9199344" } ] }, { "title": "Bryostatin 1 (bryo1)-induced monocytic differentiation in THP-1 human leukemia cells is associated with enhanced c-fyn tyrosine kinase and M-CSF receptors.", "journal": "Leukemia research", "date": "1997", "authors": "Li Y, Mohammad RM, al-Katib A, Varterasian ML, Chen B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9680350", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350" } ], "reference": [ { "type": "PubMed", "id": "9225065", "url": "https://glygen.org/publication/PubMed/9225065" } ] }, { "title": "Chymase cleavage of stem cell factor yields a bioactive, soluble product.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Longley BJ, Tyrrell L, Ma Y, Williams DA, Halaban R, Langley K, Lu HS, Schechter NM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "9256427", "url": "https://glygen.org/publication/PubMed/9256427" } ] }, { "title": "Stat1 associates with c-kit and is activated in response to stem cell factor.", "journal": "The Biochemical journal", "date": "1997", "authors": "Deberry C, Mou S, Linnekin D", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "9355737", "url": "https://glygen.org/publication/PubMed/9355737" } ] }, { "title": "Functional role for Syk tyrosine kinase in natural killer cell-mediated natural cytotoxicity.", "journal": "The Journal of experimental medicine", "date": "1997", "authors": "Brumbaugh KM, Binstadt BA, Billadeau DD, Schoon RA, Dick CJ, Ten RM, Leibson PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2424491", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2424491" } ], "reference": [ { "type": "PubMed", "id": "9396765", "url": "https://glygen.org/publication/PubMed/9396765" } ] }, { "title": "Analysis of c-kit receptor dimerization by fluorescence resonance energy transfer.", "journal": "Blood", "date": "1998", "authors": "Broudy VC, Lin NL, Buhring HJ, Komatsu N, Kavanagh TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "9446650", "url": "https://glygen.org/publication/PubMed/9446650" } ] }, { "title": "Immunoreceptor DAP12 bearing a tyrosine-based activation motif is involved in activating NK cells.", "journal": "Nature", "date": "1998", "authors": "Lanier LL, Corliss BC, Wu J, Leong C, Phillips JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2424491", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2424491" } ], "reference": [ { "type": "PubMed", "id": "9490415", "url": "https://glygen.org/publication/PubMed/9490415" } ] }, { "title": "Differential activation of stress-activated protein kinase kinases SKK4/MKK7 and SKK1/MKK4 by the mixed-lineage kinase-2 and mitogen-activated protein kinase kinase (MKK) kinase-1.", "journal": "The Biochemical journal", "date": "1998", "authors": "Cuenda A, Dorow DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "9639556", "url": "https://glygen.org/publication/PubMed/9639556" } ] }, { "title": "The structural basis of the activation of Ras by Sos.", "journal": "Nature", "date": "1998", "authors": "Boriack-Sjodin PA, Margarit SM, Bar-Sagi D, Kuriyan J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2424491", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2424491" } ], "reference": [ { "type": "PubMed", "id": "9690470", "url": "https://glygen.org/publication/PubMed/9690470" } ] }, { "title": "Kit signaling through PI 3-kinase and Src kinase pathways: an essential role for Rac1 and JNK activation in mast cell proliferation.", "journal": "The EMBO journal", "date": "1998", "authors": "Timokhina I, Kissel H, Stella G, Besmer P", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "9799234", "url": "https://glygen.org/publication/PubMed/9799234" } ] }, { "title": "DAP12-mediated signal transduction in natural killer cells. A dominant role for the Syk protein-tyrosine kinase.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "McVicar DW, Taylor LS, Gosselin P, Willette-Brown J, Mikhael AI, Geahlen RL, Nakamura MC, Linnemeyer P, Seaman WE, Anderson SK, Ortaldo JR, Mason LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2424491", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2424491" } ], "reference": [ { "type": "PubMed", "id": "9830044", "url": "https://glygen.org/publication/PubMed/9830044" } ] }, { "title": "Regulation of PAK activation and the T cell cytoskeleton by the linker protein SLP-76.", "journal": "Immunity", "date": "1998", "authors": "Bubeck Wardenburg J, Pappu R, Bu JY, Mayer B, Chernoff J, Straus D, Chan AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "9846482", "url": "https://glygen.org/publication/PubMed/9846482" } ] }, { "title": "Gads is a novel SH2 and SH3 domain-containing adaptor protein that binds to tyrosine-phosphorylated Shc.", "journal": "Oncogene", "date": "1998", "authors": "Liu SK, McGlade CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1433557", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557" } ], "reference": [ { "type": "PubMed", "id": "9872323", "url": "https://glygen.org/publication/PubMed/9872323" } ] }, { "title": "Molecular cloning and expression of human grap-2, a novel leukocyte-specific SH2- and SH3-containing adaptor-like protein that binds to gab-1.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1998", "authors": "Qiu M, Hua S, Agrawal M, Li G, Cai J, Chan E, Zhou H, Luo Y, Liu M", "evidence": [ { "database": "UniProtKB", "id": "O75791", "url": "https://www.uniprot.org/uniprot/O75791" } ], "reference": [ { "type": "PubMed", "id": "9878555", "url": "https://glygen.org/publication/PubMed/9878555" } ] }, { "title": "p85 subunit of PI3 kinase does not bind to human Flt3 receptor, but associates with SHP2, SHIP, and a tyrosine-phosphorylated 100-kDa protein in Flt3 ligand-stimulated hematopoietic cells.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Zhang S, Broxmeyer HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "9918857", "url": "https://glygen.org/publication/PubMed/9918857" } ] }, { "title": "Identification of tyrosine phosphorylation sites in the CD28 cytoplasmic domain and their role in the costimulation of Jurkat T cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Sadra A, Cinek T, Arellano JL, Shi J, Truitt KE, Imboden JB", "evidence": [ { "database": "Reactome", "id": "R-HSA-389356", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389356" } ], "reference": [ { "type": "PubMed", "id": "9973466", "url": "https://glygen.org/publication/PubMed/9973466" } ] }, { "title": "Mechanism of activation of Pak1 kinase by membrane localization.", "journal": "Oncogene", "date": "1999", "authors": "Lu W, Mayer BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "9989831", "url": "https://glygen.org/publication/PubMed/9989831" } ] } ], "pathway": [ { "id": "hsa:9402", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9402", "resource": "KEGG Pathway" }, { "id": "R-HSA-1433557", "name": "Signaling by SCF-KIT", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557", "resource": "Reactome", "description": "Signaling by SCF-KIT" }, { "id": "R-HSA-202433", "name": "Generation of second messenger molecules", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433", "resource": "Reactome", "description": "Generation of second messenger molecules" }, { "id": "R-HSA-2424491", "name": "DAP12 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2424491", "resource": "Reactome", "description": "DAP12 signaling" }, { "id": "R-HSA-2871796", "name": "FCERI mediated MAPK activation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796", "resource": "Reactome", "description": "FCERI mediated MAPK activation" }, { "id": "R-HSA-2871809", "name": "FCERI mediated Ca+2 mobilization", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809", "resource": "Reactome", "description": "FCERI mediated Ca+2 mobilization" }, { "id": "R-HSA-389356", "name": "CD28 co-stimulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389356", "resource": "Reactome", "description": "CD28 co-stimulation" }, { "id": "R-HSA-9607240", "name": "FLT3 Signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240", "resource": "Reactome", "description": "FLT3 Signaling" }, { "id": "R-HSA-9680350", "name": "Signaling by CSF1 (M-CSF) in myeloid cells", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350", "resource": "Reactome", "description": "Signaling by CSF1 (M-CSF) in myeloid cells" } ], "orthologs": [ { "uniprot_canonical_ac": "O89100-1", "protein_name": "GRB2-related adaptor protein 2", "gene_name": "Grap2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MEATAKFDFMASGEDELSFRTGDILKILSNQEEWLKAELGSQEGYVPKNFIDIEFPEWFHEGLSRHQAENLLMGKDIGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDTKGNYFLWTEKFPSLNKLVDYYRTTSISKQKQVFLRDGTQDQGHRGNSLDRRSQGGPHPSGTVGEEIRPSVNRKLSDHLPLGPQQFHPHQQPSPQFTPGPQPPQQQRYLQHFHQDRRGGSLDINDGHCGLGSEVNATLMHRRHTDPVQLQAAGRVRWARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMMR", "length": 322 }, "evidence": [ { "id": "45926110", "url": "http://www.informatics.jax.org/homology/45926110", "database": "MGI" }, { "id": "O75791", "url": "https://omabrowser.org/oma/group/O75791/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q3KR57-1", "protein_name": "GRB2-related adaptor protein 2", "gene_name": "Grap2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MEAIAKFDFMASGEDELSFHTGDILKILSNQEEWLKAELGSQEGYVPKNFIDIKFPEWFHEGLSRHQAENLLMGKEIGFFVIRASQSSPGDFSISVRHEDDVQHFKVMRDTKGNYFLWTEKFPSLNKLVDYYRTTSISKQKQIFLRDGTQDQQGHRGNSLDRRTQGGPPREVPSGTAGEEIRPLMNRKLSDHLPLGTQQFHPHQQLPPQFPPGPQPPPQQRYLQHFHQDRRGGSLDINDGHLGIGSEMNATLMHRRHTDPVQLQAAGRVRWARALYDFEALEEDELGLRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMMR", "length": 326 }, "evidence": [ { "id": "45926110", "url": "http://www.informatics.jax.org/homology/45926110", "database": "MGI" }, { "id": "O75791", "url": "https://omabrowser.org/oma/group/O75791/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O75791", "url": "https://www.uniprot.org/uniprot/O75791" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O75791", "url": "https://www.uniprot.org/uniprot/O75791" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "O75791", "url": "https://www.uniprot.org/uniprot/O75791" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O75791", "url": "https://www.uniprot.org/uniprot/O75791" } ], "pmid": "" }, { "name": "endosome", "id": "GO:0005768", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005768", "evidence": [ { "database": "UniProtKB", "id": "O75791", "url": "https://www.uniprot.org/uniprot/O75791" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "O75791", "url": "https://www.uniprot.org/uniprot/O75791" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "phosphotyrosine residue binding", "id": "GO:0001784", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001784", "evidence": [ { "database": "UniProtKB", "id": "O75791", "url": "https://www.uniprot.org/uniprot/O75791" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "O75791", "url": "https://www.uniprot.org/uniprot/O75791" } ], "pmid": "" }, { "name": "cell-cell signaling", "id": "GO:0007267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007267", "evidence": [ { "database": "UniProtKB", "id": "O75791", "url": "https://www.uniprot.org/uniprot/O75791" } ], "pmid": "" }, { "name": "Ras protein signal transduction", "id": "GO:0007265", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007265", "evidence": [ { "database": "UniProtKB", "id": "O75791", "url": "https://www.uniprot.org/uniprot/O75791" } ], "pmid": "" }, { "name": "regulation of MAPK cascade", "id": "GO:0043408", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043408", "evidence": [ { "database": "UniProtKB", "id": "O75791", "url": "https://www.uniprot.org/uniprot/O75791" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [ 69, 312 ], "glycation_sites": [], "phosphorylation_sites": [ 45, 187, 236, 262 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 198 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }